F358626

General Info

Members Datasets Scaffolds Average Seq Length
246 177 492 154

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3003665799|3003669208
Length 186
Sequence AANGRVNPRRVSVGDEHPGGLTFAIFRSINCYMKRDSRLSGILHVLLHMAEEPGPLTSEALATAMQTNPAVVRRTMAGLREAGFVRSGRGHGGGWTIARDLAEITLLDIHVALGSPDLFAIGNRTEAPGCLVEQAVNAALDDGFREAERVLLERFGSVTLAALSADFHARLAARGGTLTLEQAHAV

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
49 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
50 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
51 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
52 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
53 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
54 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
84 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
85 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
97 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
98 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
106 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
107 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
108 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
109 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
110 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
111 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
116 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
117 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
118 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
119 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
133 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
134 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
135 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
136 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
137 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
138 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
139 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
153 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
156 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
157 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
158 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
159 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
160 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
161 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
162 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
163 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
164 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
165 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
166 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
167 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
168 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
169 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
170 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
171 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
172 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
173 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
174 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
175 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
176 2941479691
177 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.53
Metatranscriptomes 0
Isolates 4.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.36
Nodule 4.88
Rhizoplane 6.5
Rhizosphere 57.72
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10004274 3300003215 Bacteria 7724
2 rootL2_10168890 3300003322 Bacteria 2772
3 rootL2_10221976 3300003322 Bacteria 1578
4 Ga0055524_1037393 3300003775 Bacteria 1288
5 Ga0055536_1019450 3300003781 Bacteria 2134
6 Ga0055530_10000632 3300003791 Bacteria 30392
7 Ga0055530_10052290 3300003791 Bacteria 943
8 Ga0055531_10000643 3300003794 Bacteria 30167
9 Ga0055531_10007136 3300003794 Bacteria 6164
10 Ga0065165_1000415 3300005262 Bacteria 67666
11 Ga0065165_1027095 3300005262 Bacteria 1874
12 Ga0070676_10153324 3300005328 Bacteria 1477
13 Ga0070661_100012211 3300005344 Bacteria 6005
14 Ga0070668_100014658 3300005347 Bacteria 5858
15 Ga0070668_100019133 3300005347 Bacteria 5149
16 Ga0070659_100109650 3300005366 Bacteria 2228
17 Ga0070659_100750780 3300005366 Bacteria 846
18 Ga0070663_100228818 3300005455 Bacteria 1463
19 Ga0070662_100005031 3300005457 Bacteria 8411
20 Ga0068867_100538495 3300005459 Bacteria 1009
21 Ga0068867_100560783 3300005459 Bacteria 991
22 Ga0070684_100023179 3300005535 Bacteria 5187
23 Ga0070672_100005227 3300005543 Bacteria 8592
24 Ga0070686_100142317 3300005544 Unclassified 1671
25 Ga0070693_100571255 3300005547 Bacteria 812
26 Ga0070665_100346356 3300005548 Bacteria 1491
27 Ga0068855_100074179 3300005563 Bacteria 3952
28 Ga0068855_100740276 3300005563 Bacteria 1049
29 Ga0068855_100907973 3300005563 Bacteria 930
30 Ga0070664_100005110 3300005564 Bacteria 10533
31 Ga0070664_101186657 3300005564 Bacteria 720
32 Ga0068857_100000324 3300005577 Bacteria 32787
33 Ga0068854_100431398 3300005578 Bacteria 1097
34 Ga0068852_100057433 3300005616 Bacteria 3367
35 Ga0068859_100117906 3300005617 Bacteria 2720
36 Ga0068859_100937594 3300005617 Bacteria 949
37 Ga0068858_100261316 3300005842 Bacteria 1645
38 Ga0068860_100077425 3300005843 Bacteria 3162
39 Ga0075363_100259902 3300006048 Bacteria 1001
40 Ga0075367_10140133 3300006178 Bacteria 1498
41 Ga0075366_10053859 3300006195 Bacteria 2390
42 Ga0075370_10076096 3300006353 Bacteria 1924
43 Ga0075433_10059122 3300006852 Bacteria 3353
44 Ga0068865_100238241 3300006881 Bacteria 1430
45 Ga0068865_100682245 3300006881 Bacteria 876
46 Ga0068865_100866741 3300006881 Bacteria 783
47 Ga0097620_100117912 3300006931 Bacteria 2720
48 Ga0097620_100937565 3300006931 Bacteria 949
49 Ga0079104_1000993 3300006946 Bacteria 21991
50 Ga0079104_1024104 3300006946 Bacteria 1607
51 Ga0105245_10221096 3300009098 Bacteria 1827
52 Ga0105245_11008365 3300009098 Bacteria 877
53 Ga0114129_13476174 3300009147 Bacteria 504
54 Ga0105243_12592882 3300009148 Bacteria 547
55 Ga0105241_11274900 3300009174 Bacteria 699
56 Ga0105237_10299461 3300009545 Bacteria 1611
57 Ga0105249_10004213 3300009553 Bacteria 12430
58 Ga0157371_10225311 3300013102 Bacteria 1347
59 Ga0157372_10182648 3300013307 Bacteria 2428
60 Ga0163163_10031768 3300014325 Bacteria 5098
61 Ga0157380_11778073 3300014326 Bacteria 675
62 Ga0157377_10022527 3300014745 Bacteria 3327
63 Ga0157379_10195081 3300014968 Bacteria 1830
64 Ga0214542_1017209 3300021321 Bacteria 6640
65 Ga0214543_1000049 3300021327 Bacteria 149506
66 Ga0228711_1000013 3300022739 Bacteria 132585
67 Ga0228710_1000008 3300022740 Bacteria 174306
68 Ga0209129_1038886 3300025258 Bacteria 761
69 Ga0209233_1004738 3300025261 Bacteria 4588
70 Ga0207666_1016480 3300025271 Bacteria 1060
71 Ga0209675_1000184 3300025291 Bacteria 70175
72 Ga0209676_1000133 3300025292 Bacteria 184430
73 Ga0209676_1000174 3300025292 Bacteria 153292
74 Ga0209676_1000543 3300025292 Bacteria 58059
75 Ga0209676_1035442 3300025292 Bacteria 1463
76 Ga0209564_1004260 3300025295 Bacteria 8886
77 Ga0209564_1023497 3300025295 Bacteria 2139
78 Ga0209564_1061775 3300025295 Bacteria 833
79 Ga0209758_1000015 3300025297 Bacteria 851943
80 Ga0209758_1001092 3300025297 Bacteria 35145
81 Ga0209758_1004379 3300025297 Bacteria 11803
82 Ga0209758_1025810 3300025297 Bacteria 2565
83 Ga0209050_1000067 3300025298 Bacteria 304206
84 Ga0209050_1002514 3300025298 Bacteria 15420
85 Ga0209050_1013458 3300025298 Bacteria 3628
86 Ga0209256_1004535 3300025299 Bacteria 8650
87 Ga0207426_1019923 3300025302 Bacteria 2339
88 Ga0207426_1048444 3300025302 Bacteria 1277
89 Ga0209257_1000132 3300025304 Bacteria 210870
90 Ga0209257_1000982 3300025304 Bacteria 38708
91 Ga0209257_1001152 3300025304 Bacteria 33656
92 Ga0209257_1038351 3300025304 Bacteria 1452
93 Ga0207697_10402106 3300025315 Bacteria 608
94 Ga0207645_10003492 3300025907 Bacteria 11902
95 Ga0207663_10911899 3300025916 Bacteria 703
96 Ga0207649_10042299 3300025920 Bacteria 2779
97 Ga0207681_10021449 3300025923 Bacteria 4106
98 Ga0207687_10342262 3300025927 Bacteria 1216
99 Ga0207690_10064312 3300025932 Bacteria 2504
100 Ga0207706_10002015 3300025933 Bacteria 19881
101 Ga0207706_10900670 3300025933 Bacteria 747
102 Ga0207704_10156380 3300025938 Bacteria 1616
103 Ga0207704_10539726 3300025938 Bacteria 946
104 Ga0207691_10003037 3300025940 Bacteria 16370
105 Ga0207679_10003141 3300025945 Bacteria 10201
106 Ga0207679_10032762 3300025945 Bacteria 3652
107 Ga0207667_10060908 3300025949 Bacteria 3950
108 Ga0207667_10705826 3300025949 Bacteria 1011
109 Ga0207667_11059764 3300025949 Bacteria 795
110 Ga0207712_10016007 3300025961 Bacteria 4848
111 Ga0207677_10150990 3300026023 Bacteria 1792
112 Ga0207677_10632659 3300026023 Bacteria 942
113 Ga0207703_10354217 3300026035 Bacteria 1352
114 Ga0207639_10399247 3300026041 Bacteria 1238
115 Ga0207678_10053757 3300026067 Bacteria 3469
116 Ga0207678_10313725 3300026067 Bacteria 1348
117 Ga0207648_10015270 3300026089 Bacteria 7065
118 Ga0207648_10769127 3300026089 Bacteria 895
119 Ga0207674_10006572 3300026116 Bacteria 13668
120 Ga0207674_10023727 3300026116 Bacteria 6565
121 Ga0207698_10563515 3300026142 Bacteria 1118
122 Ga0209281_1000134 3300027111 Bacteria 185406
123 Ga0209282_1000029 3300027666 Bacteria 157883
124 Ga0209974_10071871 3300027876 Bacteria 1181
125 Ga0268266_10072819 3300028379 Bacteria 2980
126 Ga0268266_11730938 3300028379 Bacteria 600
127 Ga0268265_10151478 3300028380 Bacteria 1956
128 Ga0268265_10622726 3300028380 Bacteria 1034
129 Ga0316183_1115565 3300030742 Bacteria 954
130 Ga0307408_100000005 3300031548 Bacteria 529098
131 Ga0307408_100002321 3300031548 Bacteria 13477
132 Ga0307408_101660608 3300031548 Bacteria 608
133 Ga0307405_10387352 3300031731 Bacteria 1090
134 Ga0307406_10000030 3300031901 Bacteria 87564
135 Ga0307406_10001141 3300031901 Bacteria 14860
136 Ga0307406_10548771 3300031901 Bacteria 945
137 Ga0307412_10003750 3300031911 Bacteria 8445
138 Ga0307412_10004002 3300031911 Bacteria 8216
139 Ga0307412_10900648 3300031911 Bacteria 775
140 Ga0315914_1000021 3300031967 Bacteria 119592
141 Ga0307414_10000320 3300032004 Bacteria 27424
142 Ga0307414_10013772 3300032004 Bacteria 4824
143 Ga0307414_10095702 3300032004 Bacteria 2220
144 Ga0307414_10376345 3300032004 Bacteria 1226
145 Ga0307414_10462623 3300032004 Bacteria 1115
146 Ga0307414_10761908 3300032004 Bacteria 880
147 Ga0307411_11465138 3300032005 Bacteria 626
148 Ga0315913_1000014 3300033430 Bacteria 120114
149 Ga0315915_1000003 3300033464 Bacteria 407996
150 Ga0373945_0341089 3300035116 Bacteria 648
151 Ga0373937_0813142 3300036401 Bacteria 883
152 Ga0395905_0000571 3300037471 Bacteria 49947
153 Ga0395905_0041262 3300037471 Bacteria 4330
154 Ga0466964_0242800 3300044706 Bacteria 884
155 Ga0466957_0809577 3300044842 Bacteria 666
156 Ga0466960_0170153 3300044901 Bacteria 1175
157 Ga0451576_0657619 3300045051 Unclassified 1101
158 Ga0495617_075295 3300046452 Bacteria 1108
159 Ga0495603_0052518 3300046455 Bacteria 2420
160 Ga0495585_0208043 3300046492 Bacteria 993
161 Ga0495648_0083211 3300046524 Bacteria 1814
162 Ga0495622_0048794 3300046557 Bacteria 1966
163 Ga0495668_0000002 3300046616 Bacteria 763179
164 Ga0495611_0208124 3300046648 Bacteria 911
165 Ga0495625_0000655 3300046660 Bacteria 49468
166 Ga0495661_0057497 3300046665 Bacteria 2322
167 Ga0495658_0116742 3300046683 Bacteria 1610
168 Ga0495624_0037204 3300046690 Bacteria 3134
169 Ga0495649_0389182 3300046694 Bacteria 701
170 Ga0495604_0299311 3300047317 Bacteria 1081
171 Ga0495679_178584 3300047446 Bacteria 563
172 Ga0496100_0134882 3300048903 Bacteria 1743
173 Ga0496101_0017602 3300048904 Bacteria 4848
174 Ga0496102_0454922 3300048905 Bacteria 1201
175 Ga0496103_0224844 3300048906 Bacteria 1207
176 Ga0496104_0005869 3300048907 Bacteria 10759
177 Ga0496104_0410658 3300048907 Bacteria 1266
178 Ga0496105_0010241 3300048908 Bacteria 7371
179 Ga0496106_0018535 3300048909 Bacteria 5148
180 Ga0496107_0015368 3300048910 Bacteria 5364
181 Ga0496107_0428158 3300048910 Bacteria 984
182 Ga0496109_0227404 3300048912 Bacteria 1755
183 Ga0496110_0387833 3300048913 Bacteria 1273
184 Ga0496111_0233946 3300048914 Bacteria 1365
185 Ga0496113_0698981 3300048916 Bacteria 809
186 Ga0496114_1447595 3300048917 Bacteria 575
187 Ga0496117_0022620 3300048920 Bacteria 5038
188 Ga0496118_0094473 3300048921 Bacteria 2045
189 Ga0496119_0099518 3300048922 Bacteria 1635
190 Ga0496119_0151957 3300048922 Bacteria 1239
191 Ga0496121_0032520 3300048924 Bacteria 4739
192 Ga0496121_0055211 3300048924 Bacteria 3311
193 Ga0496124_0335684 3300048927 Bacteria 1076
194 Ga0496125_0103290 3300048928 Bacteria 2092
195 Ga0496126_0004765 3300048929 Bacteria 15974
196 Ga0496126_0039370 3300048929 Bacteria 4387
197 Ga0496126_0129464 3300048929 Bacteria 2182
198 Ga0496126_0214592 3300048929 Bacteria 1619
199 Ga0496126_0445394 3300048929 Bacteria 1043
200 Ga0501300_015723 3300049523 Bacteria 1105
201 Ga0501031_0115595 3300049568 Bacteria 1753
202 Ga0501032_0019758 3300049569 Bacteria 4705
203 Ga0501033_0069824 3300049570 Bacteria 2581
204 Ga0501033_0322760 3300049570 Bacteria 1084
205 Ga0501034_0037079 3300049571 Bacteria 4937
206 Ga0501034_0082198 3300049571 Bacteria 3223
207 Ga0501034_0179794 3300049571 Bacteria 2080
208 Ga0501038_0118722 3300049574 Bacteria 2183
209 Ga0501039_0028642 3300049575 Bacteria 4288
210 Ga0501046_0123913 3300049580 Bacteria 1965
211 Ga0501047_0042849 3300049581 Bacteria 4372
212 Ga0501047_0295075 3300049581 Bacteria 1464
213 Ga0501048_0149163 3300049582 Bacteria 1654
214 Ga0501235_065534 3300049669 Bacteria 855
215 Ga0501035_0284571 3300049822 Bacteria 1396
216 Ga0501044_0082114 3300049823 Bacteria 3261
217 Ga0501284_09295 3300050005 Bacteria 594
218 nmdc:mga03n38_460995_c1 3300050490 Bacteria 708
219 nmdc:mga0k408_83296_c1 3300050493 Bacteria 1875
220 nmdc:mga06z11_51939_c1 3300050494 Bacteria 2100
221 Ga0500643_000079 3300053087 Bacteria 104107
222 Ga0500643_001317 3300053087 Bacteria 14582
223 Ga0500644_0026591 3300053088 Bacteria 1792
224 Ga0500651_0321372 3300053093 Bacteria 884
225 Ga0500566_0204833 3300053094 Bacteria 993
226 Ga0500557_000034 3300053105 Bacteria 71225
227 Ga0500608_001076 3300053122 Bacteria 9745
228 Ga0500642_0000053 3300053130 Bacteria 71632
229 Ga0500642_0128364 3300053130 Bacteria 1188
230 Ga0500568_0004017 3300053139 Bacteria 7976
231 Ga0500590_096425 3300053148 Bacteria 1427
232 Ga0500622_0002353 3300053156 Bacteria 13743
233 Ga0500622_0020412 3300053156 Bacteria 3519
234 Ga0500622_0056039 3300053156 Bacteria 2018
235 Ga0500636_0280586 3300053177 Bacteria 832
236 3003669208 3003665799 Bacteria 7279786
237 2512535101 2512047086 Bacteria 6850303
238 2587735132 2585428058 Bacteria 6853932
239 2599902407 2599185292 Bacteria 6290804
240 2643832953 2643221563 Bacteria 4726935
241 2644053252 2643221608 Bacteria 4724829
242 2687239576 2684623219 Bacteria 8442773
243 2852656476 2852653556 Bacteria 4050083
244 2861694263 2861691609 Bacteria 5628931
245 2941483005
246 2995953461 2995948881 Bacteria 6358104
247 JGI25153J46596_10004274
248 rootL2_10168890
249 rootL2_10221976
250 Ga0055524_1037393
251 Ga0055536_1019450
252 Ga0055530_10000632
253 Ga0055530_10052290
254 Ga0055531_10000643
255 Ga0055531_10007136
256 Ga0065165_1000415
257 Ga0065165_1027095
258 Ga0070676_10153324
259 Ga0070661_100012211
260 Ga0070668_100014658
261 Ga0070668_100019133
262 Ga0070659_100109650
263 Ga0070659_100750780
264 Ga0070663_100228818
265 Ga0070662_100005031
266 Ga0068867_100538495
267 Ga0068867_100560783
268 Ga0070684_100023179
269 Ga0070672_100005227
270 Ga0070686_100142317
271 Ga0070693_100571255
272 Ga0070665_100346356
273 Ga0068855_100074179
274 Ga0068855_100740276
275 Ga0068855_100907973
276 Ga0070664_100005110
277 Ga0070664_101186657
278 Ga0068857_100000324
279 Ga0068854_100431398
280 Ga0068852_100057433
281 Ga0068859_100117906
282 Ga0068859_100937594
283 Ga0068858_100261316
284 Ga0068860_100077425
285 Ga0075363_100259902
286 Ga0075367_10140133
287 Ga0075366_10053859
288 Ga0075370_10076096
289 Ga0075433_10059122
290 Ga0068865_100238241
291 Ga0068865_100682245
292 Ga0068865_100866741
293 Ga0097620_100117912
294 Ga0097620_100937565
295 Ga0079104_1000993
296 Ga0079104_1024104
297 Ga0105245_10221096
298 Ga0105245_11008365
299 Ga0114129_13476174
300 Ga0105243_12592882
301 Ga0105241_11274900
302 Ga0105237_10299461
303 Ga0105249_10004213
304 Ga0157371_10225311
305 Ga0157372_10182648
306 Ga0163163_10031768
307 Ga0157380_11778073
308 Ga0157377_10022527
309 Ga0157379_10195081
310 Ga0214542_1017209
311 Ga0214543_1000049
312 Ga0228711_1000013
313 Ga0228710_1000008
314 Ga0209129_1038886
315 Ga0209233_1004738
316 Ga0207666_1016480
317 Ga0209675_1000184
318 Ga0209676_1000133
319 Ga0209676_1000174
320 Ga0209676_1000543
321 Ga0209676_1035442
322 Ga0209564_1004260
323 Ga0209564_1023497
324 Ga0209564_1061775
325 Ga0209758_1000015
326 Ga0209758_1001092
327 Ga0209758_1004379
328 Ga0209758_1025810
329 Ga0209050_1000067
330 Ga0209050_1002514
331 Ga0209050_1013458
332 Ga0209256_1004535
333 Ga0207426_1019923
334 Ga0207426_1048444
335 Ga0209257_1000132
336 Ga0209257_1000982
337 Ga0209257_1001152
338 Ga0209257_1038351
339 Ga0207697_10402106
340 Ga0207645_10003492
341 Ga0207663_10911899
342 Ga0207649_10042299
343 Ga0207681_10021449
344 Ga0207687_10342262
345 Ga0207690_10064312
346 Ga0207706_10002015
347 Ga0207706_10900670
348 Ga0207704_10156380
349 Ga0207704_10539726
350 Ga0207691_10003037
351 Ga0207679_10003141
352 Ga0207679_10032762
353 Ga0207667_10060908
354 Ga0207667_10705826
355 Ga0207667_11059764
356 Ga0207712_10016007
357 Ga0207677_10150990
358 Ga0207677_10632659
359 Ga0207703_10354217
360 Ga0207639_10399247
361 Ga0207678_10053757
362 Ga0207678_10313725
363 Ga0207648_10015270
364 Ga0207648_10769127
365 Ga0207674_10006572
366 Ga0207674_10023727
367 Ga0207698_10563515
368 Ga0209281_1000134
369 Ga0209282_1000029
370 Ga0209974_10071871
371 Ga0268266_10072819
372 Ga0268266_11730938
373 Ga0268265_10151478
374 Ga0268265_10622726
375 Ga0316183_1115565
376 Ga0307408_100000005
377 Ga0307408_100002321
378 Ga0307408_101660608
379 Ga0307405_10387352
380 Ga0307406_10000030
381 Ga0307406_10001141
382 Ga0307406_10548771
383 Ga0307412_10003750
384 Ga0307412_10004002
385 Ga0307412_10900648
386 Ga0315914_1000021
387 Ga0307414_10000320
388 Ga0307414_10013772
389 Ga0307414_10095702
390 Ga0307414_10376345
391 Ga0307414_10462623
392 Ga0307414_10761908
393 Ga0307411_11465138
394 Ga0315913_1000014
395 Ga0315915_1000003
396 Ga0373945_0341089
397 Ga0373937_0813142
398 Ga0395905_0000571
399 Ga0395905_0041262
400 Ga0466964_0242800
401 Ga0466957_0809577
402 Ga0466960_0170153
403 Ga0451576_0657619
404 Ga0495617_075295
405 Ga0495603_0052518
406 Ga0495585_0208043
407 Ga0495648_0083211
408 Ga0495622_0048794
409 Ga0495668_0000002
410 Ga0495611_0208124
411 Ga0495625_0000655
412 Ga0495661_0057497
413 Ga0495658_0116742
414 Ga0495624_0037204
415 Ga0495649_0389182
416 Ga0495604_0299311
417 Ga0495679_178584
418 Ga0496100_0134882
419 Ga0496101_0017602
420 Ga0496102_0454922
421 Ga0496103_0224844
422 Ga0496104_0005869
423 Ga0496104_0410658
424 Ga0496105_0010241
425 Ga0496106_0018535
426 Ga0496107_0015368
427 Ga0496107_0428158
428 Ga0496109_0227404
429 Ga0496110_0387833
430 Ga0496111_0233946
431 Ga0496113_0698981
432 Ga0496114_1447595
433 Ga0496117_0022620
434 Ga0496118_0094473
435 Ga0496119_0099518
436 Ga0496119_0151957
437 Ga0496121_0032520
438 Ga0496121_0055211
439 Ga0496124_0335684
440 Ga0496125_0103290
441 Ga0496126_0004765
442 Ga0496126_0039370
443 Ga0496126_0129464
444 Ga0496126_0214592
445 Ga0496126_0445394
446 Ga0501300_015723
447 Ga0501031_0115595
448 Ga0501032_0019758
449 Ga0501033_0069824
450 Ga0501033_0322760
451 Ga0501034_0037079
452 Ga0501034_0082198
453 Ga0501034_0179794
454 Ga0501038_0118722
455 Ga0501039_0028642
456 Ga0501046_0123913
457 Ga0501047_0042849
458 Ga0501047_0295075
459 Ga0501048_0149163
460 Ga0501235_065534
461 Ga0501035_0284571
462 Ga0501044_0082114
463 Ga0501284_09295
464 nmdc:mga03n38_460995_c1
465 nmdc:mga0k408_83296_c1
466 nmdc:mga06z11_51939_c1
467 Ga0500643_000079
468 Ga0500643_001317
469 Ga0500644_0026591
470 Ga0500651_0321372
471 Ga0500566_0204833
472 Ga0500557_000034
473 Ga0500608_001076
474 Ga0500642_0000053
475 Ga0500642_0128364
476 Ga0500568_0004017
477 Ga0500590_096425
478 Ga0500622_0002353
479 Ga0500622_0020412
480 Ga0500622_0056039
481 Ga0500636_0280586
482 3003669208
483 2512535101
484 2587735132
485 2599902407
486 2643832953
487 2644053252
488 2687239576
489 2852656476
490 2861694263
491 2941483005
492 2995953461

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02082

Rrf2

Iron-dependent Transcriptional regulator

35

166

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j75-assembly1.cif.gz_A-2 crystal structure of the dna-binding domain zalpha of dlm-1 bound to z-dna 0.9226 9 65
4hob-assembly2.cif.gz_C the crystal structure of the zalpha domain from cyprinid herpes virus 3 0.9182 8 59
2heo-assembly1.cif.gz_D general structure-based approach to the design of protein ligands: application to the design of kv1.2 potassium channel blockers. 0.9164 9 65
3irq-assembly1.cif.gz_D crystal structure of a z-z junction 0.9154 9 67
4wcg-assembly1.cif.gz_B the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna 0.9144 8 65
ID Description Score Start End Superfamily
af_P71977_12_75_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9422 5 67 1.10.10.10
4ijaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.925 10 65 1.10.10.10
af_Q9QY24_7_70_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9219 5 67 1.10.10.10
af_Q5ADM0_558_717_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.9202 9 68 3.30.230.130
4hobC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9182 8 59 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A0S7C699-F1-model_v4 Transcriptional regulator, BadM/Rrf2 family 0.8709 1 84 GO:0003700
GO:0005829
AF-A0A4S0JJL4-F1-model_v4 Transcriptional regulator 0.8682 1 86 GO:0003700
GO:0005829
AF-A0A3D5QAJ3-F1-model_v4 Rrf2 family transcriptional regulator 0.868 6 85 GO:0003700
GO:0005829
AF-A0A432K8R1-F1-model_v4 Rrf2 family transcriptional regulator 0.8655 1 80 GO:0003700
GO:0005829
AF-A0A101HX88-F1-model_v4 Transcriptional regulator, BadM/Rrf2 family 0.8653 1 84 GO:0003700
GO:0005829

Map