F358581

General Info

Members Datasets Scaffolds Average Seq Length
246 141 492 146

Family's Representative Sequence

Representative Sequence 3300061734|Ga0530510_0297337|Ga0530510_0297337_244_735
Length 163
Sequence MSAGRADAAKAVDRIGGTVRNRVEVMHGVNLDMLGHRDPEHYGTLTYSELELRIKRYAGGLGLEVTFFHTNHEGEFVEHLHRLPDVADAALLNPGAWTHYSYAIRDALEIAGLPAIEVHLSDVSSREEWRRKSVLDGLVIGVVAGQGEEGYRVALERLKEALA

Samples

Sample ID Description Type Environment
1 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
42 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
53 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
54 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
55 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
56 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
57 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
58 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
59 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
60 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
61 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
62 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
63 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
64 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
68 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
69 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
70 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
71 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
72 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
80 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
81 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
86 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
87 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
94 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
97 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
98 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
101 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
102 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
103 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
104 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 2.44
Rhizosphere 93.09
Stem 0
Stem Tuber 0
Unclassified 4.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0530510_0297337 3300061734 Unclassified 1208
2 JGI25407J50210_10024337 3300003373 Bacteria 1570
3 Ga0070683_100484716 3300005329 Bacteria 1181
4 Ga0070683_100626723 3300005329 Bacteria 1029
5 Ga0070680_100631920 3300005336 Bacteria 920
6 Ga0070680_101456000 3300005336 Bacteria 593
7 Ga0068868_101136128 3300005338 Bacteria 720
8 Ga0070689_100974375 3300005340 Unclassified 753
9 Ga0070691_11041244 3300005341 Unclassified 513
10 Ga0070661_100627477 3300005344 Bacteria 871
11 Ga0070661_101029478 3300005344 Bacteria 684
12 Ga0070668_100242413 3300005347 Bacteria 1494
13 Ga0070703_10117596 3300005406 Bacteria 960
14 Ga0070694_100093340 3300005444 Bacteria 2116
15 Ga0070694_100360394 3300005444 Bacteria 1129
16 Ga0070694_100375131 3300005444 Bacteria 1108
17 Ga0070663_101398141 3300005455 Bacteria 620
18 Ga0070698_101311472 3300005471 Bacteria 674
19 Ga0070679_100706332 3300005530 Bacteria 951
20 Ga0070679_101858080 3300005530 Bacteria 551
21 Ga0070684_100158641 3300005535 Bacteria 2051
22 Ga0070684_101882261 3300005535 Bacteria 564
23 Ga0070672_100388449 3300005543 Bacteria 1195
24 Ga0070695_100600532 3300005545 Bacteria 864
25 Ga0070695_100960590 3300005545 Bacteria 693
26 Ga0070696_100161302 3300005546 Bacteria 1652
27 Ga0070696_100864349 3300005546 Bacteria 748
28 Ga0070704_100123408 3300005549 Bacteria 1994
29 Ga0070704_100288037 3300005549 Bacteria 1364
30 Ga0070704_100579466 3300005549 Bacteria 984
31 Ga0070704_100884332 3300005549 Bacteria 803
32 Ga0068854_100133943 3300005578 Bacteria 1895
33 Ga0068866_10686450 3300005718 Bacteria 701
34 Ga0068861_100445450 3300005719 Bacteria 1159
35 Ga0081455_10020542 3300005937 Bacteria 6214
36 Ga0081455_10063274 3300005937 Bacteria 3105
37 Ga0081455_10230567 3300005937 Bacteria 1367
38 Ga0081538_10000189 3300005981 Bacteria 67621
39 Ga0081538_10000673 3300005981 Bacteria 37575
40 Ga0081538_10001368 3300005981 Bacteria 25106
41 Ga0081538_10020688 3300005981 Bacteria 4831
42 Ga0081539_10072304 3300005985 Bacteria 1844
43 Ga0075428_100148314 3300006844 Bacteria 2549
44 Ga0075428_101063902 3300006844 Bacteria 855
45 Ga0075430_100043306 3300006846 Bacteria 3804
46 Ga0075430_101737041 3300006846 Bacteria 512
47 Ga0075431_100032664 3300006847 Bacteria 5364
48 Ga0075431_100046421 3300006847 Bacteria 4479
49 Ga0075434_100048448 3300006871 Bacteria 4216
50 Ga0068865_100857967 3300006881 Bacteria 787
51 Ga0111539_10206827 3300009094 Bacteria 2288
52 Ga0111539_10447634 3300009094 Bacteria 1504
53 Ga0111539_10766636 3300009094 Bacteria 1123
54 Ga0114129_10046745 3300009147 Bacteria 6083
55 Ga0114129_10325015 3300009147 Bacteria 2044
56 Ga0114129_10818335 3300009147 Bacteria 1187
57 Ga0114129_11670418 3300009147 Bacteria 778
58 Ga0105242_11017871 3300009176 Bacteria 837
59 Ga0105249_10523051 3300009553 Bacteria 1234
60 Ga0157369_10675255 3300013105 Bacteria 1064
61 Ga0157369_12131422 3300013105 Bacteria 568
62 Ga0163163_11731930 3300014325 Bacteria 685
63 Ga0157380_10450668 3300014326 Bacteria 1236
64 Ga0157376_11045000 3300014969 Bacteria 841
65 Ga0157376_11265261 3300014969 Bacteria 767
66 Ga0206353_11853070 3300020082 Bacteria 666
67 Ga0213876_10043496 3300021384 Bacteria 2374
68 Ga0213875_10000454 3300021388 Bacteria 35453
69 Ga0213875_10061033 3300021388 Bacteria 1762
70 Ga0207649_10469728 3300025920 Bacteria 952
71 Ga0207700_11175901 3300025928 Archaea 685
72 Ga0207670_10701886 3300025936 Bacteria 838
73 Ga0207689_10257615 3300025942 Bacteria 1443
74 Ga0207661_10004874 3300025944 Bacteria 9405
75 Ga0207661_10378866 3300025944 Bacteria 1280
76 Ga0207661_10546550 3300025944 Bacteria 1061
77 Ga0207679_10243766 3300025945 Bacteria 1524
78 Ga0207640_10200553 3300025981 Bacteria 1512
79 Ga0207708_11047778 3300026075 Bacteria 710
80 Ga0207674_10746177 3300026116 Bacteria 945
81 Ga0207698_10384679 3300026142 Bacteria 1336
82 Ga0265319_1004832 3300028563 Bacteria 6596
83 Ga0265318_10004810 3300028577 Bacteria 6465
84 Ga0265338_10124817 3300028800 Bacteria 2044
85 Ga0265320_10002003 3300031240 Bacteria 14381
86 Ga0265325_10483937 3300031241 Bacteria 537
87 Ga0265316_10075649 3300031344 Bacteria 2589
88 Ga0307408_100221656 3300031548 Bacteria 1544
89 Ga0265314_10007814 3300031711 Bacteria 9243
90 Ga0307405_10015502 3300031731 Bacteria 4131
91 Ga0307405_10106484 3300031731 Unclassified 1891
92 Ga0307413_10266308 3300031824 Bacteria 1280
93 Ga0307413_10507340 3300031824 Unclassified 970
94 Ga0307410_10160602 3300031852 Bacteria 1683
95 Ga0307410_10312080 3300031852 Unclassified 1245
96 Ga0307410_10647695 3300031852 Bacteria 886
97 Ga0307406_10131593 3300031901 Bacteria 1757
98 Ga0307407_10053389 3300031903 Bacteria 2325
99 Ga0307407_10111029 3300031903 Bacteria 1721
100 Ga0307407_10159223 3300031903 Bacteria 1476
101 Ga0307407_10599438 3300031903 Bacteria 820
102 Ga0307409_100055728 3300031995 Bacteria 3054
103 Ga0307409_100341284 3300031995 Bacteria 1409
104 Ga0307416_100080986 3300032002 Bacteria 2743
105 Ga0307416_100708146 3300032002 Bacteria 1096
106 Ga0307416_102464862 3300032002 Bacteria 619
107 Ga0307414_10024260 3300032004 Bacteria 3865
108 Ga0307411_10020153 3300032005 Bacteria 3871
109 Ga0307411_10310345 3300032005 Bacteria 1269
110 Ga0307415_100039768 3300032126 Bacteria 3111
111 Ga0307415_100170135 3300032126 Bacteria 1698
112 Ga0307415_101458958 3300032126 Bacteria 653
113 Ga0373960_0283761 3300035121 Bacteria 611
114 Ga0373961_0207800 3300035241 Bacteria 693
115 Ga0373931_0740157 3300035691 Bacteria 652
116 Ga0395900_1058718 3300037418 Bacteria 729
117 Ga0395898_0284155 3300037466 Bacteria 1578
118 Ga0395898_0565007 3300037466 Bacteria 1080
119 Ga0395898_0796101 3300037466 Bacteria 886
120 Ga0395905_0018996 3300037471 Bacteria 6518
121 Ga0436364_0183590 3300037853 Bacteria 35367
122 Ga0436364_1031890 3300037853 Bacteria 1112
123 Ga0436364_1180097 3300037853 Bacteria 39008
124 Ga0436364_1349329 3300037853 Bacteria 5934
125 Ga0395901_0838867 3300038443 Bacteria 905
126 Ga0395901_0878975 3300038443 Bacteria 879
127 Ga0395901_1560074 3300038443 Bacteria 615
128 Ga0436365_0815111 3300039437 Bacteria 2916
129 Ga0436365_1744446 3300039437 Bacteria 5368
130 Ga0436362_0057172 3300039453 Bacteria 929
131 Ga0436362_0514118 3300039453 Bacteria 2420
132 Ga0466969_0019253 3300044656 Bacteria 3552
133 Ga0466965_0042966 3300044683 Bacteria 2231
134 Ga0466966_0096995 3300044684 Bacteria 1826
135 Ga0466966_0275183 3300044684 Bacteria 1013
136 Ga0466961_0138186 3300044693 Bacteria 1526
137 Ga0466963_0006318 3300044694 Bacteria 7007
138 Ga0466963_0019580 3300044694 Bacteria 4248
139 Ga0466963_0024676 3300044694 Bacteria 3828
140 Ga0466963_0046782 3300044694 Bacteria 2854
141 Ga0466963_0105143 3300044694 Bacteria 1935
142 Ga0466963_0656065 3300044694 Bacteria 741
143 Ga0466964_0159380 3300044706 Bacteria 1053
144 Ga0466971_0052984 3300044719 Bacteria 1828
145 Ga0466971_0140771 3300044719 Bacteria 1123
146 Ga0466970_0017635 3300044765 Bacteria 3690
147 Ga0466970_0171630 3300044765 Unclassified 1202
148 Ga0466957_0170509 3300044842 Bacteria 1417
149 Ga0466957_0341919 3300044842 Bacteria 1014
150 Ga0466960_0029643 3300044901 Bacteria 2512
151 Ga0466960_0137014 3300044901 Bacteria 1297
152 Ga0466960_0437601 3300044901 Bacteria 758
153 Ga0466959_0044599 3300045049 Bacteria 3267
154 Ga0466959_0065707 3300045049 Bacteria 2632
155 Ga0466959_0312298 3300045049 Bacteria 1076
156 Ga0466958_0007513 3300045836 Bacteria 6001
157 Ga0466958_0090624 3300045836 Bacteria 1892
158 Ga0466958_0382111 3300045836 Bacteria 908
159 Ga0466958_0472842 3300045836 Bacteria 812
160 Ga0466967_0006630 3300045976 Bacteria 8231
161 Ga0466967_0012802 3300045976 Bacteria 6444
162 Ga0466967_0161247 3300045976 Bacteria 2105
163 Ga0466967_0186690 3300045976 Bacteria 1958
164 Ga0466967_0298937 3300045976 Bacteria 1548
165 Ga0466967_0497025 3300045976 Bacteria 1197
166 Ga0466967_0950149 3300045976 Bacteria 855
167 Ga0466967_1565894 3300045976 Bacteria 656
168 Ga0466967_1841159 3300045976 Bacteria 602
169 Ga0495641_0000111 3300046461 Bacteria 57409
170 Ga0495641_0051407 3300046461 Bacteria 1882
171 Ga0495651_0302000 3300046462 Bacteria 1073
172 Ga0495580_0817190 3300046472 Bacteria 603
173 Ga0495639_0517133 3300046475 Unclassified 610
174 Ga0495596_0197099 3300046500 Bacteria 783
175 Ga0495607_0364084 3300046501 Bacteria 665
176 Ga0495630_0839041 3300046517 Bacteria 701
177 Ga0495631_0251282 3300046518 Bacteria 754
178 Ga0495588_0382589 3300046674 Bacteria 739
179 Ga0495646_0335771 3300046680 Bacteria 794
180 Ga0495658_0572954 3300046683 Bacteria 723
181 Ga0495676_0019112 3300047321 Bacteria 6031
182 Ga0496109_0460967 3300048912 Unclassified 1200
183 Ga0496110_0045950 3300048913 Bacteria 3819
184 Ga0496111_0161086 3300048914 Bacteria 1666
185 Ga0496112_0289250 3300048915 Bacteria 1585
186 Ga0496112_0490885 3300048915 Bacteria 1164
187 Ga0496113_0106018 3300048916 Bacteria 2183
188 Ga0496121_0320024 3300048924 Bacteria 1045
189 Ga0501033_0648796 3300049570 Bacteria 721
190 Ga0501034_1254668 3300049571 Unclassified 619
191 Ga0501036_0283515 3300049572 Bacteria 1386
192 Ga0501036_0377314 3300049572 Bacteria 1183
193 Ga0501039_0155056 3300049575 Bacteria 1799
194 Ga0501039_0472928 3300049575 Bacteria 984
195 Ga0501039_1502762 3300049575 Bacteria 518
196 Ga0501040_0673869 3300049576 Bacteria 748
197 Ga0501041_0074467 3300049577 Bacteria 2086
198 Ga0501043_0396691 3300049579 Bacteria 1043
199 Ga0501046_0128023 3300049580 Bacteria 1927
200 Ga0501046_0525043 3300049580 Bacteria 846
201 Ga0501048_0012256 3300049582 Bacteria 6381
202 Ga0501048_0184539 3300049582 Bacteria 1479
203 Ga0501048_0409678 3300049582 Bacteria 969
204 Ga0501069_0191973 3300049585 Bacteria 1182
205 Ga0501071_0005442 3300049587 Bacteria 8184
206 Ga0501072_0028796 3300049588 Bacteria 4336
207 Ga0501072_0037998 3300049588 Bacteria 3778
208 Ga0501072_0051020 3300049588 Bacteria 3257
209 Ga0501074_0319700 3300049590 Bacteria 1102
210 Ga0501075_0024964 3300049591 Bacteria 4388
211 Ga0501075_0032178 3300049591 Bacteria 3896
212 Ga0501076_0107241 3300049592 Bacteria 2255
213 Ga0501076_0447726 3300049592 Bacteria 1063
214 Ga0501077_0076009 3300049593 Bacteria 2127
215 Ga0501077_0111142 3300049593 Bacteria 1737
216 Ga0501077_0704530 3300049593 Bacteria 649
217 Ga0501079_0037544 3300049741 Bacteria 3734
218 Ga0501079_0069495 3300049741 Bacteria 2718
219 Ga0501081_0033593 3300049743 Bacteria 3486
220 Ga0501081_0047385 3300049743 Bacteria 2957
221 Ga0501083_0076894 3300049744 Bacteria 2215
222 Ga0501035_0361020 3300049822 Bacteria 1214
223 Ga0501045_0055928 3300049824 Bacteria 2886
224 Ga0501045_0150500 3300049824 Bacteria 1731
225 Ga0501045_0574465 3300049824 Bacteria 835
226 nmdc:mga0yw44_662920_c1 3300050492 Bacteria 709
227 nmdc:mga05p37_1192782_c1 3300050507 Bacteria 787
228 nmdc:mga05p37_192072_c1 3300050507 Bacteria 2478
229 nmdc:mga05p37_2229832_c1 3300050507 Unclassified 507
230 nmdc:mga05p37_324009_c1 3300050507 Bacteria 1823
231 nmdc:mga0qj67_842873_c1 3300050509 Bacteria 724
232 nmdc:mga06r32_43702_c1 3300050510 Bacteria 4265
233 nmdc:mga06r32_731721_c1 3300050510 Bacteria 953
234 nmdc:mga06r32_749644_c1 3300050510 Bacteria 940
235 nmdc:mga08y16_1354235_c1 3300050511 Bacteria 676
236 nmdc:mga08y16_142058_c1 3300050511 Bacteria 2496
237 nmdc:mga08y16_274113_c1 3300050511 Bacteria 1741
238 nmdc:mga08y16_444978_c1 3300050511 Bacteria 1322
239 nmdc:mga0n895_43354_c1 3300050512 Bacteria 4384
240 nmdc:mga0rr50_257549_c1 3300050513 Bacteria 1451
241 nmdc:mga08x19_33967_c1 3300050514 Bacteria 3221
242 Ga0501084_0013361 3300054114 Bacteria 6794
243 Ga0501084_0216946 3300054114 Bacteria 1614
244 Ga0501082_0126843 3300060353 Bacteria 2213
245 Ga0501082_1169221 3300060353 Unclassified 672
246 Ga0530510_0058328 3300061734 Bacteria 2791
247 Ga0530510_0297337
248 JGI25407J50210_10024337
249 Ga0070683_100484716
250 Ga0070683_100626723
251 Ga0070680_100631920
252 Ga0070680_101456000
253 Ga0068868_101136128
254 Ga0070689_100974375
255 Ga0070691_11041244
256 Ga0070661_100627477
257 Ga0070661_101029478
258 Ga0070668_100242413
259 Ga0070703_10117596
260 Ga0070694_100093340
261 Ga0070694_100360394
262 Ga0070694_100375131
263 Ga0070663_101398141
264 Ga0070698_101311472
265 Ga0070679_100706332
266 Ga0070679_101858080
267 Ga0070684_100158641
268 Ga0070684_101882261
269 Ga0070672_100388449
270 Ga0070695_100600532
271 Ga0070695_100960590
272 Ga0070696_100161302
273 Ga0070696_100864349
274 Ga0070704_100123408
275 Ga0070704_100288037
276 Ga0070704_100579466
277 Ga0070704_100884332
278 Ga0068854_100133943
279 Ga0068866_10686450
280 Ga0068861_100445450
281 Ga0081455_10020542
282 Ga0081455_10063274
283 Ga0081455_10230567
284 Ga0081538_10000189
285 Ga0081538_10000673
286 Ga0081538_10001368
287 Ga0081538_10020688
288 Ga0081539_10072304
289 Ga0075428_100148314
290 Ga0075428_101063902
291 Ga0075430_100043306
292 Ga0075430_101737041
293 Ga0075431_100032664
294 Ga0075431_100046421
295 Ga0075434_100048448
296 Ga0068865_100857967
297 Ga0111539_10206827
298 Ga0111539_10447634
299 Ga0111539_10766636
300 Ga0114129_10046745
301 Ga0114129_10325015
302 Ga0114129_10818335
303 Ga0114129_11670418
304 Ga0105242_11017871
305 Ga0105249_10523051
306 Ga0157369_10675255
307 Ga0157369_12131422
308 Ga0163163_11731930
309 Ga0157380_10450668
310 Ga0157376_11045000
311 Ga0157376_11265261
312 Ga0206353_11853070
313 Ga0213876_10043496
314 Ga0213875_10000454
315 Ga0213875_10061033
316 Ga0207649_10469728
317 Ga0207700_11175901
318 Ga0207670_10701886
319 Ga0207689_10257615
320 Ga0207661_10004874
321 Ga0207661_10378866
322 Ga0207661_10546550
323 Ga0207679_10243766
324 Ga0207640_10200553
325 Ga0207708_11047778
326 Ga0207674_10746177
327 Ga0207698_10384679
328 Ga0265319_1004832
329 Ga0265318_10004810
330 Ga0265338_10124817
331 Ga0265320_10002003
332 Ga0265325_10483937
333 Ga0265316_10075649
334 Ga0307408_100221656
335 Ga0265314_10007814
336 Ga0307405_10015502
337 Ga0307405_10106484
338 Ga0307413_10266308
339 Ga0307413_10507340
340 Ga0307410_10160602
341 Ga0307410_10312080
342 Ga0307410_10647695
343 Ga0307406_10131593
344 Ga0307407_10053389
345 Ga0307407_10111029
346 Ga0307407_10159223
347 Ga0307407_10599438
348 Ga0307409_100055728
349 Ga0307409_100341284
350 Ga0307416_100080986
351 Ga0307416_100708146
352 Ga0307416_102464862
353 Ga0307414_10024260
354 Ga0307411_10020153
355 Ga0307411_10310345
356 Ga0307415_100039768
357 Ga0307415_100170135
358 Ga0307415_101458958
359 Ga0373960_0283761
360 Ga0373961_0207800
361 Ga0373931_0740157
362 Ga0395900_1058718
363 Ga0395898_0284155
364 Ga0395898_0565007
365 Ga0395898_0796101
366 Ga0395905_0018996
367 Ga0436364_0183590
368 Ga0436364_1031890
369 Ga0436364_1180097
370 Ga0436364_1349329
371 Ga0395901_0838867
372 Ga0395901_0878975
373 Ga0395901_1560074
374 Ga0436365_0815111
375 Ga0436365_1744446
376 Ga0436362_0057172
377 Ga0436362_0514118
378 Ga0466969_0019253
379 Ga0466965_0042966
380 Ga0466966_0096995
381 Ga0466966_0275183
382 Ga0466961_0138186
383 Ga0466963_0006318
384 Ga0466963_0019580
385 Ga0466963_0024676
386 Ga0466963_0046782
387 Ga0466963_0105143
388 Ga0466963_0656065
389 Ga0466964_0159380
390 Ga0466971_0052984
391 Ga0466971_0140771
392 Ga0466970_0017635
393 Ga0466970_0171630
394 Ga0466957_0170509
395 Ga0466957_0341919
396 Ga0466960_0029643
397 Ga0466960_0137014
398 Ga0466960_0437601
399 Ga0466959_0044599
400 Ga0466959_0065707
401 Ga0466959_0312298
402 Ga0466958_0007513
403 Ga0466958_0090624
404 Ga0466958_0382111
405 Ga0466958_0472842
406 Ga0466967_0006630
407 Ga0466967_0012802
408 Ga0466967_0161247
409 Ga0466967_0186690
410 Ga0466967_0298937
411 Ga0466967_0497025
412 Ga0466967_0950149
413 Ga0466967_1565894
414 Ga0466967_1841159
415 Ga0495641_0000111
416 Ga0495641_0051407
417 Ga0495651_0302000
418 Ga0495580_0817190
419 Ga0495639_0517133
420 Ga0495596_0197099
421 Ga0495607_0364084
422 Ga0495630_0839041
423 Ga0495631_0251282
424 Ga0495588_0382589
425 Ga0495646_0335771
426 Ga0495658_0572954
427 Ga0495676_0019112
428 Ga0496109_0460967
429 Ga0496110_0045950
430 Ga0496111_0161086
431 Ga0496112_0289250
432 Ga0496112_0490885
433 Ga0496113_0106018
434 Ga0496121_0320024
435 Ga0501033_0648796
436 Ga0501034_1254668
437 Ga0501036_0283515
438 Ga0501036_0377314
439 Ga0501039_0155056
440 Ga0501039_0472928
441 Ga0501039_1502762
442 Ga0501040_0673869
443 Ga0501041_0074467
444 Ga0501043_0396691
445 Ga0501046_0128023
446 Ga0501046_0525043
447 Ga0501048_0012256
448 Ga0501048_0184539
449 Ga0501048_0409678
450 Ga0501069_0191973
451 Ga0501071_0005442
452 Ga0501072_0028796
453 Ga0501072_0037998
454 Ga0501072_0051020
455 Ga0501074_0319700
456 Ga0501075_0024964
457 Ga0501075_0032178
458 Ga0501076_0107241
459 Ga0501076_0447726
460 Ga0501077_0076009
461 Ga0501077_0111142
462 Ga0501077_0704530
463 Ga0501079_0037544
464 Ga0501079_0069495
465 Ga0501081_0033593
466 Ga0501081_0047385
467 Ga0501083_0076894
468 Ga0501035_0361020
469 Ga0501045_0055928
470 Ga0501045_0150500
471 Ga0501045_0574465
472 nmdc:mga0yw44_662920_c1
473 nmdc:mga05p37_1192782_c1
474 nmdc:mga05p37_192072_c1
475 nmdc:mga05p37_2229832_c1
476 nmdc:mga05p37_324009_c1
477 nmdc:mga0qj67_842873_c1
478 nmdc:mga06r32_43702_c1
479 nmdc:mga06r32_731721_c1
480 nmdc:mga06r32_749644_c1
481 nmdc:mga08y16_1354235_c1
482 nmdc:mga08y16_142058_c1
483 nmdc:mga08y16_274113_c1
484 nmdc:mga08y16_444978_c1
485 nmdc:mga0n895_43354_c1
486 nmdc:mga0rr50_257549_c1
487 nmdc:mga08x19_33967_c1
488 Ga0501084_0013361
489 Ga0501084_0216946
490 Ga0501082_0126843
491 Ga0501082_1169221
492 Ga0530510_0058328

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01220

DHquinase_II

Dehydroquinase class II

22

159

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gqo-assembly1.cif.gz_K type ii dehydroquinase from bacillus subtilis 0.9631 11 149
1gqo-assembly2.cif.gz_N type ii dehydroquinase from bacillus subtilis 0.9604 11 149
1gqo-assembly2.cif.gz_V type ii dehydroquinase from bacillus subtilis 0.9597 11 149
1gqo-assembly1.cif.gz_E type ii dehydroquinase from bacillus subtilis 0.9592 11 149
6hs9-assembly1.cif.gz_A the crystal structure of type ii dehydroquinase from butyrivibrio crossotus dsm 2876 0.9579 8 148
ID Description Score Start End Superfamily
1gqoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9597 11 149 3.40.50.9100
1d0iH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9552 9 153 3.40.50.9100
1gqoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9401 11 149 3.40.50.9100
4kiuM00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9335 11 153 3.40.50.9100
2c57B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9316 11 152 3.40.50.9100
ID Description Score Start End GO Terms
AF-A0A7V6ITG2-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9849 11 149 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A415ELT2-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9814 11 152 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A6N3GHY7-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9806 11 153 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A1Q6F124-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9795 11 153 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A354UEB9-F1-model_v4 3-dehydroquinate dehydratase (EC 4.2.1.10) 0.9793 11 136 GO:0003855
GO:0009073
GO:0009423
GO:0019631

Map