F358520

General Info

Members Datasets Scaffolds Average Seq Length
246 141 492 221

Family's Representative Sequence

Representative Sequence 3300049582|Ga0501048_0057378|Ga0501048_0057378_639_1346
Length 235
Sequence MCSPGSAEAVTVLVVTGTDTGVGKTIATAALACHARRAGLDVAVCKPVQTGIDAGDDDLAEVARLSGVRELAGFGRYPQPLAPVAAAEDAGMPLPTREQLLALIGDLDRPGRLTLVEGAGGLLVELGENGVTARDLAVGLGAAVLVVVSPSLGTLNHTALTLESIAAQNLSCAGLVIGSWPRRPGVVETTNRSALARLAAVRAALPEGAASLGTTEFASLCAQAFDRDWVTSLVA

Samples

Sample ID Description Type Environment
1 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
57 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
58 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
59 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
62 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
63 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
64 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
65 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
66 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
67 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
68 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
69 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
70 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
73 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
74 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
82 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
83 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
84 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
85 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
86 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
87 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
88 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
89 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
90 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
91 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
94 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
95 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
96 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
99 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
100 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
101 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
102 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
103 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
104 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
105 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
106 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
107 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
108 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
121 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
122 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
123 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
124 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
125 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
126 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
127 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
128 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
129 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
130 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
131 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
132 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
133 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
134 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
135 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
136 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
137 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
138 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
139 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
140 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
141 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.34
Metatranscriptomes 0
Isolates 3.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.98
Nodule 0.41
Rhizoplane 17.48
Rhizosphere 49.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501048_0057378 3300049582 Bacteria 2761
2 JGI24751J29686_10009839 3300002459 Bacteria 1970
3 Ga0055540_1000136 3300003792 Bacteria 73398
4 Ga0055540_1003354 3300003792 Bacteria 7777
5 Ga0055540_1009520 3300003792 Bacteria 3347
6 Ga0070683_100161340 3300005329 Bacteria 2127
7 Ga0070670_100559215 3300005331 Bacteria 1021
8 Ga0070668_100030685 3300005347 Bacteria 4088
9 Ga0070668_100122766 3300005347 Bacteria 2077
10 Ga0070671_100052678 3300005355 Bacteria 3383
11 Ga0070674_100058732 3300005356 Bacteria 2675
12 Ga0070667_100001293 3300005367 Bacteria 22631
13 Ga0070667_100005403 3300005367 Bacteria 10671
14 Ga0070667_100271503 3300005367 Bacteria 1521
15 Ga0070714_100112961 3300005435 Bacteria 2408
16 Ga0070713_100071175 3300005436 Bacteria 2938
17 Ga0070708_100615017 3300005445 Bacteria 1024
18 Ga0070678_100252992 3300005456 Bacteria 1478
19 Ga0070685_10161833 3300005466 Bacteria 1427
20 Ga0070684_100316597 3300005535 Bacteria 1433
21 Ga0068853_100020541 3300005539 Bacteria 5493
22 Ga0070686_100469413 3300005544 Bacteria 971
23 Ga0070665_100004596 3300005548 Bacteria 14442
24 Ga0068859_100142683 3300005617 Bacteria 2469
25 Ga0068859_100493294 3300005617 Bacteria 1320
26 Ga0068864_100251915 3300005618 Bacteria 1640
27 Ga0068861_100224692 3300005719 Bacteria 1589
28 Ga0068863_100083207 3300005841 Bacteria 3032
29 Ga0068863_100137295 3300005841 Bacteria 2336
30 Ga0068858_100260204 3300005842 Bacteria 1649
31 Ga0068860_100606072 3300005843 Bacteria 1101
32 Ga0075365_10006370 3300006038 Bacteria 6489
33 Ga0075365_10089916 3300006038 Bacteria 2091
34 Ga0075365_10186193 3300006038 Bacteria 1452
35 Ga0075368_10011989 3300006042 Bacteria 3163
36 Ga0075363_100000212 3300006048 Bacteria 16030
37 Ga0075363_100000793 3300006048 Bacteria 10916
38 Ga0075363_100000928 3300006048 Bacteria 10354
39 Ga0075363_100015633 3300006048 Bacteria 3734
40 Ga0075363_100062647 3300006048 Bacteria 2006
41 Ga0075364_10000234 3300006051 Bacteria 26412
42 Ga0075364_10004135 3300006051 Bacteria 8320
43 Ga0075364_10025083 3300006051 Bacteria 3793
44 Ga0075364_10037093 3300006051 Bacteria 3154
45 Ga0075364_10251641 3300006051 Bacteria 1201
46 Ga0075362_10016826 3300006177 Bacteria 3002
47 Ga0075362_10077820 3300006177 Bacteria 1525
48 Ga0075362_10223791 3300006177 Bacteria 920
49 Ga0075367_10004066 3300006178 Bacteria 7077
50 Ga0075369_10001288 3300006186 Bacteria 8528
51 Ga0075369_10004407 3300006186 Bacteria 5200
52 Ga0075369_10038610 3300006186 Bacteria 2038
53 Ga0075369_10055149 3300006186 Bacteria 1727
54 Ga0075369_10107296 3300006186 Bacteria 1257
55 Ga0075370_10003418 3300006353 Bacteria 7556
56 Ga0075370_10064815 3300006353 Bacteria 2084
57 Ga0068865_100619229 3300006881 Bacteria 917
58 Ga0097620_100142685 3300006931 Bacteria 2469
59 Ga0097620_100493280 3300006931 Bacteria 1320
60 Ga0105250_10100918 3300009092 Bacteria 1177
61 Ga0105242_10147499 3300009176 Bacteria 2048
62 Ga0105237_10000175 3300009545 Bacteria 90284
63 Ga0105237_10198227 3300009545 Bacteria 2007
64 Ga0105249_10280647 3300009553 Bacteria 1663
65 Ga0105249_10386125 3300009553 Bacteria 1427
66 Ga0105239_10003915 3300010375 Bacteria 18039
67 Ga0105239_10105382 3300010375 Bacteria 3123
68 Ga0163161_10149348 3300017792 Bacteria 1775
69 Ga0209673_1006053 3300025273 Bacteria 5945
70 Ga0209051_1000011 3300025303 Bacteria 610828
71 Ga0209051_1000559 3300025303 Bacteria 45332
72 Ga0209051_1000670 3300025303 Bacteria 38433
73 Ga0207650_10258850 3300025925 Bacteria 1411
74 Ga0207700_10667224 3300025928 Bacteria 927
75 Ga0207664_10048409 3300025929 Bacteria 3342
76 Ga0207664_10201015 3300025929 Bacteria 1720
77 Ga0207709_10289959 3300025935 Bacteria 1212
78 Ga0207669_10045203 3300025937 Bacteria 2593
79 Ga0207712_10010322 3300025961 Bacteria 5930
80 Ga0207668_10043103 3300025972 Bacteria 3059
81 Ga0207658_10001047 3300025986 Bacteria 22453
82 Ga0207658_10013462 3300025986 Bacteria 5588
83 Ga0207639_10015630 3300026041 Bacteria 5355
84 Ga0207641_10100906 3300026088 Bacteria 2542
85 Ga0207641_10438699 3300026088 Bacteria 1260
86 Ga0207676_10041611 3300026095 Bacteria 3529
87 Ga0207675_100143798 3300026118 Bacteria 2267
88 Ga0268266_10002908 3300028379 Bacteria 17732
89 Ga0268266_10106307 3300028379 Bacteria 2481
90 Ga0265327_10000081 3300031251 Bacteria 205988
91 Ga0265327_10003372 3300031251 Bacteria 15379
92 Ga0265327_10009711 3300031251 Bacteria 6892
93 Ga0265327_10046265 3300031251 Bacteria 2305
94 Ga0307413_10220234 3300031824 Bacteria 1386
95 Ga0307410_10134801 3300031852 Bacteria 1819
96 Ga0307407_10133588 3300031903 Bacteria 1591
97 Ga0307409_100136954 3300031995 Bacteria 2103
98 Ga0436363_1045148 3300039450 Bacteria 2782
99 Ga0439466_0055777 3300041411 Bacteria 1283
100 Ga0439465_0012627 3300041413 Bacteria 2641
101 Ga0451793_0167831 3300041452 Bacteria 4068
102 Ga0439442_038172 3300042002 Bacteria 1007
103 Ga0439448_0007020 3300042005 Bacteria 3252
104 Ga0466969_0158817 3300044656 Bacteria 1039
105 Ga0466972_0095838 3300044658 Bacteria 1406
106 Ga0466965_0000977 3300044683 Bacteria 11071
107 Ga0466965_0019818 3300044683 Bacteria 3230
108 Ga0466965_0074715 3300044683 Bacteria 1708
109 Ga0466965_0173571 3300044683 Bacteria 1135
110 Ga0466961_0036420 3300044693 Bacteria 3158
111 Ga0466963_0245729 3300044694 Bacteria 1255
112 Ga0466964_0074993 3300044706 Bacteria 1439
113 Ga0466964_0196173 3300044706 Bacteria 966
114 Ga0466971_0042015 3300044719 Bacteria 2054
115 Ga0466971_0247561 3300044719 Bacteria 849
116 Ga0466968_0046284 3300044735 Bacteria 1848
117 Ga0466970_0065791 3300044765 Bacteria 1945
118 Ga0466957_0004000 3300044842 Bacteria 8149
119 Ga0466957_0063515 3300044842 Bacteria 2270
120 Ga0466957_0085819 3300044842 Bacteria 1966
121 Ga0466960_0000150 3300044901 Bacteria 23737
122 Ga0466960_0020049 3300044901 Bacteria 2956
123 Ga0466960_0050762 3300044901 Bacteria 2000
124 Ga0466959_0008423 3300045049 Bacteria 7291
125 Ga0466959_0012199 3300045049 Bacteria 6201
126 Ga0466958_0044205 3300045836 Bacteria 2684
127 Ga0466958_0087677 3300045836 Bacteria 1922
128 Ga0466967_0011056 3300045976 Bacteria 6813
129 Ga0466967_0095339 3300045976 Bacteria 2711
130 Ga0466967_0183714 3300045976 Bacteria 1973
131 Ga0466967_0316867 3300045976 Bacteria 1503
132 Ga0466967_0338982 3300045976 Bacteria 1453
133 Ga0466967_0347845 3300045976 Bacteria 1434
134 Ga0466967_0495946 3300045976 Bacteria 1198
135 Ga0466967_1317364 3300045976 Bacteria 719
136 Ga0495606_0021005 3300046507 Bacteria 4793
137 Ga0495686_0005301 3300047472 Bacteria 10220
138 Ga0496100_0000041 3300048903 Bacteria 92857
139 Ga0496100_0001672 3300048903 Bacteria 11005
140 Ga0496100_0097521 3300048903 Bacteria 2019
141 Ga0496101_0000249 3300048904 Bacteria 38955
142 Ga0496101_0000703 3300048904 Bacteria 20082
143 Ga0496101_0012357 3300048904 Bacteria 5697
144 Ga0496101_0102477 3300048904 Bacteria 2144
145 Ga0496102_0003474 3300048905 Bacteria 13362
146 Ga0496102_0117781 3300048905 Bacteria 2479
147 Ga0496102_0118947 3300048905 Bacteria 2466
148 Ga0496102_0177634 3300048905 Bacteria 2005
149 Ga0496103_0000879 3300048906 Bacteria 21795
150 Ga0496103_0206216 3300048906 Bacteria 1264
151 Ga0496104_0014060 3300048907 Bacteria 7225
152 Ga0496104_0028123 3300048907 Bacteria 5210
153 Ga0496104_0052209 3300048907 Bacteria 3861
154 Ga0496104_0349779 3300048907 Bacteria 1391
155 Ga0496104_0893111 3300048907 Bacteria 794
156 Ga0496105_0006121 3300048908 Bacteria 9213
157 Ga0496105_0058718 3300048908 Bacteria 3175
158 Ga0496106_0000561 3300048909 Bacteria 26484
159 Ga0496106_0004707 3300048909 Bacteria 10110
160 Ga0496106_0018832 3300048909 Bacteria 5115
161 Ga0496107_0007655 3300048910 Bacteria 7456
162 Ga0496107_0042749 3300048910 Bacteria 3255
163 Ga0496107_0658357 3300048910 Bacteria 772
164 Ga0496108_0003812 3300048911 Bacteria 12075
165 Ga0496108_0130813 3300048911 Bacteria 2157
166 Ga0496109_0000582 3300048912 Bacteria 30519
167 Ga0496109_0071793 3300048912 Bacteria 3179
168 Ga0496109_0282528 3300048912 Bacteria 1564
169 Ga0496110_0001049 3300048913 Bacteria 19505
170 Ga0496110_0056567 3300048913 Bacteria 3452
171 Ga0496110_0391316 3300048913 Bacteria 1267
172 Ga0496111_0029399 3300048914 Bacteria 3903
173 Ga0496111_0316251 3300048914 Bacteria 1156
174 Ga0496112_0004562 3300048915 Bacteria 11771
175 Ga0496113_0040541 3300048916 Bacteria 3432
176 Ga0496114_0004930 3300048917 Bacteria 10401
177 Ga0496114_0720047 3300048917 Bacteria 874
178 Ga0496115_0016424 3300048918 Bacteria 5638
179 Ga0496115_0191010 3300048918 Bacteria 1692
180 Ga0496116_0004667 3300048919 Bacteria 12968
181 Ga0496117_0040390 3300048920 Bacteria 3431
182 Ga0496118_0009791 3300048921 Bacteria 9608
183 Ga0496119_0006416 3300048922 Bacteria 10909
184 Ga0496121_0000016 3300048924 Bacteria 562911
185 Ga0496122_0000250 3300048925 Bacteria 121043
186 Ga0496122_0087711 3300048925 Bacteria 2136
187 Ga0496123_0014352 3300048926 Bacteria 6573
188 Ga0496123_0027858 3300048926 Bacteria 4197
189 Ga0496124_0000015 3300048927 Bacteria 460700
190 Ga0496125_0000021 3300048928 Bacteria 460688
191 Ga0496126_0000015 3300048929 Bacteria 663212
192 Ga0496126_0006189 3300048929 Bacteria 13394
193 Ga0496126_0046405 3300048929 Bacteria 3985
194 Ga0496126_0324754 3300048929 Bacteria 1264
195 Ga0501032_0127336 3300049569 Bacteria 1681
196 Ga0501036_0052665 3300049572 Bacteria 3447
197 Ga0501037_0014047 3300049573 Bacteria 5899
198 Ga0501038_0059894 3300049574 Bacteria 3260
199 Ga0501043_0437442 3300049579 Bacteria 984
200 Ga0501046_0004893 3300049580 Bacteria 12064
201 Ga0501047_0012600 3300049581 Bacteria 8011
202 Ga0501047_0629793 3300049581 Bacteria 893
203 Ga0501069_0024785 3300049585 Bacteria 3275
204 Ga0501070_0105683 3300049586 Bacteria 2327
205 Ga0501070_0216056 3300049586 Bacteria 1573
206 Ga0501070_0363817 3300049586 Bacteria 1173
207 Ga0501073_0130890 3300049589 Bacteria 1739
208 Ga0501080_0135100 3300049742 Bacteria 2283
209 Ga0501044_0003653 3300049823 Bacteria 17312
210 nmdc:mga03683_15342_c1 3300050489 Bacteria 1860
211 nmdc:mga03683_51365_c1 3300050489 Bacteria 1720
212 nmdc:mga03n38_133_c1 3300050490 Bacteria 16165
213 nmdc:mga03n38_155236_c1 3300050490 Bacteria 1155
214 nmdc:mga03n38_15824_c1 3300050490 Bacteria 2921
215 nmdc:mga03n38_158266_c1 3300050490 Bacteria 1145
216 nmdc:mga00v17_11301_c1 3300050491 Bacteria 4906
217 nmdc:mga00v17_173586_c1 3300050491 Bacteria 1390
218 nmdc:mga00v17_211095_c1 3300050491 Bacteria 1256
219 nmdc:mga00v17_220160_c1 3300050491 Bacteria 1229
220 nmdc:mga00v17_235906_c1 3300050491 Bacteria 1185
221 nmdc:mga00v17_2548_c1 3300050491 Bacteria 9338
222 nmdc:mga00v17_4348_c1 3300050491 Bacteria 6219
223 nmdc:mga00v17_5887_c1 3300050491 Bacteria 6476
224 nmdc:mga0yw44_123212_c1 3300050492 Bacteria 1671
225 nmdc:mga0yw44_224975_c1 3300050492 Bacteria 1244
226 nmdc:mga0yw44_4676_c1 3300050492 Bacteria 6328
227 nmdc:mga06z11_11519_c1 3300050494 Bacteria 3817
228 nmdc:mga07m45_2902_c1 3300050496 Bacteria 8125
229 nmdc:mga07m45_740_c1 3300050496 Bacteria 13945
230 nmdc:mga0sz30_2044_c1 3300050516 Bacteria 7207
231 nmdc:mga0sz30_79544_c1 3300050516 Bacteria 1418
232 nmdc:mga0sz30_99920_c1 3300050516 Bacteria 1267
233 Ga0500610_0007360 3300053079 Bacteria 4711
234 Ga0500635_0000430 3300053080 Bacteria 12188
235 Ga0500562_036647 3300053108 Bacteria 1301
236 Ga0500652_000985 3300053131 Bacteria 9378
237 Ga0466962_0188401 3300061719 Bacteria 1006
238 2644485940 2643221687 Bacteria 6500351
239 2738665134 2738541264 Bacteria 5935393
240 2739144268 2738541356 Bacteria 5935017
241 2842137689 2842134933 Bacteria 5847019
242 2902795907 2902792274 Bacteria 7270173
243 2902840713 2902837492 Bacteria 6697721
244 2929215506 2929212328 Bacteria 7708288
245 2939588184 2939582691 Bacteria 7088898
246 8057573437 8057568493 Bacteria 7221719
247 Ga0501048_0057378
248 JGI24751J29686_10009839
249 Ga0055540_1000136
250 Ga0055540_1003354
251 Ga0055540_1009520
252 Ga0070683_100161340
253 Ga0070670_100559215
254 Ga0070668_100030685
255 Ga0070668_100122766
256 Ga0070671_100052678
257 Ga0070674_100058732
258 Ga0070667_100001293
259 Ga0070667_100005403
260 Ga0070667_100271503
261 Ga0070714_100112961
262 Ga0070713_100071175
263 Ga0070708_100615017
264 Ga0070678_100252992
265 Ga0070685_10161833
266 Ga0070684_100316597
267 Ga0068853_100020541
268 Ga0070686_100469413
269 Ga0070665_100004596
270 Ga0068859_100142683
271 Ga0068859_100493294
272 Ga0068864_100251915
273 Ga0068861_100224692
274 Ga0068863_100083207
275 Ga0068863_100137295
276 Ga0068858_100260204
277 Ga0068860_100606072
278 Ga0075365_10006370
279 Ga0075365_10089916
280 Ga0075365_10186193
281 Ga0075368_10011989
282 Ga0075363_100000212
283 Ga0075363_100000793
284 Ga0075363_100000928
285 Ga0075363_100015633
286 Ga0075363_100062647
287 Ga0075364_10000234
288 Ga0075364_10004135
289 Ga0075364_10025083
290 Ga0075364_10037093
291 Ga0075364_10251641
292 Ga0075362_10016826
293 Ga0075362_10077820
294 Ga0075362_10223791
295 Ga0075367_10004066
296 Ga0075369_10001288
297 Ga0075369_10004407
298 Ga0075369_10038610
299 Ga0075369_10055149
300 Ga0075369_10107296
301 Ga0075370_10003418
302 Ga0075370_10064815
303 Ga0068865_100619229
304 Ga0097620_100142685
305 Ga0097620_100493280
306 Ga0105250_10100918
307 Ga0105242_10147499
308 Ga0105237_10000175
309 Ga0105237_10198227
310 Ga0105249_10280647
311 Ga0105249_10386125
312 Ga0105239_10003915
313 Ga0105239_10105382
314 Ga0163161_10149348
315 Ga0209673_1006053
316 Ga0209051_1000011
317 Ga0209051_1000559
318 Ga0209051_1000670
319 Ga0207650_10258850
320 Ga0207700_10667224
321 Ga0207664_10048409
322 Ga0207664_10201015
323 Ga0207709_10289959
324 Ga0207669_10045203
325 Ga0207712_10010322
326 Ga0207668_10043103
327 Ga0207658_10001047
328 Ga0207658_10013462
329 Ga0207639_10015630
330 Ga0207641_10100906
331 Ga0207641_10438699
332 Ga0207676_10041611
333 Ga0207675_100143798
334 Ga0268266_10002908
335 Ga0268266_10106307
336 Ga0265327_10000081
337 Ga0265327_10003372
338 Ga0265327_10009711
339 Ga0265327_10046265
340 Ga0307413_10220234
341 Ga0307410_10134801
342 Ga0307407_10133588
343 Ga0307409_100136954
344 Ga0436363_1045148
345 Ga0439466_0055777
346 Ga0439465_0012627
347 Ga0451793_0167831
348 Ga0439442_038172
349 Ga0439448_0007020
350 Ga0466969_0158817
351 Ga0466972_0095838
352 Ga0466965_0000977
353 Ga0466965_0019818
354 Ga0466965_0074715
355 Ga0466965_0173571
356 Ga0466961_0036420
357 Ga0466963_0245729
358 Ga0466964_0074993
359 Ga0466964_0196173
360 Ga0466971_0042015
361 Ga0466971_0247561
362 Ga0466968_0046284
363 Ga0466970_0065791
364 Ga0466957_0004000
365 Ga0466957_0063515
366 Ga0466957_0085819
367 Ga0466960_0000150
368 Ga0466960_0020049
369 Ga0466960_0050762
370 Ga0466959_0008423
371 Ga0466959_0012199
372 Ga0466958_0044205
373 Ga0466958_0087677
374 Ga0466967_0011056
375 Ga0466967_0095339
376 Ga0466967_0183714
377 Ga0466967_0316867
378 Ga0466967_0338982
379 Ga0466967_0347845
380 Ga0466967_0495946
381 Ga0466967_1317364
382 Ga0495606_0021005
383 Ga0495686_0005301
384 Ga0496100_0000041
385 Ga0496100_0001672
386 Ga0496100_0097521
387 Ga0496101_0000249
388 Ga0496101_0000703
389 Ga0496101_0012357
390 Ga0496101_0102477
391 Ga0496102_0003474
392 Ga0496102_0117781
393 Ga0496102_0118947
394 Ga0496102_0177634
395 Ga0496103_0000879
396 Ga0496103_0206216
397 Ga0496104_0014060
398 Ga0496104_0028123
399 Ga0496104_0052209
400 Ga0496104_0349779
401 Ga0496104_0893111
402 Ga0496105_0006121
403 Ga0496105_0058718
404 Ga0496106_0000561
405 Ga0496106_0004707
406 Ga0496106_0018832
407 Ga0496107_0007655
408 Ga0496107_0042749
409 Ga0496107_0658357
410 Ga0496108_0003812
411 Ga0496108_0130813
412 Ga0496109_0000582
413 Ga0496109_0071793
414 Ga0496109_0282528
415 Ga0496110_0001049
416 Ga0496110_0056567
417 Ga0496110_0391316
418 Ga0496111_0029399
419 Ga0496111_0316251
420 Ga0496112_0004562
421 Ga0496113_0040541
422 Ga0496114_0004930
423 Ga0496114_0720047
424 Ga0496115_0016424
425 Ga0496115_0191010
426 Ga0496116_0004667
427 Ga0496117_0040390
428 Ga0496118_0009791
429 Ga0496119_0006416
430 Ga0496121_0000016
431 Ga0496122_0000250
432 Ga0496122_0087711
433 Ga0496123_0014352
434 Ga0496123_0027858
435 Ga0496124_0000015
436 Ga0496125_0000021
437 Ga0496126_0000015
438 Ga0496126_0006189
439 Ga0496126_0046405
440 Ga0496126_0324754
441 Ga0501032_0127336
442 Ga0501036_0052665
443 Ga0501037_0014047
444 Ga0501038_0059894
445 Ga0501043_0437442
446 Ga0501046_0004893
447 Ga0501047_0012600
448 Ga0501047_0629793
449 Ga0501069_0024785
450 Ga0501070_0105683
451 Ga0501070_0216056
452 Ga0501070_0363817
453 Ga0501073_0130890
454 Ga0501080_0135100
455 Ga0501044_0003653
456 nmdc:mga03683_15342_c1
457 nmdc:mga03683_51365_c1
458 nmdc:mga03n38_133_c1
459 nmdc:mga03n38_155236_c1
460 nmdc:mga03n38_15824_c1
461 nmdc:mga03n38_158266_c1
462 nmdc:mga00v17_11301_c1
463 nmdc:mga00v17_173586_c1
464 nmdc:mga00v17_211095_c1
465 nmdc:mga00v17_220160_c1
466 nmdc:mga00v17_235906_c1
467 nmdc:mga00v17_2548_c1
468 nmdc:mga00v17_4348_c1
469 nmdc:mga00v17_5887_c1
470 nmdc:mga0yw44_123212_c1
471 nmdc:mga0yw44_224975_c1
472 nmdc:mga0yw44_4676_c1
473 nmdc:mga06z11_11519_c1
474 nmdc:mga07m45_2902_c1
475 nmdc:mga07m45_740_c1
476 nmdc:mga0sz30_2044_c1
477 nmdc:mga0sz30_79544_c1
478 nmdc:mga0sz30_99920_c1
479 Ga0500610_0007360
480 Ga0500635_0000430
481 Ga0500562_036647
482 Ga0500652_000985
483 Ga0466962_0188401
484 2644485940
485 2738665134
486 2739144268
487 2842137689
488 2902795907
489 2902840713
490 2929215506
491 2939588184
492 8057573437

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13500

AAA_26

AAA domain

11

207

0.85

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

13

196

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fmf-assembly2.cif.gz_C crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate 0.9836 2 223
6e06-assembly2.cif.gz_D crystal structure of mycobacterium tuberculosis dethiobiotin synthetase in complex with cytidine triphosphate solved by precipitant-ligand exchange (crystals grown in citrate precipitant) 0.9817 2 221
3fmf-assembly2.cif.gz_D crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate 0.9759 2 221
3fmf-assembly2.cif.gz_C crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate 0.9749 2 223
3fmf-assembly2.cif.gz_D crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate 0.9672 2 221
ID Description Score Start End Superfamily
3fmfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9759 2 221 3.40.50.300
3fmfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9587 2 221 3.40.50.300
af_Q2FVJ5_2_213_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8604 4 194 3.40.50.300
af_Q58695_1_213_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8424 4 193 3.40.50.300
af_A0A1D8PS31_1_209_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8133 1 209 3.40.50.300
ID Description Score Start End GO Terms
AF-X8B3J5-F1-model_v4 deleted 0.9895 82 196
AF-P45486-F1-model_v4 ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) 0.989 1 223 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102
AF-A0A1B9D8C7-F1-model_v4 Dethiobiotin synthase 0.9887 46 223 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102
AF-A0A5A7ZK01-F1-model_v4 ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) 0.9872 1 221 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102
AF-D5P2S2-F1-model_v4 Putative dethiobiotin synthase (EC 6.3.3.3) 0.9863 66 223 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102

Map