F358463

General Info

Members Datasets Scaffolds Average Seq Length
246 174 492 211

Family's Representative Sequence

Representative Sequence 3300046684|Ga0495669_0172125|Ga0495669_0172125_71_787
Length 238
Sequence MNEELDSQLSAMFDDELPEAECQLLARRLSRDDLLKARWRRYAVIGAAVRSEHGVRLETNLAARVSAAISAEPSLAGAAVAGKRVGAGGGFRWWQPVAGGAIAAGVAALSVLWIRAQSPVGSDELVARNSAPTTIASPTALANGPPSTADSNGTTYVVPNAVVRRTALVPQAELANFVVAHSEFSTPMNRRNLLSALVASESGTGGGANESEGANDDADTTIKSSAPEDRTKNVQEAK

Samples

Sample ID Description Type Environment
1 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
45 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
108 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
109 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
110 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
137 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
141 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
142 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
162 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
163 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
164 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
165 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
166 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
167 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
168 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
169 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
170 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
173 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 1.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.32
Nodule 0
Rhizoplane 8.13
Rhizosphere 78.86
Stem 0
Stem Tuber 0
Unclassified 8.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495669_0172125 3300046684 Bacteria 1030
2 JGI25406J46586_10006417 3300003203 Bacteria 5418
3 Ga0070683_100038074 3300005329 Bacteria 4406
4 Ga0070690_100225513 3300005330 Bacteria 1315
5 Ga0068869_100118379 3300005334 Bacteria 2023
6 Ga0070666_10004686 3300005335 Bacteria 8356
7 Ga0070666_10152789 3300005335 Bacteria 1611
8 Ga0068868_100003581 3300005338 Bacteria 10821
9 Ga0070689_100365588 3300005340 Unclassified 1213
10 Ga0070671_100000281 3300005355 Bacteria 34546
11 Ga0070671_100012990 3300005355 Bacteria 6711
12 Ga0070667_100000068 3300005367 Bacteria 127663
13 Ga0070667_100046894 3300005367 Bacteria 3635
14 Ga0070714_100000176 3300005435 Bacteria 51988
15 Ga0070713_100007456 3300005436 Bacteria 7681
16 Ga0070713_100308475 3300005436 Bacteria 1459
17 Ga0070710_10027513 3300005437 Bacteria 3033
18 Ga0070711_100005774 3300005439 Bacteria 7428
19 Ga0070708_101026769 3300005445 Unclassified 773
20 Ga0070678_100025700 3300005456 Bacteria 3967
21 Ga0070681_10015009 3300005458 Bacteria 7704
22 Ga0070681_10317712 3300005458 Bacteria 1467
23 Ga0068867_100078377 3300005459 Bacteria 2485
24 Ga0070679_100065626 3300005530 Unclassified 3618
25 Ga0070679_100547132 3300005530 Unclassified 1101
26 Ga0070684_100449147 3300005535 Unclassified 1191
27 Ga0070686_100312061 3300005544 Unclassified 1170
28 Ga0070665_100012059 3300005548 Bacteria 8721
29 Ga0070665_100068078 3300005548 Bacteria 3570
30 Ga0070665_100082400 3300005548 Bacteria 3222
31 Ga0070665_100111236 3300005548 Bacteria 2741
32 Ga0070665_100305526 3300005548 Bacteria 1594
33 Ga0068855_100338340 3300005563 Bacteria 1660
34 Ga0068856_100034549 3300005614 Bacteria 4952
35 Ga0068856_100036256 3300005614 Bacteria 4836
36 Ga0068852_100092858 3300005616 Bacteria 2704
37 Ga0068852_100478395 3300005616 Unclassified 1237
38 Ga0068859_100000678 3300005617 Bacteria 34157
39 Ga0068866_10036715 3300005718 Bacteria 2402
40 Ga0068861_100032414 3300005719 Bacteria 3846
41 Ga0068863_100014368 3300005841 Bacteria 7626
42 Ga0068863_100018061 3300005841 Bacteria 6754
43 Ga0068863_100034214 3300005841 Bacteria 4841
44 Ga0068858_100000687 3300005842 Bacteria 35306
45 Ga0068858_100011523 3300005842 Bacteria 8343
46 Ga0068858_100201916 3300005842 Unclassified 1880
47 Ga0068860_100067816 3300005843 Bacteria 3389
48 Ga0068862_100158364 3300005844 Bacteria 2020
49 Ga0068862_100555742 3300005844 Bacteria 1096
50 Ga0081455_10000099 3300005937 Bacteria 95044
51 Ga0081539_10000004 3300005985 Bacteria 555600
52 Ga0070717_10001719 3300006028 Bacteria 15270
53 Ga0070715_10002347 3300006163 Bacteria 5789
54 Ga0070716_100045724 3300006173 Bacteria 2459
55 Ga0070712_100002057 3300006175 Bacteria 12320
56 Ga0097621_100014927 3300006237 Bacteria 5829
57 Ga0068865_100021039 3300006881 Bacteria 4239
58 Ga0075436_100048256 3300006914 Bacteria 2938
59 Ga0097620_100000678 3300006931 Bacteria 34157
60 Ga0075435_100055118 3300007076 Bacteria 3210
61 Ga0099795_10159085 3300007788 Bacteria 931
62 Ga0105250_10062676 3300009092 Bacteria 1496
63 Ga0105240_10041291 3300009093 Bacteria 5889
64 Ga0105240_10162903 3300009093 Bacteria 2647
65 Ga0105240_10404517 3300009093 Bacteria 1537
66 Ga0105240_10654746 3300009093 Bacteria 1151
67 Ga0105240_10747528 3300009093 Unclassified 1063
68 Ga0105245_10001541 3300009098 Bacteria 20894
69 Ga0105247_10000203 3300009101 Bacteria 58331
70 Ga0105247_10023960 3300009101 Bacteria 3677
71 Ga0105247_10068598 3300009101 Bacteria 2211
72 Ga0105241_10009366 3300009174 Bacteria 7198
73 Ga0105242_10003331 3300009176 Bacteria 12493
74 Ga0105248_10021621 3300009177 Bacteria 7125
75 Ga0105248_10219152 3300009177 Bacteria 2143
76 Ga0105248_10249551 3300009177 Bacteria 1998
77 Ga0105248_11275979 3300009177 Bacteria 831
78 Ga0105237_10842994 3300009545 Unclassified 923
79 Ga0105238_10201596 3300009551 Bacteria 1965
80 Ga0105238_10635622 3300009551 Unclassified 1077
81 Ga0105249_10062148 3300009553 Bacteria 3428
82 Ga0105249_10439980 3300009553 Bacteria 1341
83 Ga0099796_10001542 3300010159 Bacteria 4694
84 Ga0105239_10107870 3300010375 Bacteria 3085
85 Ga0157374_10007257 3300013296 Bacteria 9441
86 Ga0157378_10005368 3300013297 Bacteria 11240
87 Ga0163162_10110705 3300013306 Bacteria 2843
88 Ga0157375_10048534 3300013308 Bacteria 4153
89 Ga0163163_10023892 3300014325 Bacteria 5810
90 Ga0163163_10323517 3300014325 Bacteria 1596
91 Ga0163163_10359522 3300014325 Bacteria 1512
92 Ga0157379_10031321 3300014968 Bacteria 4737
93 Ga0157379_10041470 3300014968 Bacteria 4109
94 Ga0157379_10044347 3300014968 Bacteria 3970
95 Ga0157376_10207611 3300014969 Bacteria 1806
96 Ga0206350_11631742 3300020080 Bacteria 729
97 Ga0213876_10107324 3300021384 Bacteria 1482
98 Ga0224712_10016147 3300022467 Bacteria 2446
99 Ga0207710_10001289 3300025900 Bacteria 12672
100 Ga0207680_10328907 3300025903 Unclassified 1070
101 Ga0207699_10003601 3300025906 Bacteria 7404
102 Ga0207654_10051062 3300025911 Bacteria 2379
103 Ga0207707_10146228 3300025912 Bacteria 2066
104 Ga0207707_10246729 3300025912 Bacteria 1551
105 Ga0207695_10112295 3300025913 Bacteria 2703
106 Ga0207695_10514676 3300025913 Bacteria 1078
107 Ga0207671_10459719 3300025914 Unclassified 1014
108 Ga0207693_10000059 3300025915 Bacteria 94053
109 Ga0207693_10029061 3300025915 Bacteria 4369
110 Ga0207663_10005288 3300025916 Bacteria 6500
111 Ga0207663_10238007 3300025916 Bacteria 1334
112 Ga0207652_10492790 3300025921 Bacteria 1103
113 Ga0207694_10448455 3300025924 Unclassified 1077
114 Ga0207700_10049632 3300025928 Bacteria 3123
115 Ga0207664_10012403 3300025929 Bacteria 6091
116 Ga0207664_10603680 3300025929 Bacteria 986
117 Ga0207644_10050657 3300025931 Bacteria 2977
118 Ga0207644_10274701 3300025931 Bacteria 1351
119 Ga0207686_10019682 3300025934 Bacteria 3844
120 Ga0207704_10110000 3300025938 Bacteria 1860
121 Ga0207665_10001746 3300025939 Bacteria 14583
122 Ga0207665_10019427 3300025939 Bacteria 4467
123 Ga0207665_10430814 3300025939 Bacteria 1009
124 Ga0207711_10037649 3300025941 Bacteria 4110
125 Ga0207711_10066314 3300025941 Bacteria 3122
126 Ga0207711_10099962 3300025941 Bacteria 2565
127 Ga0207689_10278191 3300025942 Bacteria 1386
128 Ga0207661_10050213 3300025944 Bacteria 3322
129 Ga0207651_10100153 3300025960 Bacteria 2148
130 Ga0207712_10071307 3300025961 Bacteria 2498
131 Ga0207712_10114210 3300025961 Bacteria 2031
132 Ga0207668_10430545 3300025972 Bacteria 1122
133 Ga0207658_10007712 3300025986 Bacteria 7330
134 Ga0207658_10012851 3300025986 Bacteria 5717
135 Ga0207677_10026292 3300026023 Bacteria 3648
136 Ga0207703_10011729 3300026035 Bacteria 6821
137 Ga0207703_10578053 3300026035 Bacteria 1061
138 Ga0207678_10091552 3300026067 Bacteria 2599
139 Ga0207702_10029318 3300026078 Bacteria 4578
140 Ga0207641_10001095 3300026088 Bacteria 27240
141 Ga0207641_10029316 3300026088 Bacteria 4549
142 Ga0207641_10048969 3300026088 Bacteria 3569
143 Ga0207648_10104453 3300026089 Bacteria 2485
144 Ga0207675_100058464 3300026118 Bacteria 3597
145 Ga0207683_10015112 3300026121 Bacteria 6569
146 Ga0207698_10154529 3300026142 Bacteria 1997
147 Ga0268266_10027307 3300028379 Bacteria 4854
148 Ga0268266_10046253 3300028379 Bacteria 3726
149 Ga0268266_10329606 3300028379 Unclassified 1430
150 Ga0268265_10482689 3300028380 Bacteria 1164
151 Ga0268265_10999619 3300028380 Bacteria 826
152 Ga0268264_10042203 3300028381 Bacteria 3776
153 Ga0268264_10164230 3300028381 Bacteria 2003
154 Ga0265334_10088959 3300028573 Bacteria 1129
155 Ga0307515_10483062 3300028794 Unclassified 851
156 Ga0265331_10006675 3300031250 Bacteria 6780
157 Ga0307513_10372940 3300031456 Bacteria 1169
158 Ga0307509_10000013 3300031507 Bacteria 283027
159 Ga0307518_10111942 3300031838 Bacteria 1943
160 Ga0307510_10068991 3300033180 Bacteria 3544
161 Ga0373923_0068656 3300035111 Bacteria 1518
162 Ga0373955_0124474 3300035172 Unclassified 1501
163 Ga0373933_0142800 3300035724 Bacteria 1512
164 Ga0373947_0072580 3300035725 Bacteria 2114
165 Ga0373937_0002058 3300036401 Bacteria 16806
166 Ga0310109_013230 3300036534 Bacteria 1120
167 Ga0395900_0082133 3300037418 Bacteria 3311
168 Ga0395898_0090847 3300037466 Bacteria 2938
169 Ga0436365_1194336 3300039437 Bacteria 2234
170 Ga0436360_0345650 3300039438 Bacteria 1400
171 Ga0436363_0403225 3300039450 Bacteria 6921
172 Ga0436363_0463233 3300039450 Bacteria 5784
173 Ga0436363_0466998 3300039450 Bacteria 2557
174 Ga0436362_0334028 3300039453 Bacteria 2249
175 Ga0436362_0373853 3300039453 Bacteria 2815
176 Ga0451800_0710947 3300041459 Bacteria 1394
177 Ga0466969_0019305 3300044656 Bacteria 3545
178 Ga0466966_0010542 3300044684 Bacteria 6142
179 Ga0466966_0124562 3300044684 Bacteria 1581
180 Ga0466961_0025079 3300044693 Bacteria 3836
181 Ga0466971_0013263 3300044719 Bacteria 3616
182 Ga0466968_0015462 3300044735 Bacteria 3025
183 Ga0466968_0087537 3300044735 Bacteria 1376
184 Ga0466970_0016546 3300044765 Bacteria 3805
185 Ga0466957_0016912 3300044842 Bacteria 4268
186 Ga0466959_0052009 3300045049 Bacteria 3001
187 Ga0466959_0073197 3300045049 Bacteria 2479
188 Ga0466959_0076508 3300045049 Bacteria 2416
189 Ga0466959_0359939 3300045049 Bacteria 991
190 Ga0466958_0059797 3300045836 Bacteria 2319
191 Ga0466958_0093802 3300045836 Bacteria 1859
192 Ga0466967_0492875 3300045976 Bacteria 1202
193 Ga0495580_0019583 3300046472 Bacteria 5028
194 Ga0495606_0074015 3300046507 Bacteria 2135
195 Ga0495630_0148090 3300046517 Bacteria 1785
196 Ga0495632_0080634 3300046519 Bacteria 1552
197 Ga0495666_0133826 3300046526 Bacteria 1158
198 Ga0495587_0032026 3300046536 Bacteria 3181
199 Ga0495625_0252683 3300046660 Bacteria 1144
200 Ga0495623_0075888 3300046679 Bacteria 2086
201 Ga0495671_0048199 3300046692 Bacteria 2126
202 Ga0495649_0179177 3300046694 Unclassified 1106
203 Ga0495604_0275966 3300047317 Unclassified 1137
204 Ga0496101_0003717 3300048904 Bacteria 9519
205 Ga0496104_0029075 3300048907 Bacteria 5125
206 Ga0496104_0138866 3300048907 Bacteria 2335
207 Ga0496105_0248486 3300048908 Unclassified 1441
208 Ga0496106_0003659 3300048909 Bacteria 11461
209 Ga0496106_0285840 3300048909 Bacteria 1322
210 Ga0496107_0294375 3300048910 Bacteria 1208
211 Ga0496108_0012883 3300048911 Bacteria 6813
212 Ga0496108_0121908 3300048911 Bacteria 2237
213 Ga0496108_0223349 3300048911 Bacteria 1637
214 Ga0496110_0020739 3300048913 Bacteria 5549
215 Ga0496111_0009312 3300048914 Bacteria 6548
216 Ga0496112_0017630 3300048915 Bacteria 6715
217 Ga0496112_0139774 3300048915 Bacteria 2391
218 Ga0496113_0066157 3300048916 Bacteria 2737
219 Ga0496113_0244683 3300048916 Bacteria 1431
220 Ga0496113_0400565 3300048916 Bacteria 1102
221 Ga0496114_0021120 3300048917 Bacteria 5293
222 Ga0496115_0054055 3300048918 Bacteria 3224
223 Ga0496121_0022214 3300048924 Bacteria 6170
224 Ga0496125_0009344 3300048928 Bacteria 10101
225 Ga0496126_0068854 3300048929 Bacteria 3158
226 nmdc:mga0rr50_48297_c1 3300050513 Bacteria 3145
227 nmdc:mga08x19_40549_c1 3300050514 Bacteria 2963
228 Ga0500646_0055282 3300053090 Unclassified 1155
229 Ga0500583_0023345 3300053092 Bacteria 2605
230 Ga0500583_0104426 3300053092 Bacteria 1390
231 Ga0500651_0129534 3300053093 Bacteria 1527
232 Ga0500641_0008255 3300053096 Bacteria 3714
233 Ga0500641_0025231 3300053096 Bacteria 2298
234 Ga0500556_0000152 3300053104 Bacteria 57878
235 Ga0500556_0079050 3300053104 Bacteria 1240
236 Ga0500594_0011166 3300053118 Bacteria 2096
237 Ga0500594_0246551 3300053118 Unclassified 594
238 Ga0500642_0040581 3300053130 Bacteria 2008
239 Ga0500658_0007784 3300053134 Bacteria 3958
240 Ga0500577_0016082 3300053142 Bacteria 2352
241 Ga0500588_0009464 3300053146 Bacteria 2317
242 Ga0500616_0000032 3300053153 Bacteria 403673
243 Ga0500616_0026679 3300053153 Bacteria 3195
244 Ga0500637_0073776 3300053178 Bacteria 1965
245 Ga0500611_003345 3300053727 Bacteria 2044
246 Ga0466962_0003596 3300061719 Bacteria 7385
247 Ga0495669_0172125
248 JGI25406J46586_10006417
249 Ga0070683_100038074
250 Ga0070690_100225513
251 Ga0068869_100118379
252 Ga0070666_10004686
253 Ga0070666_10152789
254 Ga0068868_100003581
255 Ga0070689_100365588
256 Ga0070671_100000281
257 Ga0070671_100012990
258 Ga0070667_100000068
259 Ga0070667_100046894
260 Ga0070714_100000176
261 Ga0070713_100007456
262 Ga0070713_100308475
263 Ga0070710_10027513
264 Ga0070711_100005774
265 Ga0070708_101026769
266 Ga0070678_100025700
267 Ga0070681_10015009
268 Ga0070681_10317712
269 Ga0068867_100078377
270 Ga0070679_100065626
271 Ga0070679_100547132
272 Ga0070684_100449147
273 Ga0070686_100312061
274 Ga0070665_100012059
275 Ga0070665_100068078
276 Ga0070665_100082400
277 Ga0070665_100111236
278 Ga0070665_100305526
279 Ga0068855_100338340
280 Ga0068856_100034549
281 Ga0068856_100036256
282 Ga0068852_100092858
283 Ga0068852_100478395
284 Ga0068859_100000678
285 Ga0068866_10036715
286 Ga0068861_100032414
287 Ga0068863_100014368
288 Ga0068863_100018061
289 Ga0068863_100034214
290 Ga0068858_100000687
291 Ga0068858_100011523
292 Ga0068858_100201916
293 Ga0068860_100067816
294 Ga0068862_100158364
295 Ga0068862_100555742
296 Ga0081455_10000099
297 Ga0081539_10000004
298 Ga0070717_10001719
299 Ga0070715_10002347
300 Ga0070716_100045724
301 Ga0070712_100002057
302 Ga0097621_100014927
303 Ga0068865_100021039
304 Ga0075436_100048256
305 Ga0097620_100000678
306 Ga0075435_100055118
307 Ga0099795_10159085
308 Ga0105250_10062676
309 Ga0105240_10041291
310 Ga0105240_10162903
311 Ga0105240_10404517
312 Ga0105240_10654746
313 Ga0105240_10747528
314 Ga0105245_10001541
315 Ga0105247_10000203
316 Ga0105247_10023960
317 Ga0105247_10068598
318 Ga0105241_10009366
319 Ga0105242_10003331
320 Ga0105248_10021621
321 Ga0105248_10219152
322 Ga0105248_10249551
323 Ga0105248_11275979
324 Ga0105237_10842994
325 Ga0105238_10201596
326 Ga0105238_10635622
327 Ga0105249_10062148
328 Ga0105249_10439980
329 Ga0099796_10001542
330 Ga0105239_10107870
331 Ga0157374_10007257
332 Ga0157378_10005368
333 Ga0163162_10110705
334 Ga0157375_10048534
335 Ga0163163_10023892
336 Ga0163163_10323517
337 Ga0163163_10359522
338 Ga0157379_10031321
339 Ga0157379_10041470
340 Ga0157379_10044347
341 Ga0157376_10207611
342 Ga0206350_11631742
343 Ga0213876_10107324
344 Ga0224712_10016147
345 Ga0207710_10001289
346 Ga0207680_10328907
347 Ga0207699_10003601
348 Ga0207654_10051062
349 Ga0207707_10146228
350 Ga0207707_10246729
351 Ga0207695_10112295
352 Ga0207695_10514676
353 Ga0207671_10459719
354 Ga0207693_10000059
355 Ga0207693_10029061
356 Ga0207663_10005288
357 Ga0207663_10238007
358 Ga0207652_10492790
359 Ga0207694_10448455
360 Ga0207700_10049632
361 Ga0207664_10012403
362 Ga0207664_10603680
363 Ga0207644_10050657
364 Ga0207644_10274701
365 Ga0207686_10019682
366 Ga0207704_10110000
367 Ga0207665_10001746
368 Ga0207665_10019427
369 Ga0207665_10430814
370 Ga0207711_10037649
371 Ga0207711_10066314
372 Ga0207711_10099962
373 Ga0207689_10278191
374 Ga0207661_10050213
375 Ga0207651_10100153
376 Ga0207712_10071307
377 Ga0207712_10114210
378 Ga0207668_10430545
379 Ga0207658_10007712
380 Ga0207658_10012851
381 Ga0207677_10026292
382 Ga0207703_10011729
383 Ga0207703_10578053
384 Ga0207678_10091552
385 Ga0207702_10029318
386 Ga0207641_10001095
387 Ga0207641_10029316
388 Ga0207641_10048969
389 Ga0207648_10104453
390 Ga0207675_100058464
391 Ga0207683_10015112
392 Ga0207698_10154529
393 Ga0268266_10027307
394 Ga0268266_10046253
395 Ga0268266_10329606
396 Ga0268265_10482689
397 Ga0268265_10999619
398 Ga0268264_10042203
399 Ga0268264_10164230
400 Ga0265334_10088959
401 Ga0307515_10483062
402 Ga0265331_10006675
403 Ga0307513_10372940
404 Ga0307509_10000013
405 Ga0307518_10111942
406 Ga0307510_10068991
407 Ga0373923_0068656
408 Ga0373955_0124474
409 Ga0373933_0142800
410 Ga0373947_0072580
411 Ga0373937_0002058
412 Ga0310109_013230
413 Ga0395900_0082133
414 Ga0395898_0090847
415 Ga0436365_1194336
416 Ga0436360_0345650
417 Ga0436363_0403225
418 Ga0436363_0463233
419 Ga0436363_0466998
420 Ga0436362_0334028
421 Ga0436362_0373853
422 Ga0451800_0710947
423 Ga0466969_0019305
424 Ga0466966_0010542
425 Ga0466966_0124562
426 Ga0466961_0025079
427 Ga0466971_0013263
428 Ga0466968_0015462
429 Ga0466968_0087537
430 Ga0466970_0016546
431 Ga0466957_0016912
432 Ga0466959_0052009
433 Ga0466959_0073197
434 Ga0466959_0076508
435 Ga0466959_0359939
436 Ga0466958_0059797
437 Ga0466958_0093802
438 Ga0466967_0492875
439 Ga0495580_0019583
440 Ga0495606_0074015
441 Ga0495630_0148090
442 Ga0495632_0080634
443 Ga0495666_0133826
444 Ga0495587_0032026
445 Ga0495625_0252683
446 Ga0495623_0075888
447 Ga0495671_0048199
448 Ga0495649_0179177
449 Ga0495604_0275966
450 Ga0496101_0003717
451 Ga0496104_0029075
452 Ga0496104_0138866
453 Ga0496105_0248486
454 Ga0496106_0003659
455 Ga0496106_0285840
456 Ga0496107_0294375
457 Ga0496108_0012883
458 Ga0496108_0121908
459 Ga0496108_0223349
460 Ga0496110_0020739
461 Ga0496111_0009312
462 Ga0496112_0017630
463 Ga0496112_0139774
464 Ga0496113_0066157
465 Ga0496113_0244683
466 Ga0496113_0400565
467 Ga0496114_0021120
468 Ga0496115_0054055
469 Ga0496121_0022214
470 Ga0496125_0009344
471 Ga0496126_0068854
472 nmdc:mga0rr50_48297_c1
473 nmdc:mga08x19_40549_c1
474 Ga0500646_0055282
475 Ga0500583_0023345
476 Ga0500583_0104426
477 Ga0500651_0129534
478 Ga0500641_0008255
479 Ga0500641_0025231
480 Ga0500556_0000152
481 Ga0500556_0079050
482 Ga0500594_0011166
483 Ga0500594_0246551
484 Ga0500642_0040581
485 Ga0500658_0007784
486 Ga0500577_0016082
487 Ga0500588_0009464
488 Ga0500616_0000032
489 Ga0500616_0026679
490 Ga0500637_0073776
491 Ga0500611_003345
492 Ga0466962_0003596

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03872

RseA_N

Anti sigma-E protein RseA, N-terminal domain

3

86

0.94

Map