F358388

General Info

Members Datasets Scaffolds Average Seq Length
246 115 239 370

Family's Representative Sequence

Representative Sequence 3300044659|Ga0466973_0145581|Ga0466973_0145581_682_1797
Length 371
Sequence MKIAYFTHSLLSCWNHGNAHFLRGVLSELQRRGHETLALEARDNWSLSNLVADHGVAGLDAMTEAYPELRTRCYGPGTRAADLTDGADLVIVHEWNDPGLVADIGRLRKRGAAFTLLFHDTHHRAVSDPKAIRAFDLSGYDGVLAFGEALSEVYRRWGWGDRVWTWHEAADTRIFHPPAKGETDRDGLVWIGNWGDGERTAELETYLFRPAREAGLPLDLYGVRYPDRALDMLRRYXXXYHGWAPNAKVPAIFAGALATVHVPRHYYATRLPGIPTIRMFEALACGIPLASAPWTDSEGLFRTGTDYLAARSGTEMSRHLRDIAHDSGLRASLAAHGLETIRSRHSCAHRVGQLLDIVDGIAAPLPARSIA

Samples

Sample ID Description Type Environment
1 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
2 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
3 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
4 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
5 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
6 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
7 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
8 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
89 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
90 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
91 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
92 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
93 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
98 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
105 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
108 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
109 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
110 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
111 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
112 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
115 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.15
Metatranscriptomes 0
Isolates 2.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 0.81
Rhizosphere 93.5
Stem 0
Stem Tuber 0
Unclassified 5.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10021586 3300001979 Bacteria 2230
2 JGI24735J21928_10026356 3300002067 Bacteria 1747
3 Ga0070658_10215838 3300005327 Bacteria 1621
4 Ga0070683_100006091 3300005329 Bacteria 10113
5 Ga0070683_100058036 3300005329 Bacteria 3596
6 Ga0070670_100045443 3300005331 Bacteria 3776
7 Ga0070680_100034855 3300005336 Bacteria 4060
8 Ga0070680_100042528 3300005336 Bacteria 3687
9 Ga0070660_100017857 3300005339 Bacteria 5174
10 Ga0070660_100067612 3300005339 Bacteria 2784
11 Ga0070660_100197945 3300005339 Bacteria 1629
12 Ga0070691_10001004 3300005341 Bacteria 11565
13 Ga0070661_100043236 3300005344 Bacteria 3291
14 Ga0070692_10056787 3300005345 Bacteria 2051
15 Ga0070668_100003366 3300005347 Bacteria 11790
16 Ga0070668_100012203 3300005347 Bacteria 6401
17 Ga0070669_100001263 3300005353 Bacteria 18356
18 Ga0070659_100209502 3300005366 Bacteria 1606
19 Ga0070663_100005470 3300005455 Bacteria 7548
20 Ga0070663_100155315 3300005455 Bacteria 1758
21 Ga0070679_100039683 3300005530 Bacteria 4680
22 Ga0070679_100122212 3300005530 Bacteria 2588
23 Ga0070679_100240138 3300005530 Bacteria 1769
24 Ga0070679_100446840 3300005530 Bacteria 1237
25 Ga0070684_100053511 3300005535 Bacteria 3514
26 Ga0070684_100283567 3300005535 Bacteria 1518
27 Ga0068853_100158955 3300005539 Bacteria 2038
28 Ga0070665_100001031 3300005548 Bacteria 34955
29 Ga0068855_100003065 3300005563 Bacteria 20440
30 Ga0068855_100086588 3300005563 Bacteria 3623
31 Ga0068855_100427266 3300005563 Bacteria 1448
32 Ga0070664_100021446 3300005564 Bacteria 5323
33 Ga0070664_100107123 3300005564 Bacteria 2436
34 Ga0068857_100015474 3300005577 Bacteria 6663
35 Ga0068857_100215775 3300005577 Bacteria 1751
36 Ga0068854_100121862 3300005578 Bacteria 1981
37 Ga0068856_100137370 3300005614 Bacteria 2450
38 Ga0068856_100211750 3300005614 Bacteria 1953
39 Ga0068856_100382194 3300005614 Bacteria 1427
40 Ga0068852_100000899 3300005616 Bacteria 19686
41 Ga0068852_100087758 3300005616 Bacteria 2776
42 Ga0068851_10008951 3300005834 Bacteria 4643
43 Ga0068863_100004037 3300005841 Bacteria 14491
44 Ga0068863_100092493 3300005841 Bacteria 2869
45 Ga0105251_10000231 3300009011 Bacteria 56229
46 Ga0105241_10210494 3300009174 Bacteria 1629
47 Ga0105237_10109067 3300009545 Bacteria 2760
48 Ga0105238_10023304 3300009551 Bacteria 6310
49 Ga0105238_10027890 3300009551 Bacteria 5754
50 Ga0157373_10058025 3300013100 Bacteria 2745
51 Ga0157373_10093030 3300013100 Bacteria 2123
52 Ga0157371_10102206 3300013102 Bacteria 2033
53 Ga0157370_10157132 3300013104 Bacteria 2116
54 Ga0157370_10174092 3300013104 Bacteria 2000
55 Ga0157370_10231686 3300013104 Bacteria 1709
56 Ga0157369_10100296 3300013105 Bacteria 3087
57 Ga0157369_10177175 3300013105 Bacteria 2244
58 Ga0157372_10063529 3300013307 Bacteria 4140
59 Ga0213873_10000017 3300021358 Bacteria 123962
60 Ga0213876_10000071 3300021384 Bacteria 123962
61 Ga0213875_10010058 3300021388 Bacteria 4755
62 Ga0207713_1000951 3300025735 Bacteria 25905
63 Ga0207710_10043236 3300025900 Bacteria 2003
64 Ga0207647_10001932 3300025904 Bacteria 15842
65 Ga0207647_10006173 3300025904 Bacteria 8731
66 Ga0207647_10010350 3300025904 Bacteria 6586
67 Ga0207705_10005601 3300025909 Bacteria 9389
68 Ga0207705_10250976 3300025909 Bacteria 1349
69 Ga0207695_10004751 3300025913 Bacteria 18383
70 Ga0207671_10038479 3300025914 Bacteria 3545
71 Ga0207660_10011244 3300025917 Bacteria 5822
72 Ga0207657_10009145 3300025919 Bacteria 9999
73 Ga0207657_10009436 3300025919 Bacteria 9806
74 Ga0207657_10027658 3300025919 Bacteria 5190
75 Ga0207657_10044428 3300025919 Bacteria 3905
76 Ga0207649_10030531 3300025920 Bacteria 3193
77 Ga0207649_10105220 3300025920 Bacteria 1875
78 Ga0207652_10004062 3300025921 Bacteria 11933
79 Ga0207681_10000774 3300025923 Bacteria 21043
80 Ga0207664_10129338 3300025929 Bacteria 2124
81 Ga0207664_10135454 3300025929 Bacteria 2078
82 Ga0207690_10017663 3300025932 Bacteria 4362
83 Ga0207690_10088168 3300025932 Bacteria 2185
84 Ga0207706_10020713 3300025933 Bacteria 5908
85 Ga0207706_10058889 3300025933 Bacteria 3383
86 Ga0207706_10162792 3300025933 Bacteria 1961
87 Ga0207661_10008664 3300025944 Bacteria 7270
88 Ga0207679_10127939 3300025945 Bacteria 2033
89 Ga0207667_10003709 3300025949 Bacteria 18842
90 Ga0207667_10015079 3300025949 Bacteria 8788
91 Ga0207667_10017791 3300025949 Bacteria 7992
92 Ga0207667_10098715 3300025949 Bacteria 3013
93 Ga0207667_10189130 3300025949 Bacteria 2113
94 Ga0207668_10009772 3300025972 Bacteria 5763
95 Ga0207640_10017861 3300025981 Bacteria 4156
96 Ga0207640_10097493 3300025981 Bacteria 2053
97 Ga0207640_10158791 3300025981 Bacteria 1670
98 Ga0207678_10004989 3300026067 Bacteria 11895
99 Ga0207678_10012107 3300026067 Bacteria 7574
100 Ga0207678_10017224 3300026067 Bacteria 6343
101 Ga0207678_10018119 3300026067 Bacteria 6185
102 Ga0207678_10038095 3300026067 Bacteria 4180
103 Ga0207678_10110773 3300026067 Bacteria 2342
104 Ga0207702_10149013 3300026078 Bacteria 2126
105 Ga0207702_10235705 3300026078 Bacteria 1712
106 Ga0207641_10005934 3300026088 Bacteria 10353
107 Ga0207641_10075641 3300026088 Bacteria 2908
108 Ga0207674_10015790 3300026116 Bacteria 8282
109 Ga0207674_10018667 3300026116 Bacteria 7532
110 Ga0207674_10030192 3300026116 Bacteria 5701
111 Ga0207698_10015756 3300026142 Bacteria 5076
112 Ga0207698_10041348 3300026142 Bacteria 3434
113 Ga0268264_10036204 3300028381 Bacteria 4064
114 Ga0307408_100411798 3300031548 Bacteria 1163
115 Ga0307405_10007433 3300031731 Bacteria 5480
116 Ga0307405_10049932 3300031731 Bacteria 2588
117 Ga0307405_10092523 3300031731 Bacteria 2006
118 Ga0307405_10109576 3300031731 Bacteria 1868
119 Ga0307413_10005739 3300031824 Bacteria 5579
120 Ga0307413_10058543 3300031824 Bacteria 2362
121 Ga0307413_10089534 3300031824 Bacteria 2000
122 Ga0307413_10173810 3300031824 Bacteria 1528
123 Ga0307410_10051652 3300031852 Bacteria 2772
124 Ga0307410_10062330 3300031852 Bacteria 2554
125 Ga0307410_10075222 3300031852 Bacteria 2354
126 Ga0307410_10154685 3300031852 Bacteria 1711
127 Ga0307407_10000454 3300031903 Bacteria 12550
128 Ga0307412_10001655 3300031911 Bacteria 12301
129 Ga0307409_100021777 3300031995 Bacteria 4403
130 Ga0307409_100043097 3300031995 Bacteria 3385
131 Ga0307409_100110889 3300031995 Bacteria 2300
132 Ga0307409_100219726 3300031995 Bacteria 1714
133 Ga0307409_100234334 3300031995 Bacteria 1666
134 Ga0307409_100240203 3300031995 Bacteria 1648
135 Ga0307416_100161456 3300032002 Bacteria 2072
136 Ga0307414_10007136 3300032004 Bacteria 6273
137 Ga0307414_10015186 3300032004 Bacteria 4642
138 Ga0307414_10048881 3300032004 Bacteria 2921
139 Ga0307414_10155209 3300032004 Bacteria 1811
140 Ga0307414_10276294 3300032004 Bacteria 1409
141 Ga0307411_10034212 3300032005 Bacteria 3160
142 Ga0307411_10038320 3300032005 Bacteria 3023
143 Ga0307411_10080349 3300032005 Bacteria 2242
144 Ga0307411_10109072 3300032005 Bacteria 1976
145 Ga0307411_10154151 3300032005 Bacteria 1711
146 Ga0395899_0000003 3300037312 Bacteria 1232684
147 Ga0395899_0040299 3300037312 Bacteria 3493
148 Ga0395899_0061218 3300037312 Bacteria 2772
149 Ga0395899_0119570 3300037312 Bacteria 1888
150 Ga0395899_0167261 3300037312 Bacteria 1550
151 Ga0395900_0002600 3300037418 Bacteria 19734
152 Ga0395900_0003653 3300037418 Bacteria 16536
153 Ga0395900_0038006 3300037418 Bacteria 4963
154 Ga0395900_0052580 3300037418 Bacteria 4193
155 Ga0395900_0064360 3300037418 Bacteria 3768
156 Ga0395900_0106552 3300037418 Bacteria 2879
157 Ga0395900_0143423 3300037418 Bacteria 2444
158 Ga0395898_0035584 3300037466 Bacteria 4949
159 Ga0395898_0040443 3300037466 Bacteria 4610
160 Ga0395898_0053196 3300037466 Bacteria 3954
161 Ga0395898_0072873 3300037466 Bacteria 3317
162 Ga0395898_0086321 3300037466 Bacteria 3024
163 Ga0395898_0089057 3300037466 Bacteria 2970
164 Ga0395898_0186084 3300037466 Bacteria 1984
165 Ga0395905_0025744 3300037471 Bacteria 5546
166 Ga0395905_0093642 3300037471 Bacteria 2817
167 Ga0395905_0095468 3300037471 Bacteria 2790
168 Ga0395905_0126930 3300037471 Bacteria 2399
169 Ga0395905_0137092 3300037471 Bacteria 2302
170 Ga0395905_0152661 3300037471 Bacteria 2172
171 Ga0395905_0166010 3300037471 Bacteria 2074
172 Ga0395905_0194384 3300037471 Bacteria 1902
173 Ga0436364_0727027 3300037853 Bacteria 25515
174 Ga0395901_0000041 3300038443 Bacteria 202314
175 Ga0395901_0112536 3300038443 Bacteria 2858
176 Ga0395901_0158673 3300038443 Bacteria 2375
177 Ga0395901_0188194 3300038443 Bacteria 2165
178 Ga0395901_0353745 3300038443 Bacteria 1516
179 Ga0436365_0363550 3300039437 Bacteria 9725
180 Ga0436362_1094363 3300039453 Bacteria 35955
181 Ga0466972_0002718 3300044658 Bacteria 8752
182 Ga0466972_0031059 3300044658 Bacteria 2629
183 Ga0466972_0034676 3300044658 Bacteria 2471
184 Ga0466972_0080939 3300044658 Bacteria 1547
185 Ga0466973_0145581 3300044659 Bacteria 1887
186 Ga0466965_0017668 3300044683 Bacteria 3413
187 Ga0466966_0009235 3300044684 Bacteria 6529
188 Ga0466961_0092107 3300044693 Bacteria 1913
189 Ga0466963_0008862 3300044694 Bacteria 6036
190 Ga0466963_0017606 3300044694 Bacteria 4456
191 Ga0466963_0020222 3300044694 Bacteria 4185
192 Ga0466963_0038061 3300044694 Bacteria 3144
193 Ga0466963_0064722 3300044694 Bacteria 2450
194 Ga0466963_0069922 3300044694 Bacteria 2360
195 Ga0466963_0236590 3300044694 Bacteria 1280
196 Ga0466964_0007765 3300044706 Bacteria 4015
197 Ga0466964_0015137 3300044706 Bacteria 2936
198 Ga0466964_0031143 3300044706 Bacteria 2114
199 Ga0466971_0052968 3300044719 Bacteria 1828
200 Ga0466968_0000809 3300044735 Bacteria 10903
201 Ga0466970_0002664 3300044765 Bacteria 8614
202 Ga0466970_0014976 3300044765 Bacteria 3987
203 Ga0466957_0042508 3300044842 Bacteria 2750
204 Ga0466957_0240597 3300044842 Bacteria 1201
205 Ga0466960_0104614 3300044901 Bacteria 1462
206 Ga0466959_0012955 3300045049 Bacteria 6037
207 Ga0466959_0017995 3300045049 Bacteria 5185
208 Ga0466959_0081407 3300045049 Bacteria 2333
209 Ga0466958_0004287 3300045836 Bacteria 7512
210 Ga0466958_0011168 3300045836 Bacteria 5052
211 Ga0466958_0014871 3300045836 Bacteria 4448
212 Ga0466958_0020196 3300045836 Bacteria 3884
213 Ga0466958_0036161 3300045836 Bacteria 2955
214 Ga0466958_0072679 3300045836 Bacteria 2106
215 Ga0466967_0008541 3300045976 Bacteria 7520
216 Ga0466967_0009900 3300045976 Bacteria 7111
217 Ga0466967_0010177 3300045976 Bacteria 7036
218 Ga0466967_0026309 3300045976 Bacteria 4817
219 Ga0466967_0041503 3300045976 Bacteria 3967
220 Ga0466967_0057738 3300045976 Bacteria 3427
221 Ga0466967_0086369 3300045976 Bacteria 2842
222 Ga0466967_0101289 3300045976 Bacteria 2632
223 Ga0466967_0113750 3300045976 Bacteria 2490
224 Ga0495606_0000231 3300046507 Bacteria 98418
225 Ga0495643_0000166 3300046522 Bacteria 104972
226 Ga0495643_0061193 3300046522 Bacteria 1997
227 Ga0495668_0000013 3300046616 Bacteria 452938
228 Ga0495686_0000145 3300047472 Bacteria 141946
229 Ga0496107_0068956 3300048910 Bacteria 2566
230 Ga0496118_0128561 3300048921 Bacteria 1632
231 Ga0496123_0010013 3300048926 Bacteria 8446
232 Ga0496124_0000631 3300048927 Bacteria 58432
233 Ga0496124_0178348 3300048927 Bacteria 1638
234 Ga0496125_0059781 3300048928 Bacteria 3068
235 Ga0501070_0105203 3300049586 Bacteria 2333
236 Ga0500556_0000207 3300053104 Bacteria 48431
237 Ga0466962_0003272 3300061719 Bacteria 7695
238 Ga0466962_0011933 3300061719 Bacteria 4180
239 Ga0466962_0028318 3300061719 Bacteria 2685

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021388 Ga0213875_10010058 Ga0213875_100100583 363
2 3300037853 Ga0436364_0727027 Ga0436364_0727027_3106_4203 363
3 iso_pu_bacteria 2818991466 2819713458 363
4 iso_pu_bacteria 2928526807 2928530297 363
5 iso_pu_bacteria 2928968154 2928971870 363
6 iso_pu_bacteria 2599185359 2600225176 364
7 iso_pu_bacteria 2879163058 2879164761 364
8 3300048928 Ga0496125_0059781 Ga0496125_0059781_39_1136 365
9 iso_pu_bacteria 2751185897 2753765412 365
10 iso_pu_bacteria 2885429604 2885430313 365
11 3300005331 Ga0070670_100045443 Ga0070670_1000454433 367
12 3300005347 Ga0070668_100003366 Ga0070668_1000033666 367
13 3300005347 Ga0070668_100012203 Ga0070668_1000122034 367
14 3300005353 Ga0070669_100001263 Ga0070669_10000126310 367
15 3300005548 Ga0070665_100001031 Ga0070665_10000103115 367
16 3300005578 Ga0068854_100121862 Ga0068854_1001218622 367
17 3300005841 Ga0068863_100004037 Ga0068863_10000403714 367
18 3300009011 Ga0105251_10000231 Ga0105251_1000023138 367
19 3300025735 Ga0207713_1000951 Ga0207713_100095112 367
20 3300025900 Ga0207710_10043236 Ga0207710_100432362 367
21 3300025923 Ga0207681_10000774 Ga0207681_1000077412 367
22 3300025972 Ga0207668_10009772 Ga0207668_100097724 367
23 3300025981 Ga0207640_10097493 Ga0207640_100974932 367
24 3300026088 Ga0207641_10005934 Ga0207641_1000593411 367
25 3300028381 Ga0268264_10036204 Ga0268264_100362044 367
26 3300031852 Ga0307410_10051652 Ga0307410_100516523 367
27 3300031911 Ga0307412_10001655 Ga0307412_100016552 367
28 3300032005 Ga0307411_10109072 Ga0307411_101090722 367
29 3300046507 Ga0495606_0000231 Ga0495606_0000231_11812_12918 367
30 3300046522 Ga0495643_0000166 Ga0495643_0000166_38370_39476 367
31 3300046616 Ga0495668_0000013 Ga0495668_0000013_129333_130439 367
32 3300047472 Ga0495686_0000145 Ga0495686_0000145_40231_41337 367
33 3300048921 Ga0496118_0128561 Ga0496118_0128561_318_1427 367
34 3300048926 Ga0496123_0010013 Ga0496123_0010013_1787_2899 367
35 3300048927 Ga0496124_0000631 Ga0496124_0000631_57246_58358 367
36 3300048927 Ga0496124_0178348 Ga0496124_0178348_480_1589 367
37 3300005455 Ga0070663_100005470 Ga0070663_1000054703 368
38 3300005563 Ga0068855_100003065 Ga0068855_10000306519 368
39 3300005616 Ga0068852_100000899 Ga0068852_10000089923 368
40 3300005841 Ga0068863_100092493 Ga0068863_1000924933 368
41 3300021358 Ga0213873_10000017 Ga0213873_10000017129 368
42 3300021384 Ga0213876_10000071 Ga0213876_100000718 368
43 3300025933 Ga0207706_10162792 Ga0207706_101627922 368
44 3300025949 Ga0207667_10003709 Ga0207667_1000370919 368
45 3300026067 Ga0207678_10012107 Ga0207678_100121073 368
46 3300026088 Ga0207641_10075641 Ga0207641_100756413 368
47 3300026142 Ga0207698_10015756 Ga0207698_100157562 368
48 3300031548 Ga0307408_100411798 Ga0307408_1004117981 368
49 3300031731 Ga0307405_10049932 Ga0307405_100499322 368
50 3300031731 Ga0307405_10092523 Ga0307405_100925231 368
51 3300031731 Ga0307405_10109576 Ga0307405_101095762 368
52 3300031824 Ga0307413_10005739 Ga0307413_100057392 368
53 3300031852 Ga0307410_10062330 Ga0307410_100623302 368
54 3300031852 Ga0307410_10154685 Ga0307410_101546852 368
55 3300031903 Ga0307407_10000454 Ga0307407_100004549 368
56 3300031995 Ga0307409_100043097 Ga0307409_1000430972 368
57 3300031995 Ga0307409_100219726 Ga0307409_1002197262 368
58 3300031995 Ga0307409_100240203 Ga0307409_1002402032 368
59 3300032002 Ga0307416_100161456 Ga0307416_1001614562 368
60 3300032004 Ga0307414_10007136 Ga0307414_100071367 368
61 3300032004 Ga0307414_10015186 Ga0307414_100151864 368
62 3300032005 Ga0307411_10034212 Ga0307411_100342122 368
63 3300032005 Ga0307411_10080349 Ga0307411_100803492 368
64 3300032005 Ga0307411_10154151 Ga0307411_101541512 368
65 3300039437 Ga0436365_0363550 Ga0436365_0363550_2594_3706 368
66 3300039453 Ga0436362_1094363 Ga0436362_1094363_28824_29936 368
67 3300044658 Ga0466972_0002718 Ga0466972_0002718_2589_3698 368
68 3300044658 Ga0466972_0031059 Ga0466972_0031059_62_1174 368
69 3300044659 Ga0466973_0145581 Ga0466973_0145581_682_1797 368
70 3300044683 Ga0466965_0017668 Ga0466965_0017668_2017_3126 368
71 3300044684 Ga0466966_0009235 Ga0466966_0009235_536_1657 368
72 3300044694 Ga0466963_0017606 Ga0466963_0017606_2973_4082 368
73 3300044706 Ga0466964_0007765 Ga0466964_0007765_628_1737 368
74 3300044719 Ga0466971_0052968 Ga0466971_0052968_202_1311 368
75 3300044765 Ga0466970_0002664 Ga0466970_0002664_1525_2634 368
76 3300044842 Ga0466957_0042508 Ga0466957_0042508_1584_2693 368
77 3300045049 Ga0466959_0012955 Ga0466959_0012955_3823_4932 368
78 3300045836 Ga0466958_0011168 Ga0466958_0011168_2758_3867 368
79 3300045836 Ga0466958_0072679 Ga0466958_0072679_619_1728 368
80 3300045976 Ga0466967_0008541 Ga0466967_0008541_5290_6399 368
81 3300061719 Ga0466962_0003272 Ga0466962_0003272_6531_7640 368
82 3300001979 JGI24740J21852_10021586 JGI24740J21852_100215862 369
83 3300002067 JGI24735J21928_10026356 JGI24735J21928_100263562 369
84 3300005327 Ga0070658_10215838 Ga0070658_102158382 369
85 3300005329 Ga0070683_100006091 Ga0070683_1000060912 369
86 3300005329 Ga0070683_100058036 Ga0070683_1000580362 369
87 3300005336 Ga0070680_100034855 Ga0070680_1000348552 369
88 3300005336 Ga0070680_100042528 Ga0070680_1000425282 369
89 3300005339 Ga0070660_100017857 Ga0070660_1000178574 369
90 3300005339 Ga0070660_100067612 Ga0070660_1000676122 369
91 3300005339 Ga0070660_100197945 Ga0070660_1001979452 369
92 3300005341 Ga0070691_10001004 Ga0070691_1000100412 369
93 3300005344 Ga0070661_100043236 Ga0070661_1000432363 369
94 3300005345 Ga0070692_10056787 Ga0070692_100567872 369
95 3300005366 Ga0070659_100209502 Ga0070659_1002095022 369
96 3300005455 Ga0070663_100155315 Ga0070663_1001553151 369
97 3300005530 Ga0070679_100039683 Ga0070679_1000396834 369
98 3300005530 Ga0070679_100122212 Ga0070679_1001222123 369
99 3300005530 Ga0070679_100240138 Ga0070679_1002401382 369
100 3300005530 Ga0070679_100446840 Ga0070679_1004468401 369
101 3300005535 Ga0070684_100053511 Ga0070684_1000535113 369
102 3300005535 Ga0070684_100283567 Ga0070684_1002835671 369
103 3300005539 Ga0068853_100158955 Ga0068853_1001589552 369
104 3300005563 Ga0068855_100086588 Ga0068855_1000865883 369
105 3300005563 Ga0068855_100427266 Ga0068855_1004272662 369
106 3300005564 Ga0070664_100021446 Ga0070664_1000214462 369
107 3300005564 Ga0070664_100107123 Ga0070664_1001071232 369
108 3300005577 Ga0068857_100015474 Ga0068857_1000154746 369
109 3300005577 Ga0068857_100215775 Ga0068857_1002157752 369
110 3300005614 Ga0068856_100137370 Ga0068856_1001373702 369
111 3300005614 Ga0068856_100211750 Ga0068856_1002117502 369
112 3300005614 Ga0068856_100382194 Ga0068856_1003821942 369
113 3300005616 Ga0068852_100087758 Ga0068852_1000877582 369
114 3300005834 Ga0068851_10008951 Ga0068851_100089512 369
115 3300009174 Ga0105241_10210494 Ga0105241_102104941 369
116 3300009545 Ga0105237_10109067 Ga0105237_101090673 369
117 3300009551 Ga0105238_10023304 Ga0105238_100233044 369
118 3300009551 Ga0105238_10027890 Ga0105238_100278904 369
119 3300013100 Ga0157373_10058025 Ga0157373_100580253 369
120 3300013100 Ga0157373_10093030 Ga0157373_100930302 369
121 3300013102 Ga0157371_10102206 Ga0157371_101022062 369
122 3300013104 Ga0157370_10157132 Ga0157370_101571322 369
123 3300013104 Ga0157370_10174092 Ga0157370_101740922 369
124 3300013104 Ga0157370_10231686 Ga0157370_102316862 369
125 3300013105 Ga0157369_10100296 Ga0157369_101002963 369
126 3300013105 Ga0157369_10177175 Ga0157369_101771752 369
127 3300013307 Ga0157372_10063529 Ga0157372_100635291 369
128 3300025904 Ga0207647_10001932 Ga0207647_1000193213 369
129 3300025904 Ga0207647_10006173 Ga0207647_100061732 369
130 3300025904 Ga0207647_10010350 Ga0207647_100103504 369
131 3300025909 Ga0207705_10005601 Ga0207705_100056013 369
132 3300025909 Ga0207705_10250976 Ga0207705_102509762 369
133 3300025913 Ga0207695_10004751 Ga0207695_1000475118 369
134 3300025914 Ga0207671_10038479 Ga0207671_100384793 369
135 3300025917 Ga0207660_10011244 Ga0207660_100112442 369
136 3300025919 Ga0207657_10009145 Ga0207657_100091452 369
137 3300025919 Ga0207657_10009436 Ga0207657_100094369 369
138 3300025919 Ga0207657_10027658 Ga0207657_100276584 369
139 3300025919 Ga0207657_10044428 Ga0207657_100444282 369
140 3300025920 Ga0207649_10030531 Ga0207649_100305312 369
141 3300025920 Ga0207649_10105220 Ga0207649_101052202 369
142 3300025921 Ga0207652_10004062 Ga0207652_100040623 369
143 3300025929 Ga0207664_10129338 Ga0207664_101293382 369
144 3300025929 Ga0207664_10135454 Ga0207664_101354542 369
145 3300025932 Ga0207690_10017663 Ga0207690_100176633 369
146 3300025932 Ga0207690_10088168 Ga0207690_100881682 369
147 3300025933 Ga0207706_10020713 Ga0207706_100207134 369
148 3300025933 Ga0207706_10058889 Ga0207706_100588892 369
149 3300025944 Ga0207661_10008664 Ga0207661_100086643 369
150 3300025945 Ga0207679_10127939 Ga0207679_101279392 369
151 3300025949 Ga0207667_10015079 Ga0207667_100150792 369
152 3300025949 Ga0207667_10017791 Ga0207667_100177914 369
153 3300025949 Ga0207667_10098715 Ga0207667_100987153 369
154 3300025949 Ga0207667_10189130 Ga0207667_101891302 369
155 3300025981 Ga0207640_10017861 Ga0207640_100178613 369
156 3300025981 Ga0207640_10158791 Ga0207640_101587912 369
157 3300026067 Ga0207678_10004989 Ga0207678_100049898 369
158 3300026067 Ga0207678_10017224 Ga0207678_100172243 369
159 3300026067 Ga0207678_10018119 Ga0207678_100181193 369
160 3300026067 Ga0207678_10038095 Ga0207678_100380954 369
161 3300026067 Ga0207678_10110773 Ga0207678_101107732 369
162 3300026078 Ga0207702_10149013 Ga0207702_101490132 369
163 3300026078 Ga0207702_10235705 Ga0207702_102357052 369
164 3300026116 Ga0207674_10015790 Ga0207674_100157903 369
165 3300026116 Ga0207674_10018667 Ga0207674_100186672 369
166 3300026116 Ga0207674_10030192 Ga0207674_100301923 369
167 3300026142 Ga0207698_10041348 Ga0207698_100413482 369
168 3300031731 Ga0307405_10007433 Ga0307405_100074334 369
169 3300031824 Ga0307413_10058543 Ga0307413_100585432 369
170 3300031824 Ga0307413_10089534 Ga0307413_100895342 369
171 3300031824 Ga0307413_10173810 Ga0307413_101738102 369
172 3300031852 Ga0307410_10075222 Ga0307410_100752223 369
173 3300031995 Ga0307409_100021777 Ga0307409_1000217774 369
174 3300031995 Ga0307409_100110889 Ga0307409_1001108892 369
175 3300031995 Ga0307409_100234334 Ga0307409_1002343342 369
176 3300032004 Ga0307414_10048881 Ga0307414_100488812 369
177 3300032004 Ga0307414_10155209 Ga0307414_101552092 369
178 3300032004 Ga0307414_10276294 Ga0307414_102762942 369
179 3300032005 Ga0307411_10038320 Ga0307411_100383203 369
180 3300037312 Ga0395899_0000003 Ga0395899_0000003_361963_363159 369
181 3300037312 Ga0395899_0040299 Ga0395899_0040299_883_1992 369
182 3300037312 Ga0395899_0061218 Ga0395899_0061218_1555_2664 369
183 3300037312 Ga0395899_0119570 Ga0395899_0119570_408_1517 369
184 3300037312 Ga0395899_0167261 Ga0395899_0167261_39_1148 369
185 3300037418 Ga0395900_0002600 Ga0395900_0002600_12075_13184 369
186 3300037418 Ga0395900_0003653 Ga0395900_0003653_12590_13711 369
187 3300037418 Ga0395900_0038006 Ga0395900_0038006_58_1167 369
188 3300037418 Ga0395900_0052580 Ga0395900_0052580_2899_4008 369
189 3300037418 Ga0395900_0064360 Ga0395900_0064360_1168_2277 369
190 3300037418 Ga0395900_0106552 Ga0395900_0106552_607_1716 369
191 3300037418 Ga0395900_0143423 Ga0395900_0143423_210_1319 369
192 3300037466 Ga0395898_0035584 Ga0395898_0035584_548_1657 369
193 3300037466 Ga0395898_0040443 Ga0395898_0040443_2367_3476 369
194 3300037466 Ga0395898_0053196 Ga0395898_0053196_380_1489 369
195 3300037466 Ga0395898_0072873 Ga0395898_0072873_375_1484 369
196 3300037466 Ga0395898_0086321 Ga0395898_0086321_1527_2636 369
197 3300037466 Ga0395898_0089057 Ga0395898_0089057_1737_2846 369
198 3300037466 Ga0395898_0186084 Ga0395898_0186084_837_1946 369
199 3300037471 Ga0395905_0025744 Ga0395905_0025744_4064_5185 369
200 3300037471 Ga0395905_0093642 Ga0395905_0093642_1306_2415 369
201 3300037471 Ga0395905_0095468 Ga0395905_0095468_376_1485 369
202 3300037471 Ga0395905_0126930 Ga0395905_0126930_790_1911 369
203 3300037471 Ga0395905_0137092 Ga0395905_0137092_791_1900 369
204 3300037471 Ga0395905_0152661 Ga0395905_0152661_61_1170 369
205 3300037471 Ga0395905_0166010 Ga0395905_0166010_586_1707 369
206 3300037471 Ga0395905_0194384 Ga0395905_0194384_161_1270 369
207 3300038443 Ga0395901_0000041 Ga0395901_0000041_170341_171450 369
208 3300038443 Ga0395901_0112536 Ga0395901_0112536_403_1512 369
209 3300038443 Ga0395901_0158673 Ga0395901_0158673_1168_2277 369
210 3300038443 Ga0395901_0188194 Ga0395901_0188194_465_1574 369
211 3300038443 Ga0395901_0353745 Ga0395901_0353745_44_1153 369
212 3300044658 Ga0466972_0034676 Ga0466972_0034676_1304_2413 369
213 3300044658 Ga0466972_0080939 Ga0466972_0080939_164_1300 369
214 3300044693 Ga0466961_0092107 Ga0466961_0092107_34_1155 369
215 3300044694 Ga0466963_0008862 Ga0466963_0008862_1737_2846 369
216 3300044694 Ga0466963_0020222 Ga0466963_0020222_1500_2609 369
217 3300044694 Ga0466963_0038061 Ga0466963_0038061_813_1922 369
218 3300044694 Ga0466963_0064722 Ga0466963_0064722_310_1419 369
219 3300044694 Ga0466963_0069922 Ga0466963_0069922_323_1432 369
220 3300044694 Ga0466963_0236590 Ga0466963_0236590_86_1195 369
221 3300044706 Ga0466964_0015137 Ga0466964_0015137_212_1333 369
222 3300044706 Ga0466964_0031143 Ga0466964_0031143_901_2022 369
223 3300044735 Ga0466968_0000809 Ga0466968_0000809_269_1390 369
224 3300044765 Ga0466970_0014976 Ga0466970_0014976_2488_3609 369
225 3300044842 Ga0466957_0240597 Ga0466957_0240597_37_1146 369
226 3300044901 Ga0466960_0104614 Ga0466960_0104614_106_1215 369
227 3300045049 Ga0466959_0017995 Ga0466959_0017995_2798_3919 369
228 3300045049 Ga0466959_0081407 Ga0466959_0081407_1177_2298 369
229 3300045836 Ga0466958_0004287 Ga0466958_0004287_4931_6052 369
230 3300045836 Ga0466958_0014871 Ga0466958_0014871_190_1299 369
231 3300045836 Ga0466958_0020196 Ga0466958_0020196_55_1164 369
232 3300045836 Ga0466958_0036161 Ga0466958_0036161_520_1629 369
233 3300045976 Ga0466967_0009900 Ga0466967_0009900_1768_2877 369
234 3300045976 Ga0466967_0010177 Ga0466967_0010177_5129_6250 369
235 3300045976 Ga0466967_0026309 Ga0466967_0026309_1268_2389 369
236 3300045976 Ga0466967_0041503 Ga0466967_0041503_2617_3726 369
237 3300045976 Ga0466967_0057738 Ga0466967_0057738_399_1508 369
238 3300045976 Ga0466967_0086369 Ga0466967_0086369_822_1931 369
239 3300045976 Ga0466967_0101289 Ga0466967_0101289_134_1243 369
240 3300045976 Ga0466967_0113750 Ga0466967_0113750_637_1746 369
241 3300046522 Ga0495643_0061193 Ga0495643_0061193_277_1386 369
242 3300048910 Ga0496107_0068956 Ga0496107_0068956_1308_2417 369
243 3300049586 Ga0501070_0105203 Ga0501070_0105203_592_1701 369
244 3300053104 Ga0500556_0000207 Ga0500556_0000207_19327_20436 369
245 3300061719 Ga0466962_0011933 Ga0466962_0011933_184_1305 369
246 3300061719 Ga0466962_0028318 Ga0466962_0028318_649_1758 369

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13524

Glyco_trans_1_2

Glycosyl transferases group 1

199

356

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f9f-assembly1.cif.gz_A crystal structure of the putative mannosyl transferase (wbaz-1)from archaeoglobus fulgidus, northeast structural genomics target gr29a. 0.745 175 343
3mbo-assembly3.cif.gz_E crystal structure of the glycosyltransferase babsha bound with udp and l-malate 0.7428 1 360
5i45-assembly1.cif.gz_A 1.35 angstrom crystal structure of c-terminal domain of glycosyl transferase group 1 family protein (lpcc) from francisella tularensis. 0.742 172 345
2jjm-assembly1.cif.gz_B crystal structure of a family gt4 glycosyltransferase from bacillus anthracis orf ba1558. 0.7377 1 360
3mbo-assembly2.cif.gz_C crystal structure of the glycosyltransferase babsha bound with udp and l-malate 0.7328 1 360
ID Description Score Start End Superfamily
af_Q58577_179_333_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7752 185 343 3.40.50.2000
af_Q58577_179_333_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7663 185 343 3.40.50.2000
af_P16661_240_434_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7636 184 343 3.40.50.2000
3okaA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7599 171 341 3.40.50.2000
5d00A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7573 180 342 3.40.50.2000
ID Description Score Start End GO Terms
AF-B1M3L7-F1-model_v4 Spore protein YkvP/CgeB glycosyl transferase-like domain-containing protein 0.9857 1 369 GO:0016757
AF-A0A520ICV9-F1-model_v4 Glycosyltransferase 0.9846 75 361 GO:0016740
AF-B1M3L7-F1-model_v4 Spore protein YkvP/CgeB glycosyl transferase-like domain-containing protein 0.983 1 369 GO:0016757
AF-A0A4Q3WX20-F1-model_v4 deleted 0.9823 1 361
AF-A0A0M2M3P1-F1-model_v4 Glycosyltransferase 0.979 101 369 GO:0016740

Feature Viewer

pLDDT pTM Quality
91.53 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map