F358258

General Info

Members Datasets Scaffolds Average Seq Length
246 119 492 214

Family's Representative Sequence

Representative Sequence 3300028563|Ga0265319_1002659|Ga0265319_10026594
Length 240
Sequence LDTVEQLHDRLAARFPAAHVAVVTNPGPAAEHSLLLDPAHAHDIALFLRDDPALRLDYCSNVTGIDWPDKEITDTVKTSVPDPAGGPPKTVEQKTVHVQPGCLEAVYHLYSMALKHGPVIIRLRTANRTDRVALPSLTPVWRACDFQEREVYDLYGIVFERHPDLRRLLMWDEFKDHPMRKDYVEPDDYEWEPTAHGAILEKAKAHQSAASPVAGVADPGPTIKAPGSPSPATARPEARP

Samples

Sample ID Description Type Environment
1 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
71 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
72 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
73 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
74 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
75 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
78 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
80 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
81 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
82 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
83 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
92 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
93 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
99 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
100 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
101 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
102 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
108 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
112 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
119 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.15
Metatranscriptomes 2.44
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.81
Rhizosphere 97.97
Stem 0
Stem Tuber 0
Unclassified 7.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265319_1002659 3300028563 Bacteria 9595
2 rootH2_10009122 3300003320 Bacteria 11891
3 rootH2_10052670 3300003320 Bacteria 4768
4 Ga0065704_10079155 3300005289 Bacteria 4243
5 Ga0065707_10014467 3300005295 Bacteria 1749
6 Ga0070658_10006417 3300005327 Bacteria 9531
7 Ga0070658_10270343 3300005327 Bacteria 1445
8 Ga0070658_10930469 3300005327 Bacteria 756
9 Ga0070683_100004288 3300005329 Bacteria 11712
10 Ga0070680_100188479 3300005336 Bacteria 1738
11 Ga0070660_100098979 3300005339 Bacteria 2309
12 Ga0070660_100201397 3300005339 Bacteria 1615
13 Ga0070661_100015891 3300005344 Bacteria 5311
14 Ga0070671_100287216 3300005355 Bacteria 1400
15 Ga0070709_10467758 3300005434 Unclassified 953
16 Ga0070714_100066857 3300005435 Bacteria 3098
17 Ga0070713_100236063 3300005436 Bacteria 1664
18 Ga0070708_100122400 3300005445 Bacteria 2401
19 Ga0070708_100649613 3300005445 Bacteria 994
20 Ga0070678_100564062 3300005456 Bacteria 1012
21 Ga0070681_10534951 3300005458 Bacteria 1085
22 Ga0070681_10786296 3300005458 Bacteria 869
23 Ga0070706_100013539 3300005467 Bacteria 7542
24 Ga0070706_100131232 3300005467 Bacteria 2338
25 Ga0070706_100237633 3300005467 Bacteria 1701
26 Ga0070707_100017162 3300005468 Bacteria 6802
27 Ga0070707_100972315 3300005468 Bacteria 814
28 Ga0070698_100007605 3300005471 Bacteria 11725
29 Ga0070698_100024310 3300005471 Bacteria 6321
30 Ga0070698_100310084 3300005471 Bacteria 1509
31 Ga0070699_100147581 3300005518 Bacteria 2078
32 Ga0070699_100256402 3300005518 Bacteria 1564
33 Ga0070679_100016261 3300005530 Bacteria 7168
34 Ga0070697_100227385 3300005536 Bacteria 1590
35 Ga0070697_100326240 3300005536 Bacteria 1323
36 Ga0070686_100036615 3300005544 Bacteria 3040
37 Ga0070686_100274329 3300005544 Bacteria 1241
38 Ga0070665_101309523 3300005548 Unclassified 734
39 Ga0068855_100031084 3300005563 Bacteria 6379
40 Ga0068855_100121092 3300005563 Bacteria 2995
41 Ga0068855_100210546 3300005563 Bacteria 2185
42 Ga0068856_100423240 3300005614 Bacteria 1352
43 Ga0068852_100095163 3300005616 Bacteria 2674
44 Ga0068863_100036304 3300005841 Bacteria 4695
45 Ga0081455_10055878 3300005937 Bacteria 3355
46 Ga0070717_10015433 3300006028 Bacteria 5902
47 Ga0070717_10156069 3300006028 Bacteria 1977
48 Ga0075435_100166639 3300007076 Bacteria 1858
49 Ga0099794_10285166 3300007265 Bacteria 854
50 Ga0105240_10266629 3300009093 Bacteria 1974
51 Ga0105240_10644682 3300009093 Bacteria 1162
52 Ga0105240_10907872 3300009093 Bacteria 947
53 Ga0105245_11270717 3300009098 Unclassified 785
54 Ga0105238_10034871 3300009551 Bacteria 5118
55 Ga0105249_11212445 3300009553 Unclassified 826
56 Ga0105239_10025488 3300010375 Bacteria 6511
57 Ga0157369_10004551 3300013105 Bacteria 16308
58 Ga0157369_10106727 3300013105 Bacteria 2980
59 Ga0157369_10763241 3300013105 Bacteria 994
60 Ga0157374_10085775 3300013296 Bacteria 2995
61 Ga0157374_10341510 3300013296 Bacteria 1486
62 Ga0157374_10382211 3300013296 Bacteria 1403
63 Ga0157374_10473016 3300013296 Bacteria 1256
64 Ga0157378_10013898 3300013297 Bacteria 7041
65 Ga0157378_10729350 3300013297 Bacteria 1012
66 Ga0157372_10035989 3300013307 Bacteria 5453
67 Ga0157379_10314688 3300014968 Bacteria 1428
68 Ga0157379_10930190 3300014968 Bacteria 826
69 Ga0197907_10788504 3300020069 Bacteria 838
70 Ga0206356_10199215 3300020070 Bacteria 1422
71 Ga0206352_10358875 3300020078 Bacteria 1092
72 Ga0206350_11032631 3300020080 Bacteria 1117
73 Ga0206350_11626476 3300020080 Bacteria 1534
74 Ga0224572_1018693 3300024225 Bacteria 1332
75 Ga0207699_10407877 3300025906 Unclassified 969
76 Ga0207705_10003109 3300025909 Bacteria 12661
77 Ga0207684_10038928 3300025910 Bacteria 4035
78 Ga0207684_10047119 3300025910 Bacteria 3657
79 Ga0207684_10108352 3300025910 Bacteria 2377
80 Ga0207707_10401257 3300025912 Bacteria 1177
81 Ga0207693_10059101 3300025915 Bacteria 3003
82 Ga0207663_10332490 3300025916 Unclassified 1145
83 Ga0207657_10114834 3300025919 Bacteria 2220
84 Ga0207657_10125901 3300025919 Bacteria 2104
85 Ga0207652_10790319 3300025921 Bacteria 843
86 Ga0207646_10008068 3300025922 Bacteria 10613
87 Ga0207646_10136354 3300025922 Unclassified 2210
88 Ga0207694_10309137 3300025924 Bacteria 1303
89 Ga0207700_10159254 3300025928 Bacteria 1873
90 Ga0207664_10026874 3300025929 Bacteria 4356
91 Ga0207690_10121762 3300025932 Bacteria 1896
92 Ga0207661_10007139 3300025944 Bacteria 7936
93 Ga0207661_10259971 3300025944 Bacteria 1546
94 Ga0207661_10264584 3300025944 Bacteria 1533
95 Ga0207679_10253354 3300025945 Bacteria 1498
96 Ga0207667_10112552 3300025949 Bacteria 2807
97 Ga0207667_10136620 3300025949 Bacteria 2524
98 Ga0207667_10212893 3300025949 Bacteria 1981
99 Ga0207703_10290079 3300026035 Bacteria 1489
100 Ga0207639_10062117 3300026041 Unclassified 2887
101 Ga0207702_10292240 3300026078 Bacteria 1544
102 Ga0207641_10040087 3300026088 Bacteria 3919
103 Ga0207683_10344137 3300026121 Bacteria 1368
104 Ga0207698_10060427 3300026142 Bacteria 2947
105 Ga0265337_1003473 3300028556 Bacteria 6822
106 Ga0265337_1013751 3300028556 Bacteria 2703
107 Ga0265319_1002845 3300028563 Bacteria 9255
108 Ga0265319_1004357 3300028563 Bacteria 7022
109 Ga0265319_1007186 3300028563 Bacteria 5045
110 Ga0265319_1023834 3300028563 Bacteria 2212
111 Ga0265334_10009405 3300028573 Bacteria 4135
112 Ga0265334_10011992 3300028573 Bacteria 3641
113 Ga0265318_10000038 3300028577 Bacteria 136367
114 Ga0265318_10000372 3300028577 Bacteria 35288
115 Ga0265318_10026125 3300028577 Bacteria 2301
116 Ga0265318_10030867 3300028577 Bacteria 2082
117 Ga0265318_10050208 3300028577 Unclassified 1568
118 Ga0265318_10057116 3300028577 Bacteria 1459
119 Ga0265318_10108027 3300028577 Bacteria 1023
120 Ga0265323_10000632 3300028653 Bacteria 19237
121 Ga0265323_10089577 3300028653 Unclassified 1030
122 Ga0265322_10003492 3300028654 Bacteria 4741
123 Ga0265336_10007644 3300028666 Bacteria 3836
124 Ga0265336_10013311 3300028666 Bacteria 2745
125 Ga0265338_10000210 3300028800 Bacteria 107885
126 Ga0265338_10000312 3300028800 Bacteria 87999
127 Ga0265338_10002280 3300028800 Bacteria 29236
128 Ga0265338_10003029 3300028800 Bacteria 24221
129 Ga0265338_10042368 3300028800 Bacteria 4240
130 Ga0265338_10107760 3300028800 Bacteria 2252
131 Ga0265338_10134014 3300028800 Bacteria 1951
132 Ga0265338_10163577 3300028800 Bacteria 1716
133 Ga0265338_10463173 3300028800 Bacteria 896
134 Ga0265338_10468603 3300028800 Bacteria 890
135 Ga0265324_10014081 3300029957 Bacteria 2968
136 Ga0265324_10034663 3300029957 Bacteria 1758
137 Ga0265324_10078197 3300029957 Bacteria 1126
138 Ga0265760_10061268 3300031090 Bacteria 1144
139 Ga0265330_10008019 3300031235 Bacteria 5114
140 Ga0265330_10009087 3300031235 Bacteria 4738
141 Ga0265330_10037719 3300031235 Bacteria 2151
142 Ga0265330_10103109 3300031235 Bacteria 1220
143 Ga0265332_10027144 3300031238 Bacteria 2509
144 Ga0265332_10068387 3300031238 Bacteria 1514
145 Ga0265332_10166884 3300031238 Bacteria 919
146 Ga0265332_10216787 3300031238 Unclassified 794
147 Ga0265328_10027722 3300031239 Bacteria 2122
148 Ga0265328_10060631 3300031239 Bacteria 1389
149 Ga0265328_10075658 3300031239 Unclassified 1239
150 Ga0265320_10000646 3300031240 Bacteria 26600
151 Ga0265320_10002344 3300031240 Bacteria 13264
152 Ga0265320_10004420 3300031240 Bacteria 9217
153 Ga0265320_10007187 3300031240 Bacteria 6935
154 Ga0265320_10027966 3300031240 Bacteria 2933
155 Ga0265320_10031969 3300031240 Bacteria 2699
156 Ga0265320_10056230 3300031240 Bacteria 1891
157 Ga0265320_10061526 3300031240 Bacteria 1789
158 Ga0265320_10121856 3300031240 Bacteria 1188
159 Ga0265320_10157626 3300031240 Bacteria 1023
160 Ga0265325_10000731 3300031241 Bacteria 23769
161 Ga0265325_10007901 3300031241 Bacteria 6328
162 Ga0265325_10009066 3300031241 Bacteria 5836
163 Ga0265325_10083781 3300031241 Bacteria 1581
164 Ga0265340_10035195 3300031247 Bacteria 2488
165 Ga0265340_10054166 3300031247 Bacteria 1935
166 Ga0265340_10096007 3300031247 Bacteria 1381
167 Ga0265339_10002003 3300031249 Bacteria 14962
168 Ga0265339_10018966 3300031249 Bacteria 4045
169 Ga0265331_10006720 3300031250 Bacteria 6744
170 Ga0265331_10038624 3300031250 Unclassified 2333
171 Ga0265327_10000029 3300031251 Bacteria 352607
172 Ga0265327_10001693 3300031251 Bacteria 26349
173 Ga0265327_10002003 3300031251 Bacteria 23024
174 Ga0265327_10005729 3300031251 Bacteria 10237
175 Ga0265327_10027709 3300031251 Bacteria 3255
176 Ga0265327_10064169 3300031251 Bacteria 1862
177 Ga0265316_10003282 3300031344 Bacteria 16413
178 Ga0265316_10008950 3300031344 Bacteria 9235
179 Ga0265316_10020067 3300031344 Bacteria 5698
180 Ga0265316_10120002 3300031344 Bacteria 1986
181 Ga0265316_10148624 3300031344 Bacteria 1756
182 Ga0265316_10193844 3300031344 Bacteria 1508
183 Ga0265316_10212038 3300031344 Bacteria 1432
184 Ga0265316_10260222 3300031344 Bacteria 1272
185 Ga0265316_10420155 3300031344 Bacteria 961
186 Ga0265313_10003683 3300031595 Bacteria 12239
187 Ga0265313_10008107 3300031595 Bacteria 7031
188 Ga0265313_10030789 3300031595 Bacteria 2757
189 Ga0265313_10030894 3300031595 Bacteria 2751
190 Ga0265313_10047055 3300031595 Bacteria 2090
191 Ga0265314_10015607 3300031711 Bacteria 6021
192 Ga0265314_10016058 3300031711 Bacteria 5928
193 Ga0265314_10044635 3300031711 Bacteria 3141
194 Ga0265314_10080072 3300031711 Bacteria 2158
195 Ga0265314_10080164 3300031711 Bacteria 2156
196 Ga0265314_10342390 3300031711 Unclassified 825
197 Ga0265342_10003789 3300031712 Bacteria 12191
198 Ga0265342_10033541 3300031712 Bacteria 3156
199 Ga0265342_10053888 3300031712 Bacteria 2392
200 Ga0265342_10076395 3300031712 Bacteria 1941
201 Ga0265342_10105809 3300031712 Unclassified 1597
202 Ga0373942_0034690 3300035207 Bacteria 1351
203 Ga0373935_0584481 3300035692 Unclassified 816
204 Ga0373937_0342307 3300036401 Bacteria 1416
205 Ga0373925_0118258 3300037068 Bacteria 2055
206 Ga0395900_0162176 3300037418 Bacteria 2280
207 Ga0395905_0800947 3300037471 Bacteria 845
208 Ga0439448_0004722 3300042005 Bacteria 3857
209 Ga0439451_005747 3300042009 Unclassified 2538
210 Ga0451577_0000087 3300042876 Bacteria 207662
211 Ga0451577_0133446 3300042876 Bacteria 2229
212 Ga0451577_0233026 3300042876 Bacteria 1665
213 Ga0451577_0397787 3300042876 Bacteria 1250
214 Ga0466969_0127046 3300044656 Bacteria 1184
215 Ga0453683_0003708 3300044673 Bacteria 11168
216 Ga0453683_0311341 3300044673 Bacteria 1008
217 Ga0466961_0198848 3300044693 Bacteria 1240
218 Ga0453684_0003020 3300044712 Bacteria 39129
219 Ga0453684_0092219 3300044712 Bacteria 3735
220 Ga0453684_0095434 3300044712 Bacteria 3655
221 Ga0453684_0240977 3300044712 Bacteria 2082
222 Ga0453684_0407317 3300044712 Bacteria 1522
223 Ga0466959_0082969 3300045049 Bacteria 2309
224 Ga0451576_0000098 3300045051 Bacteria 220454
225 Ga0451576_0000748 3300045051 Bacteria 64840
226 Ga0451576_0020753 3300045051 Bacteria 7150
227 Ga0451576_0079551 3300045051 Bacteria 3411
228 Ga0451576_0245162 3300045051 Bacteria 1872
229 Ga0451576_0267584 3300045051 Bacteria 1787
230 Ga0451576_0449356 3300045051 Bacteria 1353
231 Ga0495592_0000372 3300046454 Bacteria 35416
232 Ga0495582_0393716 3300046473 Bacteria 799
233 Ga0495628_0001014 3300046516 Bacteria 25650
234 Ga0495645_0102792 3300046543 Bacteria 2031
235 Ga0495669_0193810 3300046684 Unclassified 970
236 Ga0495674_0055294 3300047319 Bacteria 3482
237 Ga0496108_0070974 3300048911 Bacteria 2939
238 Ga0496113_0058060 3300048916 Bacteria 2911
239 Ga0501083_0010758 3300049744 Bacteria 6433
240 Ga0501083_0012673 3300049744 Bacteria 5899
241 Ga0501083_0166697 3300049744 Bacteria 1440
242 Ga0501083_0254775 3300049744 Bacteria 1142
243 Ga0501044_0008493 3300049823 Bacteria 11254
244 nmdc:mga0n895_71993_c1 3300050512 Bacteria 3428
245 Ga0501082_0372774 3300060353 Bacteria 1245
246 2788433486 2786546940 Bacteria 6396474
247 Ga0265319_1002659
248 rootH2_10009122
249 rootH2_10052670
250 Ga0065704_10079155
251 Ga0065707_10014467
252 Ga0070658_10006417
253 Ga0070658_10270343
254 Ga0070658_10930469
255 Ga0070683_100004288
256 Ga0070680_100188479
257 Ga0070660_100098979
258 Ga0070660_100201397
259 Ga0070661_100015891
260 Ga0070671_100287216
261 Ga0070709_10467758
262 Ga0070714_100066857
263 Ga0070713_100236063
264 Ga0070708_100122400
265 Ga0070708_100649613
266 Ga0070678_100564062
267 Ga0070681_10534951
268 Ga0070681_10786296
269 Ga0070706_100013539
270 Ga0070706_100131232
271 Ga0070706_100237633
272 Ga0070707_100017162
273 Ga0070707_100972315
274 Ga0070698_100007605
275 Ga0070698_100024310
276 Ga0070698_100310084
277 Ga0070699_100147581
278 Ga0070699_100256402
279 Ga0070679_100016261
280 Ga0070697_100227385
281 Ga0070697_100326240
282 Ga0070686_100036615
283 Ga0070686_100274329
284 Ga0070665_101309523
285 Ga0068855_100031084
286 Ga0068855_100121092
287 Ga0068855_100210546
288 Ga0068856_100423240
289 Ga0068852_100095163
290 Ga0068863_100036304
291 Ga0081455_10055878
292 Ga0070717_10015433
293 Ga0070717_10156069
294 Ga0075435_100166639
295 Ga0099794_10285166
296 Ga0105240_10266629
297 Ga0105240_10644682
298 Ga0105240_10907872
299 Ga0105245_11270717
300 Ga0105238_10034871
301 Ga0105249_11212445
302 Ga0105239_10025488
303 Ga0157369_10004551
304 Ga0157369_10106727
305 Ga0157369_10763241
306 Ga0157374_10085775
307 Ga0157374_10341510
308 Ga0157374_10382211
309 Ga0157374_10473016
310 Ga0157378_10013898
311 Ga0157378_10729350
312 Ga0157372_10035989
313 Ga0157379_10314688
314 Ga0157379_10930190
315 Ga0197907_10788504
316 Ga0206356_10199215
317 Ga0206352_10358875
318 Ga0206350_11032631
319 Ga0206350_11626476
320 Ga0224572_1018693
321 Ga0207699_10407877
322 Ga0207705_10003109
323 Ga0207684_10038928
324 Ga0207684_10047119
325 Ga0207684_10108352
326 Ga0207707_10401257
327 Ga0207693_10059101
328 Ga0207663_10332490
329 Ga0207657_10114834
330 Ga0207657_10125901
331 Ga0207652_10790319
332 Ga0207646_10008068
333 Ga0207646_10136354
334 Ga0207694_10309137
335 Ga0207700_10159254
336 Ga0207664_10026874
337 Ga0207690_10121762
338 Ga0207661_10007139
339 Ga0207661_10259971
340 Ga0207661_10264584
341 Ga0207679_10253354
342 Ga0207667_10112552
343 Ga0207667_10136620
344 Ga0207667_10212893
345 Ga0207703_10290079
346 Ga0207639_10062117
347 Ga0207702_10292240
348 Ga0207641_10040087
349 Ga0207683_10344137
350 Ga0207698_10060427
351 Ga0265337_1003473
352 Ga0265337_1013751
353 Ga0265319_1002845
354 Ga0265319_1004357
355 Ga0265319_1007186
356 Ga0265319_1023834
357 Ga0265334_10009405
358 Ga0265334_10011992
359 Ga0265318_10000038
360 Ga0265318_10000372
361 Ga0265318_10026125
362 Ga0265318_10030867
363 Ga0265318_10050208
364 Ga0265318_10057116
365 Ga0265318_10108027
366 Ga0265323_10000632
367 Ga0265323_10089577
368 Ga0265322_10003492
369 Ga0265336_10007644
370 Ga0265336_10013311
371 Ga0265338_10000210
372 Ga0265338_10000312
373 Ga0265338_10002280
374 Ga0265338_10003029
375 Ga0265338_10042368
376 Ga0265338_10107760
377 Ga0265338_10134014
378 Ga0265338_10163577
379 Ga0265338_10463173
380 Ga0265338_10468603
381 Ga0265324_10014081
382 Ga0265324_10034663
383 Ga0265324_10078197
384 Ga0265760_10061268
385 Ga0265330_10008019
386 Ga0265330_10009087
387 Ga0265330_10037719
388 Ga0265330_10103109
389 Ga0265332_10027144
390 Ga0265332_10068387
391 Ga0265332_10166884
392 Ga0265332_10216787
393 Ga0265328_10027722
394 Ga0265328_10060631
395 Ga0265328_10075658
396 Ga0265320_10000646
397 Ga0265320_10002344
398 Ga0265320_10004420
399 Ga0265320_10007187
400 Ga0265320_10027966
401 Ga0265320_10031969
402 Ga0265320_10056230
403 Ga0265320_10061526
404 Ga0265320_10121856
405 Ga0265320_10157626
406 Ga0265325_10000731
407 Ga0265325_10007901
408 Ga0265325_10009066
409 Ga0265325_10083781
410 Ga0265340_10035195
411 Ga0265340_10054166
412 Ga0265340_10096007
413 Ga0265339_10002003
414 Ga0265339_10018966
415 Ga0265331_10006720
416 Ga0265331_10038624
417 Ga0265327_10000029
418 Ga0265327_10001693
419 Ga0265327_10002003
420 Ga0265327_10005729
421 Ga0265327_10027709
422 Ga0265327_10064169
423 Ga0265316_10003282
424 Ga0265316_10008950
425 Ga0265316_10020067
426 Ga0265316_10120002
427 Ga0265316_10148624
428 Ga0265316_10193844
429 Ga0265316_10212038
430 Ga0265316_10260222
431 Ga0265316_10420155
432 Ga0265313_10003683
433 Ga0265313_10008107
434 Ga0265313_10030789
435 Ga0265313_10030894
436 Ga0265313_10047055
437 Ga0265314_10015607
438 Ga0265314_10016058
439 Ga0265314_10044635
440 Ga0265314_10080072
441 Ga0265314_10080164
442 Ga0265314_10342390
443 Ga0265342_10003789
444 Ga0265342_10033541
445 Ga0265342_10053888
446 Ga0265342_10076395
447 Ga0265342_10105809
448 Ga0373942_0034690
449 Ga0373935_0584481
450 Ga0373937_0342307
451 Ga0373925_0118258
452 Ga0395900_0162176
453 Ga0395905_0800947
454 Ga0439448_0004722
455 Ga0439451_005747
456 Ga0451577_0000087
457 Ga0451577_0133446
458 Ga0451577_0233026
459 Ga0451577_0397787
460 Ga0466969_0127046
461 Ga0453683_0003708
462 Ga0453683_0311341
463 Ga0466961_0198848
464 Ga0453684_0003020
465 Ga0453684_0092219
466 Ga0453684_0095434
467 Ga0453684_0240977
468 Ga0453684_0407317
469 Ga0466959_0082969
470 Ga0451576_0000098
471 Ga0451576_0000748
472 Ga0451576_0020753
473 Ga0451576_0079551
474 Ga0451576_0245162
475 Ga0451576_0267584
476 Ga0451576_0449356
477 Ga0495592_0000372
478 Ga0495582_0393716
479 Ga0495628_0001014
480 Ga0495645_0102792
481 Ga0495669_0193810
482 Ga0495674_0055294
483 Ga0496108_0070974
484 Ga0496113_0058060
485 Ga0501083_0010758
486 Ga0501083_0012673
487 Ga0501083_0166697
488 Ga0501083_0254775
489 Ga0501044_0008493
490 nmdc:mga0n895_71993_c1
491 Ga0501082_0372774
492 2788433486

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00329

Complex1_30kDa

Respiratory-chain NADH dehydrogenase, 30 Kd subunit

34

189

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e9i-assembly1.cif.gz_C mycobacterial respiratory complex i, semi-inserted quinone 0.8077 4 184
7zmg-assembly1.cif.gz_G cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 1) 0.7991 5 184
3mcr-assembly1.cif.gz_A crystal structure of nadh dehydrogenase subunit c (tfu_2693) from thermobifida fusca yx-er1 at 2.65 a resolution 0.782 5 166
7ard-assembly1.cif.gz_C cryo-em structure of polytomella complex-i (complete composition) 0.7783 7 184
6g72-assembly1.cif.gz_C mouse mitochondrial complex i in the deactive state 0.7764 5 184
ID Description Score Start End Superfamily
af_Q10884_4_103_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.8583 102 167 3.30.460.80
af_P0C340_11_131_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.8239 15 167 3.30.460.80
af_P0C340_11_131_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.8114 15 167 3.30.460.80
af_A0A1D8PJ73_47_194_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.8047 4 167 3.30.460.80
af_A0A2P2CLF6_6_131_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.8029 24 167 3.30.460.80
ID Description Score Start End GO Terms
AF-A0A2V6GDU4-F1-model_v4 NADH dehydrogenase family protein 0.94 1 116
AF-A0A2V6GDU4-F1-model_v4 NADH dehydrogenase family protein 0.9322 1 116
AF-A0A2V6M6D3-F1-model_v4 NADH-quinone oxidoreductase (EC 7.1.1.-) 0.9215 1 171 GO:0008137
GO:0048038
AF-A0A2V6M6D3-F1-model_v4 NADH-quinone oxidoreductase (EC 7.1.1.-) 0.9163 1 171 GO:0008137
GO:0048038
AF-A0A2V5SHH9-F1-model_v4 NADH-quinone oxidoreductase (EC 7.1.1.-) 0.8795 51 179 GO:0008137
GO:0048038

Map