F358226
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 246 | 180 | 244 | 95 |
Family's Representative Sequence
| Representative Sequence | 3300025915|Ga0207693_10381299|Ga0207693_103812992 |
| Length | 105 |
| Sequence | VPTRPFSNSSDGNSMSGRLVRIRGKVQGVWYRAWTVEEATRRGLRGWVRNRRDGSVEAFFAGEAAVIEEMIAACRIGPPLAKVASIASEATAEEPPEGFESRPTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 25 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 28 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 29 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 30 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 31 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 34 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 35 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 36 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 42 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 43 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 44 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 65 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 98 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 101 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 102 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 103 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 104 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 105 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 106 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 107 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 108 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 109 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 110 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 111 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 112 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 113 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 114 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 115 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 116 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 117 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 118 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 119 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 120 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 121 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 122 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 123 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 124 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 125 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 126 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 127 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 128 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 130 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 131 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 132 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 133 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 134 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 135 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 139 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 140 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 141 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 142 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 143 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 144 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 145 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 168 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 174 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 175 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 177 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 178 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 180 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.78 |
| Metatranscriptomes | 0.41 |
| Isolates | 0.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.22 |
| Nodule | 0.41 |
| Rhizoplane | 2.03 |
| Rhizosphere | 94.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10027719 | 3300001990 | Bacteria | 1784 |
| 2 | Ga0065712_10201436 | 3300005290 | Bacteria | 1101 |
| 3 | Ga0065707_10375809 | 3300005295 | Bacteria | 884 |
| 4 | Ga0070683_100036459 | 3300005329 | Bacteria | 4500 |
| 5 | Ga0070680_100272058 | 3300005336 | Bacteria | 1434 |
| 6 | Ga0070660_100002660 | 3300005339 | Bacteria | 12271 |
| 7 | Ga0070689_100710907 | 3300005340 | Bacteria | 878 |
| 8 | Ga0070661_101537859 | 3300005344 | Bacteria | 562 |
| 9 | Ga0070669_100054701 | 3300005353 | Bacteria | 2924 |
| 10 | Ga0070709_10552739 | 3300005434 | Bacteria | 881 |
| 11 | Ga0070713_100862914 | 3300005436 | Bacteria | 869 |
| 12 | Ga0070711_100470327 | 3300005439 | Bacteria | 1032 |
| 13 | Ga0070711_101068259 | 3300005439 | Bacteria | 695 |
| 14 | Ga0070663_101752178 | 3300005455 | Bacteria | 556 |
| 15 | Ga0070662_100019653 | 3300005457 | Bacteria | 4589 |
| 16 | Ga0070681_10420549 | 3300005458 | Bacteria | 1248 |
| 17 | Ga0070698_100151220 | 3300005471 | Bacteria | 2269 |
| 18 | Ga0070699_100898641 | 3300005518 | Bacteria | 811 |
| 19 | Ga0070679_100558030 | 3300005530 | Bacteria | 1089 |
| 20 | Ga0070684_100021536 | 3300005535 | Bacteria | 5367 |
| 21 | Ga0068853_100019844 | 3300005539 | Bacteria | 5583 |
| 22 | Ga0068853_100022569 | 3300005539 | Bacteria | 5257 |
| 23 | Ga0070696_101051910 | 3300005546 | Bacteria | 682 |
| 24 | Ga0068855_100039426 | 3300005563 | Bacteria | 5607 |
| 25 | Ga0068855_101530796 | 3300005563 | Bacteria | 684 |
| 26 | Ga0068857_100055202 | 3300005577 | Bacteria | 3526 |
| 27 | Ga0068857_100064365 | 3300005577 | Bacteria | 3260 |
| 28 | Ga0068857_100122660 | 3300005577 | Bacteria | 2341 |
| 29 | Ga0068857_101723557 | 3300005577 | Bacteria | 613 |
| 30 | Ga0068854_100181125 | 3300005578 | Bacteria | 1646 |
| 31 | Ga0068854_100551964 | 3300005578 | Bacteria | 977 |
| 32 | Ga0068852_100032906 | 3300005616 | Bacteria | 4299 |
| 33 | Ga0068852_100449037 | 3300005616 | Bacteria | 1276 |
| 34 | Ga0068852_101142972 | 3300005616 | Bacteria | 799 |
| 35 | Ga0068859_100702580 | 3300005617 | Bacteria | 1102 |
| 36 | Ga0068864_102038594 | 3300005618 | Bacteria | 580 |
| 37 | Ga0068866_10115360 | 3300005718 | Bacteria | 1505 |
| 38 | Ga0068861_100221444 | 3300005719 | Bacteria | 1600 |
| 39 | Ga0068861_100265482 | 3300005719 | Bacteria | 1471 |
| 40 | Ga0068863_100002338 | 3300005841 | Bacteria | 18842 |
| 41 | Ga0068863_101171923 | 3300005841 | Bacteria | 774 |
| 42 | Ga0068858_100370166 | 3300005842 | Bacteria | 1374 |
| 43 | Ga0068860_100000073 | 3300005843 | Bacteria | 173235 |
| 44 | Ga0068862_100011228 | 3300005844 | Bacteria | 7395 |
| 45 | Ga0068862_100580391 | 3300005844 | Bacteria | 1074 |
| 46 | Ga0068862_102781404 | 3300005844 | Bacteria | 501 |
| 47 | Ga0081538_10011664 | 3300005981 | Bacteria | 7105 |
| 48 | Ga0081540_1127532 | 3300005983 | Bacteria | 1045 |
| 49 | Ga0070717_11901232 | 3300006028 | Bacteria | 537 |
| 50 | Ga0070715_10219286 | 3300006163 | Bacteria | 977 |
| 51 | Ga0070715_10479547 | 3300006163 | Bacteria | 708 |
| 52 | Ga0070715_10502960 | 3300006163 | Bacteria | 694 |
| 53 | Ga0070716_101305527 | 3300006173 | Bacteria | 587 |
| 54 | Ga0070712_100205279 | 3300006175 | Bacteria | 1551 |
| 55 | Ga0070712_100528229 | 3300006175 | Bacteria | 992 |
| 56 | Ga0075428_101293551 | 3300006844 | Bacteria | 767 |
| 57 | Ga0075430_101574404 | 3300006846 | Unclassified | 540 |
| 58 | Ga0075431_100551437 | 3300006847 | Bacteria | 1140 |
| 59 | Ga0075431_101913959 | 3300006847 | Bacteria | 549 |
| 60 | Ga0075429_100281380 | 3300006880 | Bacteria | 1457 |
| 61 | Ga0068865_100093548 | 3300006881 | Bacteria | 2186 |
| 62 | Ga0075436_100701277 | 3300006914 | Bacteria | 750 |
| 63 | Ga0097620_100702630 | 3300006931 | Bacteria | 1102 |
| 64 | Ga0099794_10268527 | 3300007265 | Bacteria | 881 |
| 65 | Ga0105240_10009181 | 3300009093 | Bacteria | 14025 |
| 66 | Ga0111539_10204401 | 3300009094 | Bacteria | 2303 |
| 67 | Ga0105241_10650811 | 3300009174 | Bacteria | 957 |
| 68 | Ga0105242_10632900 | 3300009176 | Bacteria | 1038 |
| 69 | Ga0105237_10091195 | 3300009545 | Bacteria | 3037 |
| 70 | Ga0105238_10006415 | 3300009551 | Bacteria | 11705 |
| 71 | Ga0105238_10007346 | 3300009551 | Bacteria | 11032 |
| 72 | Ga0105238_10147017 | 3300009551 | Bacteria | 2333 |
| 73 | Ga0105249_10215546 | 3300009553 | Bacteria | 1886 |
| 74 | Ga0105249_12640028 | 3300009553 | Bacteria | 574 |
| 75 | Ga0099796_10014183 | 3300010159 | Bacteria | 2296 |
| 76 | Ga0099796_10086713 | 3300010159 | Bacteria | 1157 |
| 77 | Ga0105239_11931249 | 3300010375 | Bacteria | 685 |
| 78 | Ga0157370_10154279 | 3300013104 | Bacteria | 2137 |
| 79 | Ga0157369_10008434 | 3300013105 | Bacteria | 11819 |
| 80 | Ga0163162_10405874 | 3300013306 | Bacteria | 1495 |
| 81 | Ga0163163_10603351 | 3300014325 | Bacteria | 1161 |
| 82 | Ga0157380_10001316 | 3300014326 | Bacteria | 16117 |
| 83 | Ga0157380_10035745 | 3300014326 | Bacteria | 3839 |
| 84 | Ga0157379_10395923 | 3300014968 | Bacteria | 1269 |
| 85 | Ga0213872_10051524 | 3300021361 | Bacteria | 1868 |
| 86 | Ga0207642_10422462 | 3300025899 | Bacteria | 802 |
| 87 | Ga0207680_10214364 | 3300025903 | Bacteria | 1318 |
| 88 | Ga0207699_10778564 | 3300025906 | Bacteria | 703 |
| 89 | Ga0207705_10166784 | 3300025909 | Bacteria | 1656 |
| 90 | Ga0207684_10448569 | 3300025910 | Bacteria | 1108 |
| 91 | Ga0207707_10001819 | 3300025912 | Bacteria | 19559 |
| 92 | Ga0207695_10025578 | 3300025913 | Bacteria | 6604 |
| 93 | Ga0207693_10096983 | 3300025915 | Bacteria | 2312 |
| 94 | Ga0207693_10381299 | 3300025915 | Bacteria | 1103 |
| 95 | Ga0207663_10392598 | 3300025916 | Bacteria | 1059 |
| 96 | Ga0207663_10869210 | 3300025916 | Bacteria | 720 |
| 97 | Ga0207660_10022855 | 3300025917 | Bacteria | 4216 |
| 98 | Ga0207657_10003059 | 3300025919 | Bacteria | 17896 |
| 99 | Ga0207649_11029374 | 3300025920 | Bacteria | 648 |
| 100 | Ga0207652_10009912 | 3300025921 | Bacteria | 7667 |
| 101 | Ga0207652_11722017 | 3300025921 | Bacteria | 531 |
| 102 | Ga0207694_10011186 | 3300025924 | Bacteria | 6774 |
| 103 | Ga0207694_10060774 | 3300025924 | Bacteria | 2941 |
| 104 | Ga0207694_10080704 | 3300025924 | Bacteria | 2553 |
| 105 | Ga0207700_10624473 | 3300025928 | Bacteria | 960 |
| 106 | Ga0207700_10783505 | 3300025928 | Bacteria | 853 |
| 107 | Ga0207706_10007457 | 3300025933 | Bacteria | 10116 |
| 108 | Ga0207669_10990926 | 3300025937 | Bacteria | 706 |
| 109 | Ga0207704_10016043 | 3300025938 | Bacteria | 3838 |
| 110 | Ga0207665_10383968 | 3300025939 | Bacteria | 1066 |
| 111 | Ga0207661_10074251 | 3300025944 | Bacteria | 2787 |
| 112 | Ga0207667_10078314 | 3300025949 | Bacteria | 3426 |
| 113 | Ga0207640_10045383 | 3300025981 | Bacteria | 2822 |
| 114 | Ga0207658_10000025 | 3300025986 | Bacteria | 182470 |
| 115 | Ga0207703_10252268 | 3300026035 | Bacteria | 1591 |
| 116 | Ga0207639_10025691 | 3300026041 | Bacteria | 4273 |
| 117 | Ga0207639_10598998 | 3300026041 | Bacteria | 1016 |
| 118 | Ga0207678_10926727 | 3300026067 | Unclassified | 770 |
| 119 | Ga0207641_10004846 | 3300026088 | Bacteria | 11586 |
| 120 | Ga0207641_10472927 | 3300026088 | Bacteria | 1214 |
| 121 | Ga0207648_11356372 | 3300026089 | Bacteria | 668 |
| 122 | Ga0207676_12012365 | 3300026095 | Bacteria | 576 |
| 123 | Ga0207674_10023429 | 3300026116 | Bacteria | 6613 |
| 124 | Ga0207674_10068909 | 3300026116 | Bacteria | 3558 |
| 125 | Ga0207674_10078632 | 3300026116 | Bacteria | 3303 |
| 126 | Ga0207674_11590053 | 3300026116 | Bacteria | 622 |
| 127 | Ga0207675_100112888 | 3300026118 | Bacteria | 2566 |
| 128 | Ga0207675_100409429 | 3300026118 | Bacteria | 1338 |
| 129 | Ga0207698_10096387 | 3300026142 | Bacteria | 2438 |
| 130 | Ga0207698_10251388 | 3300026142 | Bacteria | 1618 |
| 131 | Ga0207698_10763248 | 3300026142 | Bacteria | 967 |
| 132 | Ga0207428_10188831 | 3300027907 | Bacteria | 1554 |
| 133 | Ga0268265_10181661 | 3300028380 | Bacteria | 1808 |
| 134 | Ga0268265_10230486 | 3300028380 | Bacteria | 1627 |
| 135 | Ga0268265_10861993 | 3300028380 | Bacteria | 887 |
| 136 | Ga0268264_10000120 | 3300028381 | Bacteria | 191138 |
| 137 | Ga0265338_10185289 | 3300028800 | Bacteria | 1583 |
| 138 | Ga0265338_10418377 | 3300028800 | Bacteria | 953 |
| 139 | Ga0311001_1017383 | 3300029277 | Bacteria | 582 |
| 140 | Ga0265332_10001295 | 3300031238 | Bacteria | 14298 |
| 141 | Ga0265328_10124755 | 3300031239 | Bacteria | 962 |
| 142 | Ga0265325_10096118 | 3300031241 | Bacteria | 1455 |
| 143 | Ga0265325_10137235 | 3300031241 | Unclassified | 1166 |
| 144 | Ga0265340_10007359 | 3300031247 | Bacteria | 5981 |
| 145 | Ga0265340_10062719 | 3300031247 | Bacteria | 1775 |
| 146 | Ga0265340_10293925 | 3300031247 | Bacteria | 721 |
| 147 | Ga0265339_10039155 | 3300031249 | Bacteria | 2641 |
| 148 | Ga0265331_10008032 | 3300031250 | Bacteria | 6034 |
| 149 | Ga0265331_10047645 | 3300031250 | Bacteria | 2062 |
| 150 | Ga0265327_10013369 | 3300031251 | Bacteria | 5453 |
| 151 | Ga0307408_100464110 | 3300031548 | Bacteria | 1101 |
| 152 | Ga0307408_100768450 | 3300031548 | Bacteria | 872 |
| 153 | Ga0265313_10009892 | 3300031595 | Bacteria | 6129 |
| 154 | Ga0265314_10140354 | 3300031711 | Bacteria | 1494 |
| 155 | Ga0265342_10000137 | 3300031712 | Bacteria | 81963 |
| 156 | Ga0307405_10128918 | 3300031731 | Bacteria | 1744 |
| 157 | Ga0307405_11999965 | 3300031731 | Unclassified | 519 |
| 158 | Ga0307413_10060621 | 3300031824 | Bacteria | 2330 |
| 159 | Ga0307410_10051742 | 3300031852 | Bacteria | 2770 |
| 160 | Ga0307412_10334643 | 3300031911 | Bacteria | 1209 |
| 161 | Ga0307412_10356582 | 3300031911 | Bacteria | 1176 |
| 162 | Ga0307412_10456082 | 3300031911 | Bacteria | 1054 |
| 163 | Ga0307409_100289069 | 3300031995 | Bacteria | 1519 |
| 164 | Ga0307409_100566229 | 3300031995 | Bacteria | 1118 |
| 165 | Ga0307409_101038603 | 3300031995 | Bacteria | 839 |
| 166 | Ga0307414_10496326 | 3300032004 | Bacteria | 1079 |
| 167 | Ga0307414_12236384 | 3300032004 | Unclassified | 511 |
| 168 | Ga0307411_10046567 | 3300032005 | Bacteria | 2797 |
| 169 | Ga0373948_0097763 | 3300034817 | Bacteria | 688 |
| 170 | Ga0373940_0002188 | 3300035088 | Bacteria | 3747 |
| 171 | Ga0373923_0518639 | 3300035111 | Bacteria | 582 |
| 172 | Ga0373962_0005434 | 3300035242 | Bacteria | 3084 |
| 173 | Ga0373962_0323638 | 3300035242 | Bacteria | 552 |
| 174 | Ga0373935_0646006 | 3300035692 | Bacteria | 776 |
| 175 | Ga0373927_0953330 | 3300035695 | Bacteria | 566 |
| 176 | Ga0373947_0696914 | 3300035725 | Bacteria | 693 |
| 177 | Ga0373937_0005885 | 3300036401 | Bacteria | 10549 |
| 178 | Ga0373937_0265229 | 3300036401 | Bacteria | 1620 |
| 179 | Ga0373925_0906223 | 3300037068 | Bacteria | 727 |
| 180 | Ga0436364_0046963 | 3300037853 | Bacteria | 1641 |
| 181 | Ga0436361_0518468 | 3300039447 | Bacteria | 5234 |
| 182 | Ga0439460_0329681 | 3300042461 | Bacteria | 536 |
| 183 | Ga0453683_0164382 | 3300044673 | Bacteria | 1405 |
| 184 | Ga0451576_0147541 | 3300045051 | Bacteria | 2453 |
| 185 | Ga0451576_1669798 | 3300045051 | Bacteria | 660 |
| 186 | Ga0466967_0998656 | 3300045976 | Bacteria | 833 |
| 187 | Ga0495651_0817744 | 3300046462 | Bacteria | 574 |
| 188 | Ga0495669_0150631 | 3300046684 | Bacteria | 1101 |
| 189 | Ga0496108_0050570 | 3300048911 | Bacteria | 3479 |
| 190 | Ga0496110_0261168 | 3300048913 | Bacteria | 1576 |
| 191 | Ga0496112_0192211 | 3300048915 | Bacteria | 2002 |
| 192 | Ga0496113_0652500 | 3300048916 | Bacteria | 841 |
| 193 | Ga0496115_0036085 | 3300048918 | Bacteria | 3913 |
| 194 | Ga0496125_0713781 | 3300048928 | Bacteria | 530 |
| 195 | Ga0496126_0078095 | 3300048929 | Bacteria | 2934 |
| 196 | Ga0501297_012519 | 3300049520 | Bacteria | 987 |
| 197 | Ga0501034_1190201 | 3300049571 | Bacteria | 641 |
| 198 | Ga0501036_0908359 | 3300049572 | Bacteria | 722 |
| 199 | Ga0501038_1030790 | 3300049574 | Bacteria | 603 |
| 200 | Ga0501040_0156030 | 3300049576 | Bacteria | 1612 |
| 201 | Ga0501042_0112130 | 3300049578 | Bacteria | 1964 |
| 202 | Ga0501043_0013862 | 3300049579 | Bacteria | 6308 |
| 203 | Ga0501046_0367621 | 3300049580 | Bacteria | 1042 |
| 204 | Ga0501047_0009110 | 3300049581 | Bacteria | 9374 |
| 205 | Ga0501047_0839234 | 3300049581 | Bacteria | 733 |
| 206 | Ga0501048_0194573 | 3300049582 | Bacteria | 1437 |
| 207 | Ga0501048_0610883 | 3300049582 | Bacteria | 783 |
| 208 | Ga0501067_0083770 | 3300049583 | Bacteria | 1769 |
| 209 | Ga0501068_0260905 | 3300049584 | Bacteria | 1105 |
| 210 | Ga0501072_0086004 | 3300049588 | Bacteria | 2495 |
| 211 | Ga0501072_1186588 | 3300049588 | Bacteria | 593 |
| 212 | Ga0501073_0653600 | 3300049589 | Bacteria | 726 |
| 213 | Ga0501075_0567302 | 3300049591 | Bacteria | 866 |
| 214 | Ga0501076_0136920 | 3300049592 | Bacteria | 1988 |
| 215 | Ga0501076_0475675 | 3300049592 | Bacteria | 1029 |
| 216 | Ga0501077_0069000 | 3300049593 | Bacteria | 2241 |
| 217 | Ga0501079_0908487 | 3300049741 | Bacteria | 693 |
| 218 | Ga0501080_1550871 | 3300049742 | Bacteria | 562 |
| 219 | Ga0501080_1861916 | 3300049742 | Bacteria | 504 |
| 220 | Ga0501081_0193325 | 3300049743 | Bacteria | 1474 |
| 221 | Ga0501081_0488853 | 3300049743 | Bacteria | 917 |
| 222 | Ga0501083_0376806 | 3300049744 | Bacteria | 923 |
| 223 | Ga0501083_0650476 | 3300049744 | Bacteria | 686 |
| 224 | Ga0501035_0277625 | 3300049822 | Bacteria | 1417 |
| 225 | Ga0501044_0465723 | 3300049823 | Bacteria | 1169 |
| 226 | Ga0501044_0627789 | 3300049823 | Bacteria | 965 |
| 227 | nmdc:mga0k408_524100_c1 | 3300050493 | Unclassified | 701 |
| 228 | nmdc:mga05p37_1751747_c1 | 3300050507 | Bacteria | 602 |
| 229 | nmdc:mga0qj67_1488293_c1 | 3300050509 | Unclassified | 521 |
| 230 | nmdc:mga06r32_816593_c1 | 3300050510 | Bacteria | 892 |
| 231 | nmdc:mga08y16_220256_c1 | 3300050511 | Bacteria | 1965 |
| 232 | nmdc:mga08x19_702416_c1 | 3300050514 | Bacteria | 718 |
| 233 | Ga0500627_0050994 | 3300053158 | Bacteria | 1804 |
| 234 | Ga0500611_220944 | 3300053727 | Bacteria | 541 |
| 235 | Ga0501084_0259396 | 3300054114 | Bacteria | 1467 |
| 236 | Ga0501084_0316190 | 3300054114 | Bacteria | 1319 |
| 237 | Ga0501084_0778041 | 3300054114 | Unclassified | 806 |
| 238 | Ga0501084_1485320 | 3300054114 | Bacteria | 567 |
| 239 | Ga0590075_036950 | 3300059424 | Bacteria | 1245 |
| 240 | Ga0590077_014897 | 3300059426 | Bacteria | 1622 |
| 241 | Ga0501082_0655462 | 3300060353 | Bacteria | 919 |
| 242 | Ga0530510_0021720 | 3300061734 | Bacteria | 4567 |
| 243 | Ga0530510_0536342 | 3300061734 | Bacteria | 888 |
| 244 | Ga0530510_1542936 | 3300061734 | Bacteria | 510 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035242 | Ga0373962_0323638 | Ga0373962_0323638_261_539 | 86 |
| 2 | 3300049588 | Ga0501072_1186588 | Ga0501072_1186588_70_342 | 89 |
| 3 | 3300035088 | Ga0373940_0002188 | Ga0373940_0002188_3206_3490 | 90 |
| 4 | 3300035242 | Ga0373962_0005434 | Ga0373962_0005434_2590_2874 | 90 |
| 5 | iso_pu_bacteria | 2842333319 | 2842335818 | 90 |
| 6 | iso_pu_bacteria | 8001845381 | 8001848959 | 90 |
| 7 | 3300005290 | Ga0065712_10201436 | Ga0065712_102014362 | 91 |
| 8 | 3300005344 | Ga0070661_101537859 | Ga0070661_1015378592 | 91 |
| 9 | 3300005434 | Ga0070709_10552739 | Ga0070709_105527391 | 91 |
| 10 | 3300005439 | Ga0070711_100470327 | Ga0070711_1004703271 | 91 |
| 11 | 3300005439 | Ga0070711_101068259 | Ga0070711_1010682592 | 91 |
| 12 | 3300005471 | Ga0070698_100151220 | Ga0070698_1001512203 | 91 |
| 13 | 3300005530 | Ga0070679_100558030 | Ga0070679_1005580301 | 91 |
| 14 | 3300005616 | Ga0068852_101142972 | Ga0068852_1011429722 | 91 |
| 15 | 3300005618 | Ga0068864_102038594 | Ga0068864_1020385942 | 91 |
| 16 | 3300005841 | Ga0068863_101171923 | Ga0068863_1011719231 | 91 |
| 17 | 3300005842 | Ga0068858_100370166 | Ga0068858_1003701662 | 91 |
| 18 | 3300006028 | Ga0070717_11901232 | Ga0070717_119012322 | 91 |
| 19 | 3300006163 | Ga0070715_10219286 | Ga0070715_102192862 | 91 |
| 20 | 3300006163 | Ga0070715_10502960 | Ga0070715_105029602 | 91 |
| 21 | 3300006175 | Ga0070712_100528229 | Ga0070712_1005282291 | 91 |
| 22 | 3300006914 | Ga0075436_100701277 | Ga0075436_1007012772 | 91 |
| 23 | 3300007265 | Ga0099794_10268527 | Ga0099794_102685272 | 91 |
| 24 | 3300009551 | Ga0105238_10007346 | Ga0105238_100073462 | 91 |
| 25 | 3300014325 | Ga0163163_10603351 | Ga0163163_106033512 | 91 |
| 26 | 3300014968 | Ga0157379_10395923 | Ga0157379_103959232 | 91 |
| 27 | 3300025906 | Ga0207699_10778564 | Ga0207699_107785642 | 91 |
| 28 | 3300025910 | Ga0207684_10448569 | Ga0207684_104485692 | 91 |
| 29 | 3300025915 | Ga0207693_10381299 | Ga0207693_103812992 | 91 |
| 30 | 3300025916 | Ga0207663_10869210 | Ga0207663_108692101 | 91 |
| 31 | 3300025920 | Ga0207649_11029374 | Ga0207649_110293742 | 91 |
| 32 | 3300025921 | Ga0207652_11722017 | Ga0207652_117220172 | 91 |
| 33 | 3300025924 | Ga0207694_10060774 | Ga0207694_100607744 | 91 |
| 34 | 3300025928 | Ga0207700_10624473 | Ga0207700_106244731 | 91 |
| 35 | 3300026035 | Ga0207703_10252268 | Ga0207703_102522681 | 91 |
| 36 | 3300026088 | Ga0207641_10472927 | Ga0207641_104729272 | 91 |
| 37 | 3300026095 | Ga0207676_12012365 | Ga0207676_120123651 | 91 |
| 38 | 3300028800 | Ga0265338_10185289 | Ga0265338_101852891 | 91 |
| 39 | 3300031239 | Ga0265328_10124755 | Ga0265328_101247552 | 91 |
| 40 | 3300031241 | Ga0265325_10096118 | Ga0265325_100961182 | 91 |
| 41 | 3300031247 | Ga0265340_10293925 | Ga0265340_102939252 | 91 |
| 42 | 3300031250 | Ga0265331_10008032 | Ga0265331_100080322 | 91 |
| 43 | 3300031595 | Ga0265313_10009892 | Ga0265313_100098922 | 91 |
| 44 | 3300035111 | Ga0373923_0518639 | Ga0373923_0518639_273_548 | 91 |
| 45 | 3300035692 | Ga0373935_0646006 | Ga0373935_0646006_379_654 | 91 |
| 46 | 3300035695 | Ga0373927_0953330 | Ga0373927_0953330_20_295 | 91 |
| 47 | 3300035725 | Ga0373947_0696914 | Ga0373947_0696914_68_343 | 91 |
| 48 | 3300036401 | Ga0373937_0005885 | Ga0373937_0005885_9460_9735 | 91 |
| 49 | 3300036401 | Ga0373937_0265229 | Ga0373937_0265229_1123_1398 | 91 |
| 50 | 3300037068 | Ga0373925_0906223 | Ga0373925_0906223_306_581 | 91 |
| 51 | 3300037853 | Ga0436364_0046963 | Ga0436364_0046963_1295_1573 | 91 |
| 52 | 3300046462 | Ga0495651_0817744 | Ga0495651_0817744_204_479 | 91 |
| 53 | 3300049593 | Ga0501077_0069000 | Ga0501077_0069000_1001_1279 | 91 |
| 54 | 3300049743 | Ga0501081_0488853 | Ga0501081_0488853_96_374 | 91 |
| 55 | 3300049744 | Ga0501083_0650476 | Ga0501083_0650476_336_614 | 91 |
| 56 | 3300050514 | nmdc:mga08x19_702416_c1 | nmdc:mga08x19_702416_c1_184_459 | 91 |
| 57 | 3300031247 | Ga0265340_10062719 | Ga0265340_100627192 | 92 |
| 58 | 3300054114 | Ga0501084_1485320 | Ga0501084_1485320_166_462 | 92 |
| 59 | 3300005329 | Ga0070683_100036459 | Ga0070683_1000364592 | 93 |
| 60 | 3300005336 | Ga0070680_100272058 | Ga0070680_1002720583 | 93 |
| 61 | 3300005339 | Ga0070660_100002660 | Ga0070660_1000026609 | 93 |
| 62 | 3300005436 | Ga0070713_100862914 | Ga0070713_1008629142 | 93 |
| 63 | 3300005458 | Ga0070681_10420549 | Ga0070681_104205492 | 93 |
| 64 | 3300005535 | Ga0070684_100021536 | Ga0070684_1000215362 | 93 |
| 65 | 3300005539 | Ga0068853_100022569 | Ga0068853_1000225693 | 93 |
| 66 | 3300005563 | Ga0068855_100039426 | Ga0068855_1000394267 | 93 |
| 67 | 3300005577 | Ga0068857_100055202 | Ga0068857_1000552022 | 93 |
| 68 | 3300005578 | Ga0068854_100551964 | Ga0068854_1005519642 | 93 |
| 69 | 3300005616 | Ga0068852_100032906 | Ga0068852_1000329065 | 93 |
| 70 | 3300006163 | Ga0070715_10479547 | Ga0070715_104795471 | 93 |
| 71 | 3300006173 | Ga0070716_101305527 | Ga0070716_1013055272 | 93 |
| 72 | 3300006175 | Ga0070712_100205279 | Ga0070712_1002052791 | 93 |
| 73 | 3300009093 | Ga0105240_10009181 | Ga0105240_100091817 | 93 |
| 74 | 3300009545 | Ga0105237_10091195 | Ga0105237_100911952 | 93 |
| 75 | 3300009551 | Ga0105238_10006415 | Ga0105238_100064157 | 93 |
| 76 | 3300010159 | Ga0099796_10014183 | Ga0099796_100141834 | 93 |
| 77 | 3300010159 | Ga0099796_10086713 | Ga0099796_100867132 | 93 |
| 78 | 3300010375 | Ga0105239_11931249 | Ga0105239_119312492 | 93 |
| 79 | 3300013104 | Ga0157370_10154279 | Ga0157370_101542792 | 93 |
| 80 | 3300013105 | Ga0157369_10008434 | Ga0157369_100084349 | 93 |
| 81 | 3300025909 | Ga0207705_10166784 | Ga0207705_101667842 | 93 |
| 82 | 3300025912 | Ga0207707_10001819 | Ga0207707_1000181916 | 93 |
| 83 | 3300025913 | Ga0207695_10025578 | Ga0207695_100255788 | 93 |
| 84 | 3300025915 | Ga0207693_10096983 | Ga0207693_100969833 | 93 |
| 85 | 3300025916 | Ga0207663_10392598 | Ga0207663_103925981 | 93 |
| 86 | 3300025917 | Ga0207660_10022855 | Ga0207660_100228552 | 93 |
| 87 | 3300025919 | Ga0207657_10003059 | Ga0207657_1000305915 | 93 |
| 88 | 3300025921 | Ga0207652_10009912 | Ga0207652_100099127 | 93 |
| 89 | 3300025924 | Ga0207694_10011186 | Ga0207694_100111865 | 93 |
| 90 | 3300025928 | Ga0207700_10783505 | Ga0207700_107835052 | 93 |
| 91 | 3300025939 | Ga0207665_10383968 | Ga0207665_103839681 | 93 |
| 92 | 3300025944 | Ga0207661_10074251 | Ga0207661_100742512 | 93 |
| 93 | 3300025949 | Ga0207667_10078314 | Ga0207667_100783142 | 93 |
| 94 | 3300026041 | Ga0207639_10598998 | Ga0207639_105989982 | 93 |
| 95 | 3300026116 | Ga0207674_10023429 | Ga0207674_100234294 | 93 |
| 96 | 3300026142 | Ga0207698_10096387 | Ga0207698_100963872 | 93 |
| 97 | 3300031238 | Ga0265332_10001295 | Ga0265332_100012953 | 93 |
| 98 | 3300031241 | Ga0265325_10137235 | Ga0265325_101372351 | 93 |
| 99 | 3300031247 | Ga0265340_10007359 | Ga0265340_100073595 | 93 |
| 100 | 3300031249 | Ga0265339_10039155 | Ga0265339_100391553 | 93 |
| 101 | 3300031250 | Ga0265331_10047645 | Ga0265331_100476453 | 93 |
| 102 | 3300031711 | Ga0265314_10140354 | Ga0265314_101403543 | 93 |
| 103 | 3300031712 | Ga0265342_10000137 | Ga0265342_100001373 | 93 |
| 104 | 3300045976 | Ga0466967_0998656 | Ga0466967_0998656_99_380 | 93 |
| 105 | 3300048911 | Ga0496108_0050570 | Ga0496108_0050570_2283_2582 | 93 |
| 106 | 3300048913 | Ga0496110_0261168 | Ga0496110_0261168_231_530 | 93 |
| 107 | 3300048915 | Ga0496112_0192211 | Ga0496112_0192211_894_1193 | 93 |
| 108 | 3300048916 | Ga0496113_0652500 | Ga0496113_0652500_273_572 | 93 |
| 109 | 3300048918 | Ga0496115_0036085 | Ga0496115_0036085_1369_1668 | 93 |
| 110 | 3300049520 | Ga0501297_012519 | Ga0501297_012519_180_461 | 93 |
| 111 | 3300049742 | Ga0501080_1550871 | Ga0501080_1550871_47_328 | 93 |
| 112 | 3300053158 | Ga0500627_0050994 | Ga0500627_0050994_1227_1526 | 93 |
| 113 | 3300005295 | Ga0065707_10375809 | Ga0065707_103758092 | 94 |
| 114 | 3300005353 | Ga0070669_100054701 | Ga0070669_1000547013 | 94 |
| 115 | 3300005718 | Ga0068866_10115360 | Ga0068866_101153602 | 94 |
| 116 | 3300005719 | Ga0068861_100221444 | Ga0068861_1002214443 | 94 |
| 117 | 3300005719 | Ga0068861_100265482 | Ga0068861_1002654822 | 94 |
| 118 | 3300005844 | Ga0068862_100011228 | Ga0068862_1000112285 | 94 |
| 119 | 3300005844 | Ga0068862_100580391 | Ga0068862_1005803912 | 94 |
| 120 | 3300005844 | Ga0068862_102781404 | Ga0068862_1027814042 | 94 |
| 121 | 3300005981 | Ga0081538_10011664 | Ga0081538_100116643 | 94 |
| 122 | 3300005983 | Ga0081540_1127532 | Ga0081540_11275322 | 94 |
| 123 | 3300006844 | Ga0075428_101293551 | Ga0075428_1012935512 | 94 |
| 124 | 3300006846 | Ga0075430_101574404 | Ga0075430_1015744042 | 94 |
| 125 | 3300006847 | Ga0075431_100551437 | Ga0075431_1005514372 | 94 |
| 126 | 3300006847 | Ga0075431_101913959 | Ga0075431_1019139592 | 94 |
| 127 | 3300006880 | Ga0075429_100281380 | Ga0075429_1002813801 | 94 |
| 128 | 3300006881 | Ga0068865_100093548 | Ga0068865_1000935482 | 94 |
| 129 | 3300009094 | Ga0111539_10204401 | Ga0111539_102044013 | 94 |
| 130 | 3300009176 | Ga0105242_10632900 | Ga0105242_106329002 | 94 |
| 131 | 3300009553 | Ga0105249_10215546 | Ga0105249_102155463 | 94 |
| 132 | 3300013306 | Ga0163162_10405874 | Ga0163162_104058742 | 94 |
| 133 | 3300014326 | Ga0157380_10035745 | Ga0157380_100357452 | 94 |
| 134 | 3300021361 | Ga0213872_10051524 | Ga0213872_100515242 | 94 |
| 135 | 3300025899 | Ga0207642_10422462 | Ga0207642_104224622 | 94 |
| 136 | 3300025937 | Ga0207669_10990926 | Ga0207669_109909262 | 94 |
| 137 | 3300025938 | Ga0207704_10016043 | Ga0207704_100160434 | 94 |
| 138 | 3300026089 | Ga0207648_11356372 | Ga0207648_113563722 | 94 |
| 139 | 3300026118 | Ga0207675_100112888 | Ga0207675_1001128882 | 94 |
| 140 | 3300026118 | Ga0207675_100409429 | Ga0207675_1004094292 | 94 |
| 141 | 3300027907 | Ga0207428_10188831 | Ga0207428_101888312 | 94 |
| 142 | 3300028380 | Ga0268265_10181661 | Ga0268265_101816612 | 94 |
| 143 | 3300028380 | Ga0268265_10230486 | Ga0268265_102304862 | 94 |
| 144 | 3300029277 | Ga0311001_1017383 | Ga0311001_10173832 | 94 |
| 145 | 3300031731 | Ga0307405_11999965 | Ga0307405_119999652 | 94 |
| 146 | 3300031824 | Ga0307413_10060621 | Ga0307413_100606212 | 94 |
| 147 | 3300031852 | Ga0307410_10051742 | Ga0307410_100517423 | 94 |
| 148 | 3300031911 | Ga0307412_10356582 | Ga0307412_103565822 | 94 |
| 149 | 3300031995 | Ga0307409_100289069 | Ga0307409_1002890693 | 94 |
| 150 | 3300032004 | Ga0307414_10496326 | Ga0307414_104963262 | 94 |
| 151 | 3300032004 | Ga0307414_12236384 | Ga0307414_122363841 | 94 |
| 152 | 3300032005 | Ga0307411_10046567 | Ga0307411_100465673 | 94 |
| 153 | 3300039447 | Ga0436361_0518468 | Ga0436361_0518468_1230_1514 | 94 |
| 154 | 3300042461 | Ga0439460_0329681 | Ga0439460_0329681_56_340 | 94 |
| 155 | 3300045051 | Ga0451576_0147541 | Ga0451576_0147541_1812_2096 | 94 |
| 156 | 3300050493 | nmdc:mga0k408_524100_c1 | nmdc:mga0k408_524100_c1_23_307 | 94 |
| 157 | 3300050509 | nmdc:mga0qj67_1488293_c1 | nmdc:mga0qj67_1488293_c1_40_324 | 94 |
| 158 | 3300050510 | nmdc:mga06r32_816593_c1 | nmdc:mga06r32_816593_c1_272_556 | 94 |
| 159 | 3300050511 | nmdc:mga08y16_220256_c1 | nmdc:mga08y16_220256_c1_566_850 | 94 |
| 160 | 3300059424 | Ga0590075_036950 | Ga0590075_036950_319_603 | 94 |
| 161 | 3300059426 | Ga0590077_014897 | Ga0590077_014897_120_404 | 94 |
| 162 | 3300061734 | Ga0530510_1542936 | Ga0530510_1542936_23_307 | 94 |
| 163 | 3300001990 | JGI24737J22298_10027719 | JGI24737J22298_100277193 | 95 |
| 164 | 3300005340 | Ga0070689_100710907 | Ga0070689_1007109072 | 95 |
| 165 | 3300005455 | Ga0070663_101752178 | Ga0070663_1017521781 | 95 |
| 166 | 3300005457 | Ga0070662_100019653 | Ga0070662_1000196534 | 95 |
| 167 | 3300005518 | Ga0070699_100898641 | Ga0070699_1008986412 | 95 |
| 168 | 3300005539 | Ga0068853_100019844 | Ga0068853_1000198445 | 95 |
| 169 | 3300005546 | Ga0070696_101051910 | Ga0070696_1010519102 | 95 |
| 170 | 3300005563 | Ga0068855_101530796 | Ga0068855_1015307961 | 95 |
| 171 | 3300005577 | Ga0068857_100064365 | Ga0068857_1000643652 | 95 |
| 172 | 3300005577 | Ga0068857_100122660 | Ga0068857_1001226604 | 95 |
| 173 | 3300005577 | Ga0068857_101723557 | Ga0068857_1017235571 | 95 |
| 174 | 3300005578 | Ga0068854_100181125 | Ga0068854_1001811252 | 95 |
| 175 | 3300005616 | Ga0068852_100449037 | Ga0068852_1004490372 | 95 |
| 176 | 3300005617 | Ga0068859_100702580 | Ga0068859_1007025801 | 95 |
| 177 | 3300005841 | Ga0068863_100002338 | Ga0068863_10000233819 | 95 |
| 178 | 3300005843 | Ga0068860_100000073 | Ga0068860_10000007343 | 95 |
| 179 | 3300006931 | Ga0097620_100702630 | Ga0097620_1007026301 | 95 |
| 180 | 3300009174 | Ga0105241_10650811 | Ga0105241_106508112 | 95 |
| 181 | 3300009551 | Ga0105238_10147017 | Ga0105238_101470174 | 95 |
| 182 | 3300009553 | Ga0105249_12640028 | Ga0105249_126400282 | 95 |
| 183 | 3300014326 | Ga0157380_10001316 | Ga0157380_1000131610 | 95 |
| 184 | 3300025903 | Ga0207680_10214364 | Ga0207680_102143642 | 95 |
| 185 | 3300025924 | Ga0207694_10080704 | Ga0207694_100807043 | 95 |
| 186 | 3300025933 | Ga0207706_10007457 | Ga0207706_100074578 | 95 |
| 187 | 3300025981 | Ga0207640_10045383 | Ga0207640_100453833 | 95 |
| 188 | 3300025986 | Ga0207658_10000025 | Ga0207658_10000025116 | 95 |
| 189 | 3300026041 | Ga0207639_10025691 | Ga0207639_100256912 | 95 |
| 190 | 3300026067 | Ga0207678_10926727 | Ga0207678_109267272 | 95 |
| 191 | 3300026088 | Ga0207641_10004846 | Ga0207641_100048463 | 95 |
| 192 | 3300026116 | Ga0207674_10068909 | Ga0207674_100689095 | 95 |
| 193 | 3300026116 | Ga0207674_10078632 | Ga0207674_100786325 | 95 |
| 194 | 3300026116 | Ga0207674_11590053 | Ga0207674_115900532 | 95 |
| 195 | 3300026142 | Ga0207698_10251388 | Ga0207698_102513882 | 95 |
| 196 | 3300026142 | Ga0207698_10763248 | Ga0207698_107632482 | 95 |
| 197 | 3300028380 | Ga0268265_10861993 | Ga0268265_108619932 | 95 |
| 198 | 3300028381 | Ga0268264_10000120 | Ga0268264_1000012059 | 95 |
| 199 | 3300028800 | Ga0265338_10418377 | Ga0265338_104183772 | 95 |
| 200 | 3300031251 | Ga0265327_10013369 | Ga0265327_100133695 | 95 |
| 201 | 3300031548 | Ga0307408_100464110 | Ga0307408_1004641102 | 95 |
| 202 | 3300031548 | Ga0307408_100768450 | Ga0307408_1007684502 | 95 |
| 203 | 3300031731 | Ga0307405_10128918 | Ga0307405_101289182 | 95 |
| 204 | 3300031911 | Ga0307412_10334643 | Ga0307412_103346432 | 95 |
| 205 | 3300031911 | Ga0307412_10456082 | Ga0307412_104560822 | 95 |
| 206 | 3300031995 | Ga0307409_100566229 | Ga0307409_1005662293 | 95 |
| 207 | 3300031995 | Ga0307409_101038603 | Ga0307409_1010386032 | 95 |
| 208 | 3300034817 | Ga0373948_0097763 | Ga0373948_0097763_380_673 | 95 |
| 209 | 3300044673 | Ga0453683_0164382 | Ga0453683_0164382_526_819 | 95 |
| 210 | 3300045051 | Ga0451576_1669798 | Ga0451576_1669798_119_412 | 95 |
| 211 | 3300046684 | Ga0495669_0150631 | Ga0495669_0150631_286_579 | 95 |
| 212 | 3300048928 | Ga0496125_0713781 | Ga0496125_0713781_191_499 | 95 |
| 213 | 3300048929 | Ga0496126_0078095 | Ga0496126_0078095_2395_2712 | 95 |
| 214 | 3300049571 | Ga0501034_1190201 | Ga0501034_1190201_232_531 | 95 |
| 215 | 3300049572 | Ga0501036_0908359 | Ga0501036_0908359_259_558 | 95 |
| 216 | 3300049574 | Ga0501038_1030790 | Ga0501038_1030790_118_405 | 95 |
| 217 | 3300049576 | Ga0501040_0156030 | Ga0501040_0156030_125_412 | 95 |
| 218 | 3300049578 | Ga0501042_0112130 | Ga0501042_0112130_803_1090 | 95 |
| 219 | 3300049579 | Ga0501043_0013862 | Ga0501043_0013862_1409_1708 | 95 |
| 220 | 3300049580 | Ga0501046_0367621 | Ga0501046_0367621_340_639 | 95 |
| 221 | 3300049581 | Ga0501047_0009110 | Ga0501047_0009110_1644_1943 | 95 |
| 222 | 3300049581 | Ga0501047_0839234 | Ga0501047_0839234_152_439 | 95 |
| 223 | 3300049582 | Ga0501048_0194573 | Ga0501048_0194573_718_1017 | 95 |
| 224 | 3300049582 | Ga0501048_0610883 | Ga0501048_0610883_413_700 | 95 |
| 225 | 3300049583 | Ga0501067_0083770 | Ga0501067_0083770_1247_1636 | 95 |
| 226 | 3300049584 | Ga0501068_0260905 | Ga0501068_0260905_60_347 | 95 |
| 227 | 3300049588 | Ga0501072_0086004 | Ga0501072_0086004_222_509 | 95 |
| 228 | 3300049589 | Ga0501073_0653600 | Ga0501073_0653600_113_424 | 95 |
| 229 | 3300049591 | Ga0501075_0567302 | Ga0501075_0567302_66_353 | 95 |
| 230 | 3300049592 | Ga0501076_0136920 | Ga0501076_0136920_118_405 | 95 |
| 231 | 3300049592 | Ga0501076_0475675 | Ga0501076_0475675_603_890 | 95 |
| 232 | 3300049741 | Ga0501079_0908487 | Ga0501079_0908487_390_677 | 95 |
| 233 | 3300049742 | Ga0501080_1861916 | Ga0501080_1861916_108_395 | 95 |
| 234 | 3300049743 | Ga0501081_0193325 | Ga0501081_0193325_1038_1325 | 95 |
| 235 | 3300049744 | Ga0501083_0376806 | Ga0501083_0376806_229_516 | 95 |
| 236 | 3300049822 | Ga0501035_0277625 | Ga0501035_0277625_804_1091 | 95 |
| 237 | 3300049823 | Ga0501044_0465723 | Ga0501044_0465723_337_624 | 95 |
| 238 | 3300049823 | Ga0501044_0627789 | Ga0501044_0627789_225_524 | 95 |
| 239 | 3300050507 | nmdc:mga05p37_1751747_c1 | nmdc:mga05p37_1751747_c1_11_298 | 95 |
| 240 | 3300053727 | Ga0500611_220944 | Ga0500611_220944_90_386 | 95 |
| 241 | 3300054114 | Ga0501084_0259396 | Ga0501084_0259396_152_439 | 95 |
| 242 | 3300054114 | Ga0501084_0316190 | Ga0501084_0316190_452_739 | 95 |
| 243 | 3300054114 | Ga0501084_0778041 | Ga0501084_0778041_385_690 | 95 |
| 244 | 3300060353 | Ga0501082_0655462 | Ga0501082_0655462_550_873 | 95 |
| 245 | 3300061734 | Ga0530510_0021720 | Ga0530510_0021720_1634_1921 | 95 |
| 246 | 3300061734 | Ga0530510_0536342 | Ga0530510_0536342_26_313 | 95 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2w4d-assembly1.cif.gz_B | acylphosphatase variant g91a from pyrococcus horikoshii | 0.9792 | 5 | 92 |
| 3tnv-assembly1.cif.gz_A | acylphosphatase with thermophilic surface and mesophilic core | 0.979 | 5 | 92 |
| 1v3z-assembly1.cif.gz_B | crystal structure of acylphosphatase from pyrococcus horikoshii | 0.9752 | 5 | 92 |
| 3trg-assembly1.cif.gz_A | structure of an acylphosphatase from coxiella burnetii | 0.9737 | 3 | 92 |
| 8jfs-assembly2.cif.gz_B | phosphate bound acylphosphatase from deinococcus radiodurans at 1 angstrom resolution | 0.9699 | 6 | 92 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7LZQ3_146_256_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9944 | 5 | 92 | 3.30.70.100 |
| af_A0A1D6NY72_1_96_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9814 | 5 | 92 | 3.30.70.100 |
| 3tnvA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.979 | 5 | 92 | 3.30.70.100 |
| af_C0PM37_2_111_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9764 | 5 | 92 | 3.30.70.100 |
| 3trgA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9732 | 3 | 92 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A095SNZ1-F1-model_v4 | acylphosphatase (EC 3.6.1.7) | 1.004 | 6 | 92 |
GO:0003998
|
| AF-A0A512H537-F1-model_v4 | acylphosphatase (EC 3.6.1.7) | 1.003 | 6 | 95 |
GO:0003998
|
| AF-A0A6N7LTB6-F1-model_v4 | acylphosphatase (EC 3.6.1.7) | 1.002 | 6 | 92 |
GO:0003998
|
| AF-H6SSM0-F1-model_v4 | acylphosphatase (EC 3.6.1.7) | 1.001 | 5 | 95 |
GO:0003998
|
| AF-A0A7Y0E581-F1-model_v4 | Acylphosphatase (EC 3.6.1.7) | 1.001 | 6 | 95 |
GO:0003998
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar