F358226

General Info

Members Datasets Scaffolds Average Seq Length
246 180 244 95

Family's Representative Sequence

Representative Sequence 3300025915|Ga0207693_10381299|Ga0207693_103812992
Length 105
Sequence VPTRPFSNSSDGNSMSGRLVRIRGKVQGVWYRAWTVEEATRRGLRGWVRNRRDGSVEAFFAGEAAVIEEMIAACRIGPPLAKVASIASEATAEEPPEGFESRPTA

Samples

Sample ID Description Type Environment
1 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
102 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
103 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
104 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
105 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
108 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
121 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
122 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
132 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
174 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
177 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
179 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
180 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 0.41
Isolates 0.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.22
Nodule 0.41
Rhizoplane 2.03
Rhizosphere 94.72
Stem 0
Stem Tuber 0
Unclassified 1.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10027719 3300001990 Bacteria 1784
2 Ga0065712_10201436 3300005290 Bacteria 1101
3 Ga0065707_10375809 3300005295 Bacteria 884
4 Ga0070683_100036459 3300005329 Bacteria 4500
5 Ga0070680_100272058 3300005336 Bacteria 1434
6 Ga0070660_100002660 3300005339 Bacteria 12271
7 Ga0070689_100710907 3300005340 Bacteria 878
8 Ga0070661_101537859 3300005344 Bacteria 562
9 Ga0070669_100054701 3300005353 Bacteria 2924
10 Ga0070709_10552739 3300005434 Bacteria 881
11 Ga0070713_100862914 3300005436 Bacteria 869
12 Ga0070711_100470327 3300005439 Bacteria 1032
13 Ga0070711_101068259 3300005439 Bacteria 695
14 Ga0070663_101752178 3300005455 Bacteria 556
15 Ga0070662_100019653 3300005457 Bacteria 4589
16 Ga0070681_10420549 3300005458 Bacteria 1248
17 Ga0070698_100151220 3300005471 Bacteria 2269
18 Ga0070699_100898641 3300005518 Bacteria 811
19 Ga0070679_100558030 3300005530 Bacteria 1089
20 Ga0070684_100021536 3300005535 Bacteria 5367
21 Ga0068853_100019844 3300005539 Bacteria 5583
22 Ga0068853_100022569 3300005539 Bacteria 5257
23 Ga0070696_101051910 3300005546 Bacteria 682
24 Ga0068855_100039426 3300005563 Bacteria 5607
25 Ga0068855_101530796 3300005563 Bacteria 684
26 Ga0068857_100055202 3300005577 Bacteria 3526
27 Ga0068857_100064365 3300005577 Bacteria 3260
28 Ga0068857_100122660 3300005577 Bacteria 2341
29 Ga0068857_101723557 3300005577 Bacteria 613
30 Ga0068854_100181125 3300005578 Bacteria 1646
31 Ga0068854_100551964 3300005578 Bacteria 977
32 Ga0068852_100032906 3300005616 Bacteria 4299
33 Ga0068852_100449037 3300005616 Bacteria 1276
34 Ga0068852_101142972 3300005616 Bacteria 799
35 Ga0068859_100702580 3300005617 Bacteria 1102
36 Ga0068864_102038594 3300005618 Bacteria 580
37 Ga0068866_10115360 3300005718 Bacteria 1505
38 Ga0068861_100221444 3300005719 Bacteria 1600
39 Ga0068861_100265482 3300005719 Bacteria 1471
40 Ga0068863_100002338 3300005841 Bacteria 18842
41 Ga0068863_101171923 3300005841 Bacteria 774
42 Ga0068858_100370166 3300005842 Bacteria 1374
43 Ga0068860_100000073 3300005843 Bacteria 173235
44 Ga0068862_100011228 3300005844 Bacteria 7395
45 Ga0068862_100580391 3300005844 Bacteria 1074
46 Ga0068862_102781404 3300005844 Bacteria 501
47 Ga0081538_10011664 3300005981 Bacteria 7105
48 Ga0081540_1127532 3300005983 Bacteria 1045
49 Ga0070717_11901232 3300006028 Bacteria 537
50 Ga0070715_10219286 3300006163 Bacteria 977
51 Ga0070715_10479547 3300006163 Bacteria 708
52 Ga0070715_10502960 3300006163 Bacteria 694
53 Ga0070716_101305527 3300006173 Bacteria 587
54 Ga0070712_100205279 3300006175 Bacteria 1551
55 Ga0070712_100528229 3300006175 Bacteria 992
56 Ga0075428_101293551 3300006844 Bacteria 767
57 Ga0075430_101574404 3300006846 Unclassified 540
58 Ga0075431_100551437 3300006847 Bacteria 1140
59 Ga0075431_101913959 3300006847 Bacteria 549
60 Ga0075429_100281380 3300006880 Bacteria 1457
61 Ga0068865_100093548 3300006881 Bacteria 2186
62 Ga0075436_100701277 3300006914 Bacteria 750
63 Ga0097620_100702630 3300006931 Bacteria 1102
64 Ga0099794_10268527 3300007265 Bacteria 881
65 Ga0105240_10009181 3300009093 Bacteria 14025
66 Ga0111539_10204401 3300009094 Bacteria 2303
67 Ga0105241_10650811 3300009174 Bacteria 957
68 Ga0105242_10632900 3300009176 Bacteria 1038
69 Ga0105237_10091195 3300009545 Bacteria 3037
70 Ga0105238_10006415 3300009551 Bacteria 11705
71 Ga0105238_10007346 3300009551 Bacteria 11032
72 Ga0105238_10147017 3300009551 Bacteria 2333
73 Ga0105249_10215546 3300009553 Bacteria 1886
74 Ga0105249_12640028 3300009553 Bacteria 574
75 Ga0099796_10014183 3300010159 Bacteria 2296
76 Ga0099796_10086713 3300010159 Bacteria 1157
77 Ga0105239_11931249 3300010375 Bacteria 685
78 Ga0157370_10154279 3300013104 Bacteria 2137
79 Ga0157369_10008434 3300013105 Bacteria 11819
80 Ga0163162_10405874 3300013306 Bacteria 1495
81 Ga0163163_10603351 3300014325 Bacteria 1161
82 Ga0157380_10001316 3300014326 Bacteria 16117
83 Ga0157380_10035745 3300014326 Bacteria 3839
84 Ga0157379_10395923 3300014968 Bacteria 1269
85 Ga0213872_10051524 3300021361 Bacteria 1868
86 Ga0207642_10422462 3300025899 Bacteria 802
87 Ga0207680_10214364 3300025903 Bacteria 1318
88 Ga0207699_10778564 3300025906 Bacteria 703
89 Ga0207705_10166784 3300025909 Bacteria 1656
90 Ga0207684_10448569 3300025910 Bacteria 1108
91 Ga0207707_10001819 3300025912 Bacteria 19559
92 Ga0207695_10025578 3300025913 Bacteria 6604
93 Ga0207693_10096983 3300025915 Bacteria 2312
94 Ga0207693_10381299 3300025915 Bacteria 1103
95 Ga0207663_10392598 3300025916 Bacteria 1059
96 Ga0207663_10869210 3300025916 Bacteria 720
97 Ga0207660_10022855 3300025917 Bacteria 4216
98 Ga0207657_10003059 3300025919 Bacteria 17896
99 Ga0207649_11029374 3300025920 Bacteria 648
100 Ga0207652_10009912 3300025921 Bacteria 7667
101 Ga0207652_11722017 3300025921 Bacteria 531
102 Ga0207694_10011186 3300025924 Bacteria 6774
103 Ga0207694_10060774 3300025924 Bacteria 2941
104 Ga0207694_10080704 3300025924 Bacteria 2553
105 Ga0207700_10624473 3300025928 Bacteria 960
106 Ga0207700_10783505 3300025928 Bacteria 853
107 Ga0207706_10007457 3300025933 Bacteria 10116
108 Ga0207669_10990926 3300025937 Bacteria 706
109 Ga0207704_10016043 3300025938 Bacteria 3838
110 Ga0207665_10383968 3300025939 Bacteria 1066
111 Ga0207661_10074251 3300025944 Bacteria 2787
112 Ga0207667_10078314 3300025949 Bacteria 3426
113 Ga0207640_10045383 3300025981 Bacteria 2822
114 Ga0207658_10000025 3300025986 Bacteria 182470
115 Ga0207703_10252268 3300026035 Bacteria 1591
116 Ga0207639_10025691 3300026041 Bacteria 4273
117 Ga0207639_10598998 3300026041 Bacteria 1016
118 Ga0207678_10926727 3300026067 Unclassified 770
119 Ga0207641_10004846 3300026088 Bacteria 11586
120 Ga0207641_10472927 3300026088 Bacteria 1214
121 Ga0207648_11356372 3300026089 Bacteria 668
122 Ga0207676_12012365 3300026095 Bacteria 576
123 Ga0207674_10023429 3300026116 Bacteria 6613
124 Ga0207674_10068909 3300026116 Bacteria 3558
125 Ga0207674_10078632 3300026116 Bacteria 3303
126 Ga0207674_11590053 3300026116 Bacteria 622
127 Ga0207675_100112888 3300026118 Bacteria 2566
128 Ga0207675_100409429 3300026118 Bacteria 1338
129 Ga0207698_10096387 3300026142 Bacteria 2438
130 Ga0207698_10251388 3300026142 Bacteria 1618
131 Ga0207698_10763248 3300026142 Bacteria 967
132 Ga0207428_10188831 3300027907 Bacteria 1554
133 Ga0268265_10181661 3300028380 Bacteria 1808
134 Ga0268265_10230486 3300028380 Bacteria 1627
135 Ga0268265_10861993 3300028380 Bacteria 887
136 Ga0268264_10000120 3300028381 Bacteria 191138
137 Ga0265338_10185289 3300028800 Bacteria 1583
138 Ga0265338_10418377 3300028800 Bacteria 953
139 Ga0311001_1017383 3300029277 Bacteria 582
140 Ga0265332_10001295 3300031238 Bacteria 14298
141 Ga0265328_10124755 3300031239 Bacteria 962
142 Ga0265325_10096118 3300031241 Bacteria 1455
143 Ga0265325_10137235 3300031241 Unclassified 1166
144 Ga0265340_10007359 3300031247 Bacteria 5981
145 Ga0265340_10062719 3300031247 Bacteria 1775
146 Ga0265340_10293925 3300031247 Bacteria 721
147 Ga0265339_10039155 3300031249 Bacteria 2641
148 Ga0265331_10008032 3300031250 Bacteria 6034
149 Ga0265331_10047645 3300031250 Bacteria 2062
150 Ga0265327_10013369 3300031251 Bacteria 5453
151 Ga0307408_100464110 3300031548 Bacteria 1101
152 Ga0307408_100768450 3300031548 Bacteria 872
153 Ga0265313_10009892 3300031595 Bacteria 6129
154 Ga0265314_10140354 3300031711 Bacteria 1494
155 Ga0265342_10000137 3300031712 Bacteria 81963
156 Ga0307405_10128918 3300031731 Bacteria 1744
157 Ga0307405_11999965 3300031731 Unclassified 519
158 Ga0307413_10060621 3300031824 Bacteria 2330
159 Ga0307410_10051742 3300031852 Bacteria 2770
160 Ga0307412_10334643 3300031911 Bacteria 1209
161 Ga0307412_10356582 3300031911 Bacteria 1176
162 Ga0307412_10456082 3300031911 Bacteria 1054
163 Ga0307409_100289069 3300031995 Bacteria 1519
164 Ga0307409_100566229 3300031995 Bacteria 1118
165 Ga0307409_101038603 3300031995 Bacteria 839
166 Ga0307414_10496326 3300032004 Bacteria 1079
167 Ga0307414_12236384 3300032004 Unclassified 511
168 Ga0307411_10046567 3300032005 Bacteria 2797
169 Ga0373948_0097763 3300034817 Bacteria 688
170 Ga0373940_0002188 3300035088 Bacteria 3747
171 Ga0373923_0518639 3300035111 Bacteria 582
172 Ga0373962_0005434 3300035242 Bacteria 3084
173 Ga0373962_0323638 3300035242 Bacteria 552
174 Ga0373935_0646006 3300035692 Bacteria 776
175 Ga0373927_0953330 3300035695 Bacteria 566
176 Ga0373947_0696914 3300035725 Bacteria 693
177 Ga0373937_0005885 3300036401 Bacteria 10549
178 Ga0373937_0265229 3300036401 Bacteria 1620
179 Ga0373925_0906223 3300037068 Bacteria 727
180 Ga0436364_0046963 3300037853 Bacteria 1641
181 Ga0436361_0518468 3300039447 Bacteria 5234
182 Ga0439460_0329681 3300042461 Bacteria 536
183 Ga0453683_0164382 3300044673 Bacteria 1405
184 Ga0451576_0147541 3300045051 Bacteria 2453
185 Ga0451576_1669798 3300045051 Bacteria 660
186 Ga0466967_0998656 3300045976 Bacteria 833
187 Ga0495651_0817744 3300046462 Bacteria 574
188 Ga0495669_0150631 3300046684 Bacteria 1101
189 Ga0496108_0050570 3300048911 Bacteria 3479
190 Ga0496110_0261168 3300048913 Bacteria 1576
191 Ga0496112_0192211 3300048915 Bacteria 2002
192 Ga0496113_0652500 3300048916 Bacteria 841
193 Ga0496115_0036085 3300048918 Bacteria 3913
194 Ga0496125_0713781 3300048928 Bacteria 530
195 Ga0496126_0078095 3300048929 Bacteria 2934
196 Ga0501297_012519 3300049520 Bacteria 987
197 Ga0501034_1190201 3300049571 Bacteria 641
198 Ga0501036_0908359 3300049572 Bacteria 722
199 Ga0501038_1030790 3300049574 Bacteria 603
200 Ga0501040_0156030 3300049576 Bacteria 1612
201 Ga0501042_0112130 3300049578 Bacteria 1964
202 Ga0501043_0013862 3300049579 Bacteria 6308
203 Ga0501046_0367621 3300049580 Bacteria 1042
204 Ga0501047_0009110 3300049581 Bacteria 9374
205 Ga0501047_0839234 3300049581 Bacteria 733
206 Ga0501048_0194573 3300049582 Bacteria 1437
207 Ga0501048_0610883 3300049582 Bacteria 783
208 Ga0501067_0083770 3300049583 Bacteria 1769
209 Ga0501068_0260905 3300049584 Bacteria 1105
210 Ga0501072_0086004 3300049588 Bacteria 2495
211 Ga0501072_1186588 3300049588 Bacteria 593
212 Ga0501073_0653600 3300049589 Bacteria 726
213 Ga0501075_0567302 3300049591 Bacteria 866
214 Ga0501076_0136920 3300049592 Bacteria 1988
215 Ga0501076_0475675 3300049592 Bacteria 1029
216 Ga0501077_0069000 3300049593 Bacteria 2241
217 Ga0501079_0908487 3300049741 Bacteria 693
218 Ga0501080_1550871 3300049742 Bacteria 562
219 Ga0501080_1861916 3300049742 Bacteria 504
220 Ga0501081_0193325 3300049743 Bacteria 1474
221 Ga0501081_0488853 3300049743 Bacteria 917
222 Ga0501083_0376806 3300049744 Bacteria 923
223 Ga0501083_0650476 3300049744 Bacteria 686
224 Ga0501035_0277625 3300049822 Bacteria 1417
225 Ga0501044_0465723 3300049823 Bacteria 1169
226 Ga0501044_0627789 3300049823 Bacteria 965
227 nmdc:mga0k408_524100_c1 3300050493 Unclassified 701
228 nmdc:mga05p37_1751747_c1 3300050507 Bacteria 602
229 nmdc:mga0qj67_1488293_c1 3300050509 Unclassified 521
230 nmdc:mga06r32_816593_c1 3300050510 Bacteria 892
231 nmdc:mga08y16_220256_c1 3300050511 Bacteria 1965
232 nmdc:mga08x19_702416_c1 3300050514 Bacteria 718
233 Ga0500627_0050994 3300053158 Bacteria 1804
234 Ga0500611_220944 3300053727 Bacteria 541
235 Ga0501084_0259396 3300054114 Bacteria 1467
236 Ga0501084_0316190 3300054114 Bacteria 1319
237 Ga0501084_0778041 3300054114 Unclassified 806
238 Ga0501084_1485320 3300054114 Bacteria 567
239 Ga0590075_036950 3300059424 Bacteria 1245
240 Ga0590077_014897 3300059426 Bacteria 1622
241 Ga0501082_0655462 3300060353 Bacteria 919
242 Ga0530510_0021720 3300061734 Bacteria 4567
243 Ga0530510_0536342 3300061734 Bacteria 888
244 Ga0530510_1542936 3300061734 Bacteria 510

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035242 Ga0373962_0323638 Ga0373962_0323638_261_539 86
2 3300049588 Ga0501072_1186588 Ga0501072_1186588_70_342 89
3 3300035088 Ga0373940_0002188 Ga0373940_0002188_3206_3490 90
4 3300035242 Ga0373962_0005434 Ga0373962_0005434_2590_2874 90
5 iso_pu_bacteria 2842333319 2842335818 90
6 iso_pu_bacteria 8001845381 8001848959 90
7 3300005290 Ga0065712_10201436 Ga0065712_102014362 91
8 3300005344 Ga0070661_101537859 Ga0070661_1015378592 91
9 3300005434 Ga0070709_10552739 Ga0070709_105527391 91
10 3300005439 Ga0070711_100470327 Ga0070711_1004703271 91
11 3300005439 Ga0070711_101068259 Ga0070711_1010682592 91
12 3300005471 Ga0070698_100151220 Ga0070698_1001512203 91
13 3300005530 Ga0070679_100558030 Ga0070679_1005580301 91
14 3300005616 Ga0068852_101142972 Ga0068852_1011429722 91
15 3300005618 Ga0068864_102038594 Ga0068864_1020385942 91
16 3300005841 Ga0068863_101171923 Ga0068863_1011719231 91
17 3300005842 Ga0068858_100370166 Ga0068858_1003701662 91
18 3300006028 Ga0070717_11901232 Ga0070717_119012322 91
19 3300006163 Ga0070715_10219286 Ga0070715_102192862 91
20 3300006163 Ga0070715_10502960 Ga0070715_105029602 91
21 3300006175 Ga0070712_100528229 Ga0070712_1005282291 91
22 3300006914 Ga0075436_100701277 Ga0075436_1007012772 91
23 3300007265 Ga0099794_10268527 Ga0099794_102685272 91
24 3300009551 Ga0105238_10007346 Ga0105238_100073462 91
25 3300014325 Ga0163163_10603351 Ga0163163_106033512 91
26 3300014968 Ga0157379_10395923 Ga0157379_103959232 91
27 3300025906 Ga0207699_10778564 Ga0207699_107785642 91
28 3300025910 Ga0207684_10448569 Ga0207684_104485692 91
29 3300025915 Ga0207693_10381299 Ga0207693_103812992 91
30 3300025916 Ga0207663_10869210 Ga0207663_108692101 91
31 3300025920 Ga0207649_11029374 Ga0207649_110293742 91
32 3300025921 Ga0207652_11722017 Ga0207652_117220172 91
33 3300025924 Ga0207694_10060774 Ga0207694_100607744 91
34 3300025928 Ga0207700_10624473 Ga0207700_106244731 91
35 3300026035 Ga0207703_10252268 Ga0207703_102522681 91
36 3300026088 Ga0207641_10472927 Ga0207641_104729272 91
37 3300026095 Ga0207676_12012365 Ga0207676_120123651 91
38 3300028800 Ga0265338_10185289 Ga0265338_101852891 91
39 3300031239 Ga0265328_10124755 Ga0265328_101247552 91
40 3300031241 Ga0265325_10096118 Ga0265325_100961182 91
41 3300031247 Ga0265340_10293925 Ga0265340_102939252 91
42 3300031250 Ga0265331_10008032 Ga0265331_100080322 91
43 3300031595 Ga0265313_10009892 Ga0265313_100098922 91
44 3300035111 Ga0373923_0518639 Ga0373923_0518639_273_548 91
45 3300035692 Ga0373935_0646006 Ga0373935_0646006_379_654 91
46 3300035695 Ga0373927_0953330 Ga0373927_0953330_20_295 91
47 3300035725 Ga0373947_0696914 Ga0373947_0696914_68_343 91
48 3300036401 Ga0373937_0005885 Ga0373937_0005885_9460_9735 91
49 3300036401 Ga0373937_0265229 Ga0373937_0265229_1123_1398 91
50 3300037068 Ga0373925_0906223 Ga0373925_0906223_306_581 91
51 3300037853 Ga0436364_0046963 Ga0436364_0046963_1295_1573 91
52 3300046462 Ga0495651_0817744 Ga0495651_0817744_204_479 91
53 3300049593 Ga0501077_0069000 Ga0501077_0069000_1001_1279 91
54 3300049743 Ga0501081_0488853 Ga0501081_0488853_96_374 91
55 3300049744 Ga0501083_0650476 Ga0501083_0650476_336_614 91
56 3300050514 nmdc:mga08x19_702416_c1 nmdc:mga08x19_702416_c1_184_459 91
57 3300031247 Ga0265340_10062719 Ga0265340_100627192 92
58 3300054114 Ga0501084_1485320 Ga0501084_1485320_166_462 92
59 3300005329 Ga0070683_100036459 Ga0070683_1000364592 93
60 3300005336 Ga0070680_100272058 Ga0070680_1002720583 93
61 3300005339 Ga0070660_100002660 Ga0070660_1000026609 93
62 3300005436 Ga0070713_100862914 Ga0070713_1008629142 93
63 3300005458 Ga0070681_10420549 Ga0070681_104205492 93
64 3300005535 Ga0070684_100021536 Ga0070684_1000215362 93
65 3300005539 Ga0068853_100022569 Ga0068853_1000225693 93
66 3300005563 Ga0068855_100039426 Ga0068855_1000394267 93
67 3300005577 Ga0068857_100055202 Ga0068857_1000552022 93
68 3300005578 Ga0068854_100551964 Ga0068854_1005519642 93
69 3300005616 Ga0068852_100032906 Ga0068852_1000329065 93
70 3300006163 Ga0070715_10479547 Ga0070715_104795471 93
71 3300006173 Ga0070716_101305527 Ga0070716_1013055272 93
72 3300006175 Ga0070712_100205279 Ga0070712_1002052791 93
73 3300009093 Ga0105240_10009181 Ga0105240_100091817 93
74 3300009545 Ga0105237_10091195 Ga0105237_100911952 93
75 3300009551 Ga0105238_10006415 Ga0105238_100064157 93
76 3300010159 Ga0099796_10014183 Ga0099796_100141834 93
77 3300010159 Ga0099796_10086713 Ga0099796_100867132 93
78 3300010375 Ga0105239_11931249 Ga0105239_119312492 93
79 3300013104 Ga0157370_10154279 Ga0157370_101542792 93
80 3300013105 Ga0157369_10008434 Ga0157369_100084349 93
81 3300025909 Ga0207705_10166784 Ga0207705_101667842 93
82 3300025912 Ga0207707_10001819 Ga0207707_1000181916 93
83 3300025913 Ga0207695_10025578 Ga0207695_100255788 93
84 3300025915 Ga0207693_10096983 Ga0207693_100969833 93
85 3300025916 Ga0207663_10392598 Ga0207663_103925981 93
86 3300025917 Ga0207660_10022855 Ga0207660_100228552 93
87 3300025919 Ga0207657_10003059 Ga0207657_1000305915 93
88 3300025921 Ga0207652_10009912 Ga0207652_100099127 93
89 3300025924 Ga0207694_10011186 Ga0207694_100111865 93
90 3300025928 Ga0207700_10783505 Ga0207700_107835052 93
91 3300025939 Ga0207665_10383968 Ga0207665_103839681 93
92 3300025944 Ga0207661_10074251 Ga0207661_100742512 93
93 3300025949 Ga0207667_10078314 Ga0207667_100783142 93
94 3300026041 Ga0207639_10598998 Ga0207639_105989982 93
95 3300026116 Ga0207674_10023429 Ga0207674_100234294 93
96 3300026142 Ga0207698_10096387 Ga0207698_100963872 93
97 3300031238 Ga0265332_10001295 Ga0265332_100012953 93
98 3300031241 Ga0265325_10137235 Ga0265325_101372351 93
99 3300031247 Ga0265340_10007359 Ga0265340_100073595 93
100 3300031249 Ga0265339_10039155 Ga0265339_100391553 93
101 3300031250 Ga0265331_10047645 Ga0265331_100476453 93
102 3300031711 Ga0265314_10140354 Ga0265314_101403543 93
103 3300031712 Ga0265342_10000137 Ga0265342_100001373 93
104 3300045976 Ga0466967_0998656 Ga0466967_0998656_99_380 93
105 3300048911 Ga0496108_0050570 Ga0496108_0050570_2283_2582 93
106 3300048913 Ga0496110_0261168 Ga0496110_0261168_231_530 93
107 3300048915 Ga0496112_0192211 Ga0496112_0192211_894_1193 93
108 3300048916 Ga0496113_0652500 Ga0496113_0652500_273_572 93
109 3300048918 Ga0496115_0036085 Ga0496115_0036085_1369_1668 93
110 3300049520 Ga0501297_012519 Ga0501297_012519_180_461 93
111 3300049742 Ga0501080_1550871 Ga0501080_1550871_47_328 93
112 3300053158 Ga0500627_0050994 Ga0500627_0050994_1227_1526 93
113 3300005295 Ga0065707_10375809 Ga0065707_103758092 94
114 3300005353 Ga0070669_100054701 Ga0070669_1000547013 94
115 3300005718 Ga0068866_10115360 Ga0068866_101153602 94
116 3300005719 Ga0068861_100221444 Ga0068861_1002214443 94
117 3300005719 Ga0068861_100265482 Ga0068861_1002654822 94
118 3300005844 Ga0068862_100011228 Ga0068862_1000112285 94
119 3300005844 Ga0068862_100580391 Ga0068862_1005803912 94
120 3300005844 Ga0068862_102781404 Ga0068862_1027814042 94
121 3300005981 Ga0081538_10011664 Ga0081538_100116643 94
122 3300005983 Ga0081540_1127532 Ga0081540_11275322 94
123 3300006844 Ga0075428_101293551 Ga0075428_1012935512 94
124 3300006846 Ga0075430_101574404 Ga0075430_1015744042 94
125 3300006847 Ga0075431_100551437 Ga0075431_1005514372 94
126 3300006847 Ga0075431_101913959 Ga0075431_1019139592 94
127 3300006880 Ga0075429_100281380 Ga0075429_1002813801 94
128 3300006881 Ga0068865_100093548 Ga0068865_1000935482 94
129 3300009094 Ga0111539_10204401 Ga0111539_102044013 94
130 3300009176 Ga0105242_10632900 Ga0105242_106329002 94
131 3300009553 Ga0105249_10215546 Ga0105249_102155463 94
132 3300013306 Ga0163162_10405874 Ga0163162_104058742 94
133 3300014326 Ga0157380_10035745 Ga0157380_100357452 94
134 3300021361 Ga0213872_10051524 Ga0213872_100515242 94
135 3300025899 Ga0207642_10422462 Ga0207642_104224622 94
136 3300025937 Ga0207669_10990926 Ga0207669_109909262 94
137 3300025938 Ga0207704_10016043 Ga0207704_100160434 94
138 3300026089 Ga0207648_11356372 Ga0207648_113563722 94
139 3300026118 Ga0207675_100112888 Ga0207675_1001128882 94
140 3300026118 Ga0207675_100409429 Ga0207675_1004094292 94
141 3300027907 Ga0207428_10188831 Ga0207428_101888312 94
142 3300028380 Ga0268265_10181661 Ga0268265_101816612 94
143 3300028380 Ga0268265_10230486 Ga0268265_102304862 94
144 3300029277 Ga0311001_1017383 Ga0311001_10173832 94
145 3300031731 Ga0307405_11999965 Ga0307405_119999652 94
146 3300031824 Ga0307413_10060621 Ga0307413_100606212 94
147 3300031852 Ga0307410_10051742 Ga0307410_100517423 94
148 3300031911 Ga0307412_10356582 Ga0307412_103565822 94
149 3300031995 Ga0307409_100289069 Ga0307409_1002890693 94
150 3300032004 Ga0307414_10496326 Ga0307414_104963262 94
151 3300032004 Ga0307414_12236384 Ga0307414_122363841 94
152 3300032005 Ga0307411_10046567 Ga0307411_100465673 94
153 3300039447 Ga0436361_0518468 Ga0436361_0518468_1230_1514 94
154 3300042461 Ga0439460_0329681 Ga0439460_0329681_56_340 94
155 3300045051 Ga0451576_0147541 Ga0451576_0147541_1812_2096 94
156 3300050493 nmdc:mga0k408_524100_c1 nmdc:mga0k408_524100_c1_23_307 94
157 3300050509 nmdc:mga0qj67_1488293_c1 nmdc:mga0qj67_1488293_c1_40_324 94
158 3300050510 nmdc:mga06r32_816593_c1 nmdc:mga06r32_816593_c1_272_556 94
159 3300050511 nmdc:mga08y16_220256_c1 nmdc:mga08y16_220256_c1_566_850 94
160 3300059424 Ga0590075_036950 Ga0590075_036950_319_603 94
161 3300059426 Ga0590077_014897 Ga0590077_014897_120_404 94
162 3300061734 Ga0530510_1542936 Ga0530510_1542936_23_307 94
163 3300001990 JGI24737J22298_10027719 JGI24737J22298_100277193 95
164 3300005340 Ga0070689_100710907 Ga0070689_1007109072 95
165 3300005455 Ga0070663_101752178 Ga0070663_1017521781 95
166 3300005457 Ga0070662_100019653 Ga0070662_1000196534 95
167 3300005518 Ga0070699_100898641 Ga0070699_1008986412 95
168 3300005539 Ga0068853_100019844 Ga0068853_1000198445 95
169 3300005546 Ga0070696_101051910 Ga0070696_1010519102 95
170 3300005563 Ga0068855_101530796 Ga0068855_1015307961 95
171 3300005577 Ga0068857_100064365 Ga0068857_1000643652 95
172 3300005577 Ga0068857_100122660 Ga0068857_1001226604 95
173 3300005577 Ga0068857_101723557 Ga0068857_1017235571 95
174 3300005578 Ga0068854_100181125 Ga0068854_1001811252 95
175 3300005616 Ga0068852_100449037 Ga0068852_1004490372 95
176 3300005617 Ga0068859_100702580 Ga0068859_1007025801 95
177 3300005841 Ga0068863_100002338 Ga0068863_10000233819 95
178 3300005843 Ga0068860_100000073 Ga0068860_10000007343 95
179 3300006931 Ga0097620_100702630 Ga0097620_1007026301 95
180 3300009174 Ga0105241_10650811 Ga0105241_106508112 95
181 3300009551 Ga0105238_10147017 Ga0105238_101470174 95
182 3300009553 Ga0105249_12640028 Ga0105249_126400282 95
183 3300014326 Ga0157380_10001316 Ga0157380_1000131610 95
184 3300025903 Ga0207680_10214364 Ga0207680_102143642 95
185 3300025924 Ga0207694_10080704 Ga0207694_100807043 95
186 3300025933 Ga0207706_10007457 Ga0207706_100074578 95
187 3300025981 Ga0207640_10045383 Ga0207640_100453833 95
188 3300025986 Ga0207658_10000025 Ga0207658_10000025116 95
189 3300026041 Ga0207639_10025691 Ga0207639_100256912 95
190 3300026067 Ga0207678_10926727 Ga0207678_109267272 95
191 3300026088 Ga0207641_10004846 Ga0207641_100048463 95
192 3300026116 Ga0207674_10068909 Ga0207674_100689095 95
193 3300026116 Ga0207674_10078632 Ga0207674_100786325 95
194 3300026116 Ga0207674_11590053 Ga0207674_115900532 95
195 3300026142 Ga0207698_10251388 Ga0207698_102513882 95
196 3300026142 Ga0207698_10763248 Ga0207698_107632482 95
197 3300028380 Ga0268265_10861993 Ga0268265_108619932 95
198 3300028381 Ga0268264_10000120 Ga0268264_1000012059 95
199 3300028800 Ga0265338_10418377 Ga0265338_104183772 95
200 3300031251 Ga0265327_10013369 Ga0265327_100133695 95
201 3300031548 Ga0307408_100464110 Ga0307408_1004641102 95
202 3300031548 Ga0307408_100768450 Ga0307408_1007684502 95
203 3300031731 Ga0307405_10128918 Ga0307405_101289182 95
204 3300031911 Ga0307412_10334643 Ga0307412_103346432 95
205 3300031911 Ga0307412_10456082 Ga0307412_104560822 95
206 3300031995 Ga0307409_100566229 Ga0307409_1005662293 95
207 3300031995 Ga0307409_101038603 Ga0307409_1010386032 95
208 3300034817 Ga0373948_0097763 Ga0373948_0097763_380_673 95
209 3300044673 Ga0453683_0164382 Ga0453683_0164382_526_819 95
210 3300045051 Ga0451576_1669798 Ga0451576_1669798_119_412 95
211 3300046684 Ga0495669_0150631 Ga0495669_0150631_286_579 95
212 3300048928 Ga0496125_0713781 Ga0496125_0713781_191_499 95
213 3300048929 Ga0496126_0078095 Ga0496126_0078095_2395_2712 95
214 3300049571 Ga0501034_1190201 Ga0501034_1190201_232_531 95
215 3300049572 Ga0501036_0908359 Ga0501036_0908359_259_558 95
216 3300049574 Ga0501038_1030790 Ga0501038_1030790_118_405 95
217 3300049576 Ga0501040_0156030 Ga0501040_0156030_125_412 95
218 3300049578 Ga0501042_0112130 Ga0501042_0112130_803_1090 95
219 3300049579 Ga0501043_0013862 Ga0501043_0013862_1409_1708 95
220 3300049580 Ga0501046_0367621 Ga0501046_0367621_340_639 95
221 3300049581 Ga0501047_0009110 Ga0501047_0009110_1644_1943 95
222 3300049581 Ga0501047_0839234 Ga0501047_0839234_152_439 95
223 3300049582 Ga0501048_0194573 Ga0501048_0194573_718_1017 95
224 3300049582 Ga0501048_0610883 Ga0501048_0610883_413_700 95
225 3300049583 Ga0501067_0083770 Ga0501067_0083770_1247_1636 95
226 3300049584 Ga0501068_0260905 Ga0501068_0260905_60_347 95
227 3300049588 Ga0501072_0086004 Ga0501072_0086004_222_509 95
228 3300049589 Ga0501073_0653600 Ga0501073_0653600_113_424 95
229 3300049591 Ga0501075_0567302 Ga0501075_0567302_66_353 95
230 3300049592 Ga0501076_0136920 Ga0501076_0136920_118_405 95
231 3300049592 Ga0501076_0475675 Ga0501076_0475675_603_890 95
232 3300049741 Ga0501079_0908487 Ga0501079_0908487_390_677 95
233 3300049742 Ga0501080_1861916 Ga0501080_1861916_108_395 95
234 3300049743 Ga0501081_0193325 Ga0501081_0193325_1038_1325 95
235 3300049744 Ga0501083_0376806 Ga0501083_0376806_229_516 95
236 3300049822 Ga0501035_0277625 Ga0501035_0277625_804_1091 95
237 3300049823 Ga0501044_0465723 Ga0501044_0465723_337_624 95
238 3300049823 Ga0501044_0627789 Ga0501044_0627789_225_524 95
239 3300050507 nmdc:mga05p37_1751747_c1 nmdc:mga05p37_1751747_c1_11_298 95
240 3300053727 Ga0500611_220944 Ga0500611_220944_90_386 95
241 3300054114 Ga0501084_0259396 Ga0501084_0259396_152_439 95
242 3300054114 Ga0501084_0316190 Ga0501084_0316190_452_739 95
243 3300054114 Ga0501084_0778041 Ga0501084_0778041_385_690 95
244 3300060353 Ga0501082_0655462 Ga0501082_0655462_550_873 95
245 3300061734 Ga0530510_0021720 Ga0530510_0021720_1634_1921 95
246 3300061734 Ga0530510_0536342 Ga0530510_0536342_26_313 95

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00708

Acylphosphatase

Acylphosphatase

19

101

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2w4d-assembly1.cif.gz_B acylphosphatase variant g91a from pyrococcus horikoshii 0.9792 5 92
3tnv-assembly1.cif.gz_A acylphosphatase with thermophilic surface and mesophilic core 0.979 5 92
1v3z-assembly1.cif.gz_B crystal structure of acylphosphatase from pyrococcus horikoshii 0.9752 5 92
3trg-assembly1.cif.gz_A structure of an acylphosphatase from coxiella burnetii 0.9737 3 92
8jfs-assembly2.cif.gz_B phosphate bound acylphosphatase from deinococcus radiodurans at 1 angstrom resolution 0.9699 6 92
ID Description Score Start End Superfamily
af_K7LZQ3_146_256_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9944 5 92 3.30.70.100
af_A0A1D6NY72_1_96_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9814 5 92 3.30.70.100
3tnvA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.979 5 92 3.30.70.100
af_C0PM37_2_111_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9764 5 92 3.30.70.100
3trgA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9732 3 92 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A095SNZ1-F1-model_v4 acylphosphatase (EC 3.6.1.7) 1.004 6 92 GO:0003998
AF-A0A512H537-F1-model_v4 acylphosphatase (EC 3.6.1.7) 1.003 6 95 GO:0003998
AF-A0A6N7LTB6-F1-model_v4 acylphosphatase (EC 3.6.1.7) 1.002 6 92 GO:0003998
AF-H6SSM0-F1-model_v4 acylphosphatase (EC 3.6.1.7) 1.001 5 95 GO:0003998
AF-A0A7Y0E581-F1-model_v4 Acylphosphatase (EC 3.6.1.7) 1.001 6 95 GO:0003998

Feature Viewer

pLDDT pTM Quality
94.69 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map