F358068

General Info

Members Datasets Scaffolds Average Seq Length
246 134 492 144

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100222828|Ga0097621_1002228282
Length 135
Sequence MKIEKIRLFLVDDDAVFLKSLEIDFLQRADFIIETYSTGELCIKNLKHNPDVIILDYHLDGIDKSAMNGLDTPDIPVIMLSSQDKIDVAINCMHHRATDYVVKSETSFVRLQKIITSIFSYKKMEKELKWYMDRV

Samples

Sample ID Description Type Environment
1 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
96 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
97 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
101 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
110 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
123 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
130 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
134 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.81
Nodule 0
Rhizoplane 0
Rhizosphere 97.56
Stem 0
Stem Tuber 0
Unclassified 19.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0097621_100222828 3300006237 Bacteria 1644
2 Ga0065714_10085412 3300005288 Bacteria 2150
3 Ga0065712_10160987 3300005290 Bacteria 1299
4 Ga0065715_10264961 3300005293 Bacteria 1127
5 Ga0065715_10786415 3300005293 Unclassified 615
6 Ga0065707_10129424 3300005295 Bacteria 1940
7 Ga0065707_10165601 3300005295 Unclassified 1525
8 Ga0070670_100156974 3300005331 Bacteria 1971
9 Ga0070670_100201971 3300005331 Bacteria 1727
10 Ga0068869_100071174 3300005334 Unclassified 2574
11 Ga0068869_100568741 3300005334 Unclassified 954
12 Ga0070682_100254258 3300005337 Bacteria 1268
13 Ga0070682_100334362 3300005337 Bacteria 1124
14 Ga0068868_100432861 3300005338 Unclassified 1141
15 Ga0068868_101298942 3300005338 Unclassified 676
16 Ga0070689_100145357 3300005340 Bacteria 1909
17 Ga0070689_100265285 3300005340 Bacteria 1420
18 Ga0070689_100281975 3300005340 Bacteria 1379
19 Ga0070689_101127074 3300005340 Bacteria 702
20 Ga0070689_101178543 3300005340 Bacteria 687
21 Ga0070669_101397621 3300005353 Bacteria 607
22 Ga0070675_100098149 3300005354 Unclassified 2463
23 Ga0070675_101180012 3300005354 Unclassified 705
24 Ga0070671_100735127 3300005355 Bacteria 857
25 Ga0070673_100161064 3300005364 Bacteria 1908
26 Ga0070673_100239666 3300005364 Bacteria 1576
27 Ga0070688_100223015 3300005365 Bacteria 1329
28 Ga0070688_100434195 3300005365 Bacteria 978
29 Ga0070667_100305180 3300005367 Bacteria 1434
30 Ga0070701_10759799 3300005438 Bacteria 657
31 Ga0070700_100735780 3300005441 Unclassified 788
32 Ga0070678_100216205 3300005456 Bacteria 1591
33 Ga0068867_100780048 3300005459 Bacteria 850
34 Ga0070685_10045388 3300005466 Unclassified 2520
35 Ga0070685_10052399 3300005466 Bacteria 2361
36 Ga0070685_10493058 3300005466 Unclassified 865
37 Ga0070698_100005739 3300005471 Bacteria 13570
38 Ga0070698_100063452 3300005471 Bacteria 3725
39 Ga0070698_100224528 3300005471 Bacteria 1811
40 Ga0070697_101774207 3300005536 Unclassified 552
41 Ga0068853_100037437 3300005539 Bacteria 4128
42 Ga0070672_100460975 3300005543 Unclassified 1096
43 Ga0070686_100315030 3300005544 Bacteria 1165
44 Ga0070704_101140880 3300005549 Unclassified 709
45 Ga0068855_100245399 3300005563 Bacteria 1999
46 Ga0068855_100550969 3300005563 Unclassified 1248
47 Ga0068857_100043311 3300005577 Bacteria 3993
48 Ga0068857_101015407 3300005577 Bacteria 799
49 Ga0068856_100107147 3300005614 Bacteria 2790
50 Ga0068856_101002622 3300005614 Bacteria 853
51 Ga0068852_100748143 3300005616 Bacteria 990
52 Ga0068859_100000551 3300005617 Bacteria 37187
53 Ga0068859_100336628 3300005617 Unclassified 1603
54 Ga0068859_100352193 3300005617 Bacteria 1567
55 Ga0068864_100034802 3300005618 Bacteria 4286
56 Ga0068864_100098571 3300005618 Bacteria 2589
57 Ga0068864_100196414 3300005618 Unclassified 1852
58 Ga0068864_100681896 3300005618 Bacteria 1002
59 Ga0068864_100740679 3300005618 Bacteria 963
60 Ga0068866_10562939 3300005718 Bacteria 764
61 Ga0068861_100315578 3300005719 Bacteria 1360
62 Ga0068851_10018271 3300005834 Bacteria 3377
63 Ga0068851_10223169 3300005834 Bacteria 1060
64 Ga0068870_10083632 3300005840 Bacteria 1770
65 Ga0068863_100010894 3300005841 Bacteria 8816
66 Ga0068863_100203442 3300005841 Unclassified 1905
67 Ga0068863_100386335 3300005841 Bacteria 1367
68 Ga0068863_100568988 3300005841 Bacteria 1120
69 Ga0068863_101212975 3300005841 Bacteria 760
70 Ga0068860_100076315 3300005843 Bacteria 3188
71 Ga0068862_100940670 3300005844 Bacteria 852
72 Ga0068862_101196497 3300005844 Bacteria 758
73 Ga0068862_101429232 3300005844 Bacteria 696
74 Ga0070715_10433486 3300006163 Bacteria 738
75 Ga0070715_10464847 3300006163 Bacteria 717
76 Ga0070715_10656127 3300006163 Bacteria 622
77 Ga0070716_100167403 3300006173 Bacteria 1431
78 Ga0097621_100021368 3300006237 Bacteria 5005
79 Ga0097621_100504705 3300006237 Bacteria 1096
80 Ga0068871_100115415 3300006358 Bacteria 2263
81 Ga0068871_100665330 3300006358 Bacteria 952
82 Ga0068871_100890255 3300006358 Bacteria 825
83 Ga0075428_100203557 3300006844 Unclassified 2139
84 Ga0068865_101159709 3300006881 Bacteria 683
85 Ga0097620_100000551 3300006931 Bacteria 37187
86 Ga0097620_100336650 3300006931 Unclassified 1603
87 Ga0097620_100352212 3300006931 Bacteria 1567
88 Ga0111539_10079802 3300009094 Bacteria 3850
89 Ga0111539_13358901 3300009094 Bacteria 515
90 Ga0105242_10030712 3300009176 Bacteria 4291
91 Ga0105242_10071427 3300009176 Bacteria 2880
92 Ga0105242_10086975 3300009176 Bacteria 2624
93 Ga0105242_10405928 3300009176 Unclassified 1273
94 Ga0105242_10623808 3300009176 Bacteria 1045
95 Ga0105249_10054791 3300009553 Bacteria 3647
96 Ga0105249_10134283 3300009553 Bacteria 2366
97 Ga0105239_11522071 3300010375 Bacteria 773
98 Ga0157371_11247732 3300013102 Bacteria 574
99 Ga0157370_10000263 3300013104 Bacteria 66700
100 Ga0157378_10003174 3300013297 Bacteria 14593
101 Ga0157378_10810798 3300013297 Unclassified 962
102 Ga0163162_10005051 3300013306 Bacteria 12711
103 Ga0163162_10104286 3300013306 Bacteria 2930
104 Ga0163162_10668420 3300013306 Bacteria 1162
105 Ga0163162_10924692 3300013306 Bacteria 984
106 Ga0163162_11956017 3300013306 Unclassified 671
107 Ga0157372_10000250 3300013307 Bacteria 59465
108 Ga0157375_11189560 3300013308 Bacteria 894
109 Ga0163163_10476691 3300014325 Unclassified 1309
110 Ga0163163_10775227 3300014325 Bacteria 1022
111 Ga0157380_10528651 3300014326 Bacteria 1152
112 Ga0157380_11093931 3300014326 Bacteria 836
113 Ga0157380_11737775 3300014326 Bacteria 682
114 Ga0157379_10246915 3300014968 Bacteria 1619
115 Ga0157376_10095893 3300014969 Bacteria 2580
116 Ga0157376_10151479 3300014969 Unclassified 2092
117 Ga0157376_11229320 3300014969 Bacteria 778
118 Ga0163161_10052924 3300017792 Bacteria 2943
119 Ga0163161_10196336 3300017792 Bacteria 1554
120 Ga0163161_10509631 3300017792 Bacteria 981
121 Ga0207697_10168852 3300025315 Bacteria 956
122 Ga0207656_10021877 3300025321 Bacteria 2560
123 Ga0207656_10232479 3300025321 Unclassified 899
124 Ga0207682_10241217 3300025893 Bacteria 840
125 Ga0207642_10492448 3300025899 Bacteria 749
126 Ga0207685_10086029 3300025905 Bacteria 1313
127 Ga0207645_10226590 3300025907 Unclassified 1233
128 Ga0207643_10001657 3300025908 Bacteria 12510
129 Ga0207681_10426245 3300025923 Unclassified 1076
130 Ga0207650_10601627 3300025925 Unclassified 925
131 Ga0207650_11326216 3300025925 Unclassified 612
132 Ga0207686_10034974 3300025934 Bacteria 3012
133 Ga0207686_10085811 3300025934 Bacteria 2066
134 Ga0207686_11312065 3300025934 Bacteria 594
135 Ga0207670_10021032 3300025936 Bacteria 4018
136 Ga0207670_10258830 3300025936 Bacteria 1348
137 Ga0207670_10865409 3300025936 Bacteria 756
138 Ga0207669_10854476 3300025937 Bacteria 758
139 Ga0207665_10142838 3300025939 Bacteria 1708
140 Ga0207711_11404936 3300025941 Bacteria 641
141 Ga0207689_10050119 3300025942 Bacteria 3443
142 Ga0207667_10066960 3300025949 Unclassified 3742
143 Ga0207667_10209143 3300025949 Bacteria 2000
144 Ga0207667_10884260 3300025949 Unclassified 886
145 Ga0207651_10581605 3300025960 Unclassified 977
146 Ga0207651_10678807 3300025960 Bacteria 906
147 Ga0207651_11960150 3300025960 Bacteria 526
148 Ga0207712_10004996 3300025961 Bacteria 8388
149 Ga0207712_10059769 3300025961 Bacteria 2699
150 Ga0207640_11060731 3300025981 Bacteria 715
151 Ga0207658_10267013 3300025986 Bacteria 1461
152 Ga0207677_10504846 3300026023 Unclassified 1046
153 Ga0207639_10019488 3300026041 Bacteria 4840
154 Ga0207639_10249929 3300026041 Bacteria 1546
155 Ga0207708_10024794 3300026075 Bacteria 4538
156 Ga0207702_10185272 3300026078 Bacteria 1919
157 Ga0207702_10468938 3300026078 Bacteria 1224
158 Ga0207641_10000416 3300026088 Bacteria 49757
159 Ga0207641_10022869 3300026088 Bacteria 5148
160 Ga0207641_10106956 3300026088 Bacteria 2473
161 Ga0207641_10146300 3300026088 Archaea 2137
162 Ga0207641_10635821 3300026088 Unclassified 1047
163 Ga0207676_10003856 3300026095 Bacteria 10590
164 Ga0207676_10022650 3300026095 Bacteria 4621
165 Ga0207676_10808309 3300026095 Bacteria 915
166 Ga0207676_11533344 3300026095 Bacteria 664
167 Ga0207674_10023283 3300026116 Bacteria 6636
168 Ga0207674_10722398 3300026116 Bacteria 961
169 Ga0207675_100478951 3300026118 Unclassified 1237
170 Ga0207675_100619834 3300026118 Unclassified 1086
171 Ga0207683_10543594 3300026121 Bacteria 1074
172 Ga0207683_11266540 3300026121 Bacteria 683
173 Ga0207698_10796419 3300026142 Bacteria 947
174 Ga0210000_1055762 3300027462 Bacteria 637
175 Ga0207428_10205452 3300027907 Unclassified 1481
176 Ga0268265_10671131 3300028380 Bacteria 998
177 Ga0265326_10143350 3300028558 Unclassified 682
178 Ga0265334_10014045 3300028573 Bacteria 3344
179 Ga0265318_10042877 3300028577 Bacteria 1716
180 Ga0307515_10002087 3300028794 Bacteria 43969
181 Ga0265338_10004303 3300028800 Bacteria 19324
182 Ga0265338_10004513 3300028800 Bacteria 18771
183 Ga0265338_10149040 3300028800 Bacteria 1820
184 Ga0265338_10230487 3300028800 Bacteria 1378
185 Ga0265338_10331163 3300028800 Bacteria 1100
186 Ga0265328_10030836 3300031239 Bacteria 1996
187 Ga0265320_10110099 3300031240 Bacteria 1262
188 Ga0265331_10175023 3300031250 Unclassified 970
189 Ga0265327_10005425 3300031251 Bacteria 10635
190 Ga0265327_10005685 3300031251 Bacteria 10312
191 Ga0265327_10033736 3300031251 Bacteria 2847
192 Ga0265327_10047868 3300031251 Bacteria 2252
193 Ga0265327_10290755 3300031251 Unclassified 721
194 Ga0265316_10053903 3300031344 Bacteria 3149
195 Ga0265316_10465375 3300031344 Bacteria 906
196 Ga0307509_10357152 3300031507 Bacteria 1182
197 Ga0265314_10040559 3300031711 Bacteria 3340
198 Ga0373937_1711465 3300036401 Bacteria 576
199 Ga0395899_0268505 3300037312 Bacteria 1164
200 Ga0451839_1394684 3300041496 Bacteria 750
201 Ga0451849_1511745 3300041505 Unclassified 552
202 Ga0451577_0023887 3300042876 Bacteria 5570
203 Ga0451577_0097558 3300042876 Bacteria 2625
204 Ga0451577_0244957 3300042876 Unclassified 1622
205 Ga0451577_0314343 3300042876 Bacteria 1420
206 Ga0451577_0353584 3300042876 Bacteria 1333
207 Ga0453683_0031903 3300044673 Bacteria 3326
208 Ga0453683_0087119 3300044673 Bacteria 1957
209 Ga0453683_0133001 3300044673 Unclassified 1568
210 Ga0453683_0280959 3300044673 Bacteria 1063
211 Ga0453683_0469853 3300044673 Unclassified 815
212 Ga0453683_0507869 3300044673 Unclassified 782
213 Ga0453684_0000086 3300044712 Bacteria 397278
214 Ga0453684_0000660 3300044712 Bacteria 123924
215 Ga0453684_0014903 3300044712 Bacteria 12363
216 Ga0453684_0067661 3300044712 Bacteria 4541
217 Ga0453684_0074010 3300044712 Bacteria 4292
218 Ga0453684_0079141 3300044712 Bacteria 4110
219 Ga0453684_0109272 3300044712 Bacteria 3364
220 Ga0453684_0123638 3300044712 Bacteria 3119
221 Ga0453684_0131978 3300044712 Bacteria 2996
222 Ga0453684_0288566 3300044712 Bacteria 1869
223 Ga0451576_0036683 3300045051 Bacteria 5195
224 Ga0451576_2177715 3300045051 Bacteria 569
225 Ga0495629_1021902 3300046459 Bacteria 537
226 Ga0495585_0460209 3300046492 Bacteria 608
227 Ga0495594_0211328 3300046499 Unclassified 1106
228 Ga0495608_0498466 3300046511 Bacteria 738
229 Ga0495628_0736513 3300046516 Bacteria 694
230 Ga0495630_0149685 3300046517 Bacteria 1776
231 Ga0495630_0267923 3300046517 Bacteria 1305
232 Ga0495652_0416119 3300046529 Bacteria 948
233 Ga0495586_0355514 3300046535 Bacteria 842
234 Ga0495598_0117419 3300046537 Bacteria 898
235 Ga0495657_0357340 3300046675 Unclassified 864
236 Ga0495599_0884753 3300046678 Bacteria 507
237 Ga0495647_0316559 3300046681 Bacteria 706
238 Ga0495670_0435131 3300046691 Bacteria 710
239 Ga0495600_0489964 3300046809 Bacteria 756
240 Ga0495636_0120049 3300047318 Bacteria 1162
241 Ga0495615_0045195 3300048090 Bacteria 1115
242 nmdc:mga09592_861745_c1 3300050508 Bacteria 763
243 nmdc:mga08y16_115598_c1 3300050511 Bacteria 2793
244 nmdc:mga08y16_423096_c1 3300050511 Bacteria 1361
245 Ga0500578_0706075 3300053086 Unclassified 542
246 Ga0500628_179899 3300053129 Bacteria 603
247 Ga0097621_100222828
248 Ga0065714_10085412
249 Ga0065712_10160987
250 Ga0065715_10264961
251 Ga0065715_10786415
252 Ga0065707_10129424
253 Ga0065707_10165601
254 Ga0070670_100156974
255 Ga0070670_100201971
256 Ga0068869_100071174
257 Ga0068869_100568741
258 Ga0070682_100254258
259 Ga0070682_100334362
260 Ga0068868_100432861
261 Ga0068868_101298942
262 Ga0070689_100145357
263 Ga0070689_100265285
264 Ga0070689_100281975
265 Ga0070689_101127074
266 Ga0070689_101178543
267 Ga0070669_101397621
268 Ga0070675_100098149
269 Ga0070675_101180012
270 Ga0070671_100735127
271 Ga0070673_100161064
272 Ga0070673_100239666
273 Ga0070688_100223015
274 Ga0070688_100434195
275 Ga0070667_100305180
276 Ga0070701_10759799
277 Ga0070700_100735780
278 Ga0070678_100216205
279 Ga0068867_100780048
280 Ga0070685_10045388
281 Ga0070685_10052399
282 Ga0070685_10493058
283 Ga0070698_100005739
284 Ga0070698_100063452
285 Ga0070698_100224528
286 Ga0070697_101774207
287 Ga0068853_100037437
288 Ga0070672_100460975
289 Ga0070686_100315030
290 Ga0070704_101140880
291 Ga0068855_100245399
292 Ga0068855_100550969
293 Ga0068857_100043311
294 Ga0068857_101015407
295 Ga0068856_100107147
296 Ga0068856_101002622
297 Ga0068852_100748143
298 Ga0068859_100000551
299 Ga0068859_100336628
300 Ga0068859_100352193
301 Ga0068864_100034802
302 Ga0068864_100098571
303 Ga0068864_100196414
304 Ga0068864_100681896
305 Ga0068864_100740679
306 Ga0068866_10562939
307 Ga0068861_100315578
308 Ga0068851_10018271
309 Ga0068851_10223169
310 Ga0068870_10083632
311 Ga0068863_100010894
312 Ga0068863_100203442
313 Ga0068863_100386335
314 Ga0068863_100568988
315 Ga0068863_101212975
316 Ga0068860_100076315
317 Ga0068862_100940670
318 Ga0068862_101196497
319 Ga0068862_101429232
320 Ga0070715_10433486
321 Ga0070715_10464847
322 Ga0070715_10656127
323 Ga0070716_100167403
324 Ga0097621_100021368
325 Ga0097621_100504705
326 Ga0068871_100115415
327 Ga0068871_100665330
328 Ga0068871_100890255
329 Ga0075428_100203557
330 Ga0068865_101159709
331 Ga0097620_100000551
332 Ga0097620_100336650
333 Ga0097620_100352212
334 Ga0111539_10079802
335 Ga0111539_13358901
336 Ga0105242_10030712
337 Ga0105242_10071427
338 Ga0105242_10086975
339 Ga0105242_10405928
340 Ga0105242_10623808
341 Ga0105249_10054791
342 Ga0105249_10134283
343 Ga0105239_11522071
344 Ga0157371_11247732
345 Ga0157370_10000263
346 Ga0157378_10003174
347 Ga0157378_10810798
348 Ga0163162_10005051
349 Ga0163162_10104286
350 Ga0163162_10668420
351 Ga0163162_10924692
352 Ga0163162_11956017
353 Ga0157372_10000250
354 Ga0157375_11189560
355 Ga0163163_10476691
356 Ga0163163_10775227
357 Ga0157380_10528651
358 Ga0157380_11093931
359 Ga0157380_11737775
360 Ga0157379_10246915
361 Ga0157376_10095893
362 Ga0157376_10151479
363 Ga0157376_11229320
364 Ga0163161_10052924
365 Ga0163161_10196336
366 Ga0163161_10509631
367 Ga0207697_10168852
368 Ga0207656_10021877
369 Ga0207656_10232479
370 Ga0207682_10241217
371 Ga0207642_10492448
372 Ga0207685_10086029
373 Ga0207645_10226590
374 Ga0207643_10001657
375 Ga0207681_10426245
376 Ga0207650_10601627
377 Ga0207650_11326216
378 Ga0207686_10034974
379 Ga0207686_10085811
380 Ga0207686_11312065
381 Ga0207670_10021032
382 Ga0207670_10258830
383 Ga0207670_10865409
384 Ga0207669_10854476
385 Ga0207665_10142838
386 Ga0207711_11404936
387 Ga0207689_10050119
388 Ga0207667_10066960
389 Ga0207667_10209143
390 Ga0207667_10884260
391 Ga0207651_10581605
392 Ga0207651_10678807
393 Ga0207651_11960150
394 Ga0207712_10004996
395 Ga0207712_10059769
396 Ga0207640_11060731
397 Ga0207658_10267013
398 Ga0207677_10504846
399 Ga0207639_10019488
400 Ga0207639_10249929
401 Ga0207708_10024794
402 Ga0207702_10185272
403 Ga0207702_10468938
404 Ga0207641_10000416
405 Ga0207641_10022869
406 Ga0207641_10106956
407 Ga0207641_10146300
408 Ga0207641_10635821
409 Ga0207676_10003856
410 Ga0207676_10022650
411 Ga0207676_10808309
412 Ga0207676_11533344
413 Ga0207674_10023283
414 Ga0207674_10722398
415 Ga0207675_100478951
416 Ga0207675_100619834
417 Ga0207683_10543594
418 Ga0207683_11266540
419 Ga0207698_10796419
420 Ga0210000_1055762
421 Ga0207428_10205452
422 Ga0268265_10671131
423 Ga0265326_10143350
424 Ga0265334_10014045
425 Ga0265318_10042877
426 Ga0307515_10002087
427 Ga0265338_10004303
428 Ga0265338_10004513
429 Ga0265338_10149040
430 Ga0265338_10230487
431 Ga0265338_10331163
432 Ga0265328_10030836
433 Ga0265320_10110099
434 Ga0265331_10175023
435 Ga0265327_10005425
436 Ga0265327_10005685
437 Ga0265327_10033736
438 Ga0265327_10047868
439 Ga0265327_10290755
440 Ga0265316_10053903
441 Ga0265316_10465375
442 Ga0307509_10357152
443 Ga0265314_10040559
444 Ga0373937_1711465
445 Ga0395899_0268505
446 Ga0451839_1394684
447 Ga0451849_1511745
448 Ga0451577_0023887
449 Ga0451577_0097558
450 Ga0451577_0244957
451 Ga0451577_0314343
452 Ga0451577_0353584
453 Ga0453683_0031903
454 Ga0453683_0087119
455 Ga0453683_0133001
456 Ga0453683_0280959
457 Ga0453683_0469853
458 Ga0453683_0507869
459 Ga0453684_0000086
460 Ga0453684_0000660
461 Ga0453684_0014903
462 Ga0453684_0067661
463 Ga0453684_0074010
464 Ga0453684_0079141
465 Ga0453684_0109272
466 Ga0453684_0123638
467 Ga0453684_0131978
468 Ga0453684_0288566
469 Ga0451576_0036683
470 Ga0451576_2177715
471 Ga0495629_1021902
472 Ga0495585_0460209
473 Ga0495594_0211328
474 Ga0495608_0498466
475 Ga0495628_0736513
476 Ga0495630_0149685
477 Ga0495630_0267923
478 Ga0495652_0416119
479 Ga0495586_0355514
480 Ga0495598_0117419
481 Ga0495657_0357340
482 Ga0495599_0884753
483 Ga0495647_0316559
484 Ga0495670_0435131
485 Ga0495600_0489964
486 Ga0495636_0120049
487 Ga0495615_0045195
488 nmdc:mga09592_861745_c1
489 nmdc:mga08y16_115598_c1
490 nmdc:mga08y16_423096_c1
491 Ga0500578_0706075
492 Ga0500628_179899

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

8

116

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9321 8 129
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9294 8 129
1nxo-assembly1.cif.gz_A-2 micarec ph7.0 0.9172 8 131
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9157 8 129
1nxp-assembly1.cif.gz_A micarec ph4.5 0.9062 8 129
ID Description Score Start End Superfamily
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9189 7 90 3.40.50.2300
1nxoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9172 8 131 3.40.50.2300
af_P08368_2_83_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9142 5 90 3.40.50.2300
af_P71814_19_100_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9095 8 90 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9087 8 90 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7K3XMK5-F1-model_v4 Response regulator 0.9868 1 144 GO:0000160
AF-A0A2N2WDG4-F1-model_v4 Response regulator 0.9825 1 110 GO:0000160
AF-A0A7K3XMK5-F1-model_v4 Response regulator 0.9801 1 144 GO:0000160
AF-A0A3B9ZUA5-F1-model_v4 Response regulator 0.9776 1 144 GO:0000160
AF-A0A2N2WDG4-F1-model_v4 Response regulator 0.9736 1 110 GO:0000160

Map