F357969

General Info

Members Datasets Scaffolds Average Seq Length
246 145 492 190

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_101070360|Ga0070713_1010703601
Length 210
Sequence VLGDLLELALNWFDNKEYNMRKIISFMHMSLDGFVAGPNGEMNWIKVDEEIFDHVGTRISESDTALYGRVTYQMMEGYWPTAGDEPGASKHDIEHSAWYKKAHKVVLSKSMKGKSLPNTTIISDNLSQRINEIKQSGGGKEILLFGSPTATHALIQQNLIDGYWLFVNPIILGQGIPLFADVKEKVSLKLLSSREFNSGVTALDYTVDKQ

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
62 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
94 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
106 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
126 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
137 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
140 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
141 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
142 2818991444 Filimonas endophytica 3197 Isolate Unclassified
143 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
144 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
145 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 0.41
Isolates 1.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.47
Nodule 0
Rhizoplane 0.41
Rhizosphere 90.65
Stem 0
Stem Tuber 0
Unclassified 6.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_101070360 3300005436 Bacteria 779
2 JGI24737J22298_10013795 3300001990 Bacteria 2628
3 JGI25162J39368_1000089 3300002737 Bacteria 104054
4 rootH1_10159507 3300003316 Bacteria 3238
5 rootH2_10206830 3300003320 Bacteria 2255
6 rootH2_10274053 3300003320 Bacteria 1354
7 rootL2_10201272 3300003322 Eukaryota 1065
8 rootH1_10047620 3300003323 Bacteria 10024
9 rootH1_10097085 3300003323 Bacteria 2239
10 Ga0055536_1000009 3300003781 Bacteria 311572
11 Ga0055530_10004774 3300003791 Bacteria 6814
12 Ga0065704_10098444 3300005289 Bacteria 2352
13 Ga0070658_10859650 3300005327 Bacteria 788
14 Ga0068869_100008640 3300005334 Bacteria 6579
15 Ga0068868_100089608 3300005338 Bacteria 2476
16 Ga0070661_100577472 3300005344 Bacteria 907
17 Ga0070668_100796521 3300005347 Bacteria 839
18 Ga0070671_100491925 3300005355 Bacteria 1055
19 Ga0070673_100372442 3300005364 Bacteria 1272
20 Ga0070659_100017476 3300005366 Bacteria 5401
21 Ga0070667_100127174 3300005367 Bacteria 2221
22 Ga0070701_10409936 3300005438 Bacteria 861
23 Ga0070663_100015780 3300005455 Bacteria 4887
24 Ga0070679_100684155 3300005530 Bacteria 968
25 Ga0070684_100024673 3300005535 Bacteria 5045
26 Ga0070684_100233133 3300005535 Bacteria 1681
27 Ga0070684_100320716 3300005535 Bacteria 1423
28 Ga0070684_100451478 3300005535 Bacteria 1188
29 Ga0070684_100650901 3300005535 Bacteria 981
30 Ga0068853_100031724 3300005539 Bacteria 4470
31 Ga0068853_100122103 3300005539 Bacteria 2325
32 Ga0068853_100162338 3300005539 Bacteria 2017
33 Ga0068853_100568895 3300005539 Bacteria 1075
34 Ga0070672_100467418 3300005543 Bacteria 1088
35 Ga0070665_100004698 3300005548 Bacteria 14254
36 Ga0068855_100000922 3300005563 Bacteria 36594
37 Ga0068855_100025392 3300005563 Bacteria 7089
38 Ga0068855_100120567 3300005563 Bacteria 3002
39 Ga0068855_101075740 3300005563 Bacteria 842
40 Ga0070664_100294112 3300005564 Unclassified 1466
41 Ga0068857_100003056 3300005577 Bacteria 13843
42 Ga0068857_100199318 3300005577 Bacteria 1825
43 Ga0068854_100133253 3300005578 Bacteria 1899
44 Ga0068856_100010330 3300005614 Bacteria 9069
45 Ga0068856_100037808 3300005614 Bacteria 4737
46 Ga0068856_100940230 3300005614 Unclassified 883
47 Ga0070702_100063653 3300005615 Bacteria 2155
48 Ga0068852_100109411 3300005616 Bacteria 2509
49 Ga0068852_100373038 3300005616 Bacteria 1398
50 Ga0068852_100552238 3300005616 Bacteria 1152
51 Ga0068852_100805228 3300005616 Bacteria 954
52 Ga0068852_100987342 3300005616 Bacteria 860
53 Ga0068859_100578210 3300005617 Bacteria 1217
54 Ga0068864_100140850 3300005618 Bacteria 2175
55 Ga0068851_10010494 3300005834 Bacteria 4327
56 Ga0068860_100024379 3300005843 Bacteria 5845
57 Ga0068860_100282151 3300005843 Bacteria 1623
58 Ga0075428_100164094 3300006844 Bacteria 2410
59 Ga0075430_100316835 3300006846 Bacteria 1289
60 Ga0075431_100337650 3300006847 Bacteria 1516
61 Ga0097620_100578250 3300006931 Bacteria 1217
62 Ga0105240_10009096 3300009093 Bacteria 14103
63 Ga0105240_10019654 3300009093 Bacteria 9022
64 Ga0105240_10020225 3300009093 Bacteria 8886
65 Ga0105240_10215540 3300009093 Bacteria 2240
66 Ga0105241_10019187 3300009174 Bacteria 5042
67 Ga0105241_10063707 3300009174 Bacteria 2845
68 Ga0105241_10145692 3300009174 Bacteria 1932
69 Ga0105237_10003612 3300009545 Bacteria 18273
70 Ga0105237_10012441 3300009545 Bacteria 8968
71 Ga0105237_10014033 3300009545 Bacteria 8380
72 Ga0105237_10778484 3300009545 Bacteria 963
73 Ga0105238_10008960 3300009551 Bacteria 10014
74 Ga0105239_10000133 3300010375 Bacteria 105033
75 Ga0105239_10000999 3300010375 Bacteria 39639
76 Ga0105239_10002568 3300010375 Bacteria 23031
77 Ga0105239_10097324 3300010375 Bacteria 3252
78 Ga0105239_10237435 3300010375 Bacteria 2046
79 Ga0105239_10261885 3300010375 Bacteria 1944
80 Ga0105239_11179270 3300010375 Bacteria 882
81 Ga0157373_10000075 3300013100 Bacteria 85818
82 Ga0157373_10004108 3300013100 Bacteria 10973
83 Ga0157373_10347782 3300013100 Bacteria 1057
84 Ga0157371_10000382 3300013102 Bacteria 55677
85 Ga0157371_10008724 3300013102 Bacteria 8047
86 Ga0157371_10056730 3300013102 Bacteria 2778
87 Ga0157371_10120579 3300013102 Bacteria 1864
88 Ga0157371_10325618 3300013102 Bacteria 1116
89 Ga0157371_10631190 3300013102 Bacteria 798
90 Ga0157370_10108595 3300013104 Bacteria 2594
91 Ga0157370_10121429 3300013104 Bacteria 2439
92 Ga0157370_10361998 3300013104 Bacteria 1337
93 Ga0157370_10397295 3300013104 Bacteria 1269
94 Ga0157370_10987243 3300013104 Bacteria 763
95 Ga0157369_10011074 3300013105 Bacteria 10260
96 Ga0157369_10025947 3300013105 Bacteria 6502
97 Ga0157369_10083058 3300013105 Bacteria 3427
98 Ga0157374_10645542 3300013296 Bacteria 1070
99 Ga0157374_11060971 3300013296 Bacteria 830
100 Ga0157374_11546278 3300013296 Bacteria 687
101 Ga0157378_10117753 3300013297 Bacteria 2444
102 Ga0157378_11898415 3300013297 Bacteria 645
103 Ga0157372_10000077 3300013307 Bacteria 102192
104 Ga0157372_10000372 3300013307 Bacteria 49527
105 Ga0157372_10001730 3300013307 Bacteria 23671
106 Ga0157372_10015727 3300013307 Bacteria 8114
107 Ga0157372_10026507 3300013307 Bacteria 6307
108 Ga0157372_10054974 3300013307 Bacteria 4444
109 Ga0157372_10114130 3300013307 Bacteria 3097
110 Ga0157372_10151015 3300013307 Bacteria 2681
111 Ga0157372_10648514 3300013307 Bacteria 1230
112 Ga0157372_11318871 3300013307 Unclassified 833
113 Ga0157375_10834982 3300013308 Bacteria 1069
114 Ga0157375_10894388 3300013308 Unclassified 1032
115 Ga0157380_10011412 3300014326 Bacteria 6420
116 Ga0182008_10024976 3300014497 Bacteria 3039
117 Ga0157377_10043745 3300014745 Bacteria 2494
118 Ga0182007_10006251 3300015262 Bacteria 5124
119 Ga0182007_10021076 3300015262 Bacteria 2319
120 Ga0224712_10274839 3300022467 Bacteria 783
121 Ga0209437_100221 3300025233 Bacteria 104135
122 Ga0209026_1001759 3300025250 Bacteria 8977
123 Ga0209233_1000958 3300025261 Bacteria 12490
124 Ga0209676_1000001 3300025292 Bacteria 1852142
125 Ga0209050_1000018 3300025298 Bacteria 723263
126 Ga0207656_10006281 3300025321 Bacteria 4258
127 Ga0207647_10000187 3300025904 Bacteria 50028
128 Ga0207643_10398768 3300025908 Bacteria 869
129 Ga0207705_10472603 3300025909 Bacteria 973
130 Ga0207654_10228794 3300025911 Bacteria 1237
131 Ga0207695_10014954 3300025913 Bacteria 9159
132 Ga0207695_10015688 3300025913 Bacteria 8912
133 Ga0207695_10059147 3300025913 Bacteria 3976
134 Ga0207695_10095592 3300025913 Bacteria 2975
135 Ga0207695_10119088 3300025913 Bacteria 2611
136 Ga0207671_10003975 3300025914 Bacteria 14365
137 Ga0207671_10006564 3300025914 Bacteria 10331
138 Ga0207671_10022633 3300025914 Bacteria 4748
139 Ga0207671_10135673 3300025914 Bacteria 1892
140 Ga0207662_10159959 3300025918 Bacteria 1438
141 Ga0207652_10084944 3300025921 Bacteria 2773
142 Ga0207694_10232544 3300025924 Bacteria 1505
143 Ga0207694_10331233 3300025924 Bacteria 1258
144 Ga0207700_10813863 3300025928 Bacteria 836
145 Ga0207644_10042932 3300025931 Bacteria 3207
146 Ga0207690_10004026 3300025932 Bacteria 8679
147 Ga0207706_10669965 3300025933 Unclassified 888
148 Ga0207661_10260981 3300025944 Unclassified 1543
149 Ga0207679_10344099 3300025945 Unclassified 1298
150 Ga0207667_10001324 3300025949 Bacteria 31105
151 Ga0207667_10083177 3300025949 Bacteria 3314
152 Ga0207667_10437302 3300025949 Bacteria 1330
153 Ga0207651_10227739 3300025960 Bacteria 1511
154 Ga0207712_11446025 3300025961 Bacteria 615
155 Ga0207640_10542166 3300025981 Bacteria 976
156 Ga0207677_10604369 3300026023 Bacteria 963
157 Ga0207639_10141473 3300026041 Bacteria 2005
158 Ga0207639_10322753 3300026041 Bacteria 1371
159 Ga0207639_10697289 3300026041 Bacteria 942
160 Ga0207702_10029401 3300026078 Bacteria 4571
161 Ga0207702_10030518 3300026078 Unclassified 4492
162 Ga0207676_10195197 3300026095 Unclassified 1785
163 Ga0207676_10998547 3300026095 Unclassified 824
164 Ga0207674_10408161 3300026116 Bacteria 1313
165 Ga0207698_10055371 3300026142 Bacteria 3057
166 Ga0207698_10389454 3300026142 Bacteria 1328
167 Ga0207698_10507806 3300026142 Bacteria 1174
168 Ga0207698_10613656 3300026142 Unclassified 1074
169 Ga0207698_11211152 3300026142 Bacteria 769
170 Ga0268264_10017995 3300028381 Bacteria 5779
171 Ga0307515_10124492 3300028794 Bacteria 2892
172 Ga0265324_10024851 3300029957 Bacteria 2126
173 Ga0265332_10051908 3300031238 Bacteria 1761
174 Ga0265327_10000010 3300031251 Bacteria 566817
175 Ga0265327_10000351 3300031251 Bacteria 87732
176 Ga0265327_10100514 3300031251 Bacteria 1396
177 Ga0307408_100000655 3300031548 Bacteria 29072
178 Ga0307413_10307660 3300031824 Bacteria 1205
179 Ga0307412_10794805 3300031911 Bacteria 821
180 Ga0307414_10156371 3300032004 Bacteria 1805
181 Ga0307414_10918606 3300032004 Bacteria 803
182 Ga0395899_0000002 3300037312 Bacteria 1324310
183 Ga0395899_0000257 3300037312 Bacteria 69779
184 Ga0395899_0020548 3300037312 Bacteria 5005
185 Ga0395899_0630383 3300037312 Unclassified 680
186 Ga0395900_0004002 3300037418 Bacteria 15738
187 Ga0395900_0089500 3300037418 Unclassified 3164
188 Ga0395900_0363276 3300037418 Bacteria 1419
189 Ga0395898_0007899 3300037466 Bacteria 11290
190 Ga0395898_0443733 3300037466 Bacteria 1236
191 Ga0395905_0004747 3300037471 Bacteria 14042
192 Ga0395905_0505127 3300037471 Bacteria 1109
193 Ga0395901_0008324 3300038443 Bacteria 10481
194 Ga0395901_0040795 3300038443 Unclassified 4808
195 Ga0395901_0278095 3300038443 Bacteria 1740
196 Ga0451802_1092479 3300041460 Bacteria 531
197 Ga0451837_0714656 3300041494 Bacteria 604
198 Ga0451577_0147791 3300042876 Bacteria 2114
199 Ga0466969_0104283 3300044656 Bacteria 1332
200 Ga0453683_0000005 3300044673 Bacteria 741657
201 Ga0453683_0020996 3300044673 Bacteria 4170
202 Ga0453683_0690976 3300044673 Unclassified 668
203 Ga0466966_0004915 3300044684 Bacteria 8788
204 Ga0466961_0055482 3300044693 Bacteria 2526
205 Ga0466961_0215511 3300044693 Bacteria 1184
206 Ga0453684_1576478 3300044712 Unclassified 675
207 Ga0453684_1744627 3300044712 Bacteria 635
208 Ga0466959_0025420 3300045049 Bacteria 4389
209 Ga0466959_0145698 3300045049 Bacteria 1671
210 Ga0451576_1324255 3300045051 Bacteria 751
211 Ga0466958_0065502 3300045836 Bacteria 2217
212 Ga0466967_1016400 3300045976 Bacteria 826
213 Ga0495592_0398345 3300046454 Bacteria 872
214 Ga0495594_0271361 3300046499 Bacteria 966
215 Ga0495640_0263892 3300046533 Bacteria 1075
216 Ga0495586_0249897 3300046535 Bacteria 1011
217 Ga0495645_0481607 3300046543 Bacteria 778
218 Ga0495634_0046294 3300046642 Bacteria 2937
219 Ga0495600_0346157 3300046809 Bacteria 932
220 Ga0495674_0270233 3300047319 Bacteria 1395
221 Ga0495672_0266516 3300047320 Bacteria 824
222 Ga0495687_002357 3300047443 Bacteria 15314
223 Ga0495684_0311070 3300047471 Bacteria 1129
224 Ga0495684_0360031 3300047471 Bacteria 1031
225 Ga0495686_0524871 3300047472 Bacteria 621
226 Ga0501033_0325118 3300049570 Bacteria 1080
227 Ga0501033_0478069 3300049570 Bacteria 863
228 Ga0501034_0000152 3300049571 Bacteria 130576
229 Ga0501034_0012790 3300049571 Bacteria 8657
230 Ga0501034_0214923 3300049571 Bacteria 1877
231 Ga0501034_1081682 3300049571 Bacteria 683
232 Ga0501038_0105879 3300049574 Bacteria 2335
233 Ga0501043_0991810 3300049579 Bacteria 598
234 Ga0501269_007891 3300049766 Bacteria 1287
235 Ga0501035_0108820 3300049822 Bacteria 2429
236 Ga0501044_0311091 3300049823 Bacteria 1502
237 nmdc:mga07m45_135894_c1 3300050496 Bacteria 1423
238 nmdc:mga0qj67_415608_c1 3300050509 Bacteria 1085
239 nmdc:mga06r32_1081236_c1 3300050510 Bacteria 752
240 Ga0500618_000002 3300053125 Bacteria 370822
241 Ga0500568_0017183 3300053139 Bacteria 3200
242 Ga0500661_017750 3300055283 Bacteria 1270
243 2819590065 2818991444 Bacteria 6968812
244 2852628443 2852627209 Bacteria 5896285
245 2896113885 2896109856 Bacteria 7140722
246 2929158070 2929154850 Bacteria 6753285
247 Ga0070713_101070360
248 JGI24737J22298_10013795
249 JGI25162J39368_1000089
250 rootH1_10159507
251 rootH2_10206830
252 rootH2_10274053
253 rootL2_10201272
254 rootH1_10047620
255 rootH1_10097085
256 Ga0055536_1000009
257 Ga0055530_10004774
258 Ga0065704_10098444
259 Ga0070658_10859650
260 Ga0068869_100008640
261 Ga0068868_100089608
262 Ga0070661_100577472
263 Ga0070668_100796521
264 Ga0070671_100491925
265 Ga0070673_100372442
266 Ga0070659_100017476
267 Ga0070667_100127174
268 Ga0070701_10409936
269 Ga0070663_100015780
270 Ga0070679_100684155
271 Ga0070684_100024673
272 Ga0070684_100233133
273 Ga0070684_100320716
274 Ga0070684_100451478
275 Ga0070684_100650901
276 Ga0068853_100031724
277 Ga0068853_100122103
278 Ga0068853_100162338
279 Ga0068853_100568895
280 Ga0070672_100467418
281 Ga0070665_100004698
282 Ga0068855_100000922
283 Ga0068855_100025392
284 Ga0068855_100120567
285 Ga0068855_101075740
286 Ga0070664_100294112
287 Ga0068857_100003056
288 Ga0068857_100199318
289 Ga0068854_100133253
290 Ga0068856_100010330
291 Ga0068856_100037808
292 Ga0068856_100940230
293 Ga0070702_100063653
294 Ga0068852_100109411
295 Ga0068852_100373038
296 Ga0068852_100552238
297 Ga0068852_100805228
298 Ga0068852_100987342
299 Ga0068859_100578210
300 Ga0068864_100140850
301 Ga0068851_10010494
302 Ga0068860_100024379
303 Ga0068860_100282151
304 Ga0075428_100164094
305 Ga0075430_100316835
306 Ga0075431_100337650
307 Ga0097620_100578250
308 Ga0105240_10009096
309 Ga0105240_10019654
310 Ga0105240_10020225
311 Ga0105240_10215540
312 Ga0105241_10019187
313 Ga0105241_10063707
314 Ga0105241_10145692
315 Ga0105237_10003612
316 Ga0105237_10012441
317 Ga0105237_10014033
318 Ga0105237_10778484
319 Ga0105238_10008960
320 Ga0105239_10000133
321 Ga0105239_10000999
322 Ga0105239_10002568
323 Ga0105239_10097324
324 Ga0105239_10237435
325 Ga0105239_10261885
326 Ga0105239_11179270
327 Ga0157373_10000075
328 Ga0157373_10004108
329 Ga0157373_10347782
330 Ga0157371_10000382
331 Ga0157371_10008724
332 Ga0157371_10056730
333 Ga0157371_10120579
334 Ga0157371_10325618
335 Ga0157371_10631190
336 Ga0157370_10108595
337 Ga0157370_10121429
338 Ga0157370_10361998
339 Ga0157370_10397295
340 Ga0157370_10987243
341 Ga0157369_10011074
342 Ga0157369_10025947
343 Ga0157369_10083058
344 Ga0157374_10645542
345 Ga0157374_11060971
346 Ga0157374_11546278
347 Ga0157378_10117753
348 Ga0157378_11898415
349 Ga0157372_10000077
350 Ga0157372_10000372
351 Ga0157372_10001730
352 Ga0157372_10015727
353 Ga0157372_10026507
354 Ga0157372_10054974
355 Ga0157372_10114130
356 Ga0157372_10151015
357 Ga0157372_10648514
358 Ga0157372_11318871
359 Ga0157375_10834982
360 Ga0157375_10894388
361 Ga0157380_10011412
362 Ga0182008_10024976
363 Ga0157377_10043745
364 Ga0182007_10006251
365 Ga0182007_10021076
366 Ga0224712_10274839
367 Ga0209437_100221
368 Ga0209026_1001759
369 Ga0209233_1000958
370 Ga0209676_1000001
371 Ga0209050_1000018
372 Ga0207656_10006281
373 Ga0207647_10000187
374 Ga0207643_10398768
375 Ga0207705_10472603
376 Ga0207654_10228794
377 Ga0207695_10014954
378 Ga0207695_10015688
379 Ga0207695_10059147
380 Ga0207695_10095592
381 Ga0207695_10119088
382 Ga0207671_10003975
383 Ga0207671_10006564
384 Ga0207671_10022633
385 Ga0207671_10135673
386 Ga0207662_10159959
387 Ga0207652_10084944
388 Ga0207694_10232544
389 Ga0207694_10331233
390 Ga0207700_10813863
391 Ga0207644_10042932
392 Ga0207690_10004026
393 Ga0207706_10669965
394 Ga0207661_10260981
395 Ga0207679_10344099
396 Ga0207667_10001324
397 Ga0207667_10083177
398 Ga0207667_10437302
399 Ga0207651_10227739
400 Ga0207712_11446025
401 Ga0207640_10542166
402 Ga0207677_10604369
403 Ga0207639_10141473
404 Ga0207639_10322753
405 Ga0207639_10697289
406 Ga0207702_10029401
407 Ga0207702_10030518
408 Ga0207676_10195197
409 Ga0207676_10998547
410 Ga0207674_10408161
411 Ga0207698_10055371
412 Ga0207698_10389454
413 Ga0207698_10507806
414 Ga0207698_10613656
415 Ga0207698_11211152
416 Ga0268264_10017995
417 Ga0307515_10124492
418 Ga0265324_10024851
419 Ga0265332_10051908
420 Ga0265327_10000010
421 Ga0265327_10000351
422 Ga0265327_10100514
423 Ga0307408_100000655
424 Ga0307413_10307660
425 Ga0307412_10794805
426 Ga0307414_10156371
427 Ga0307414_10918606
428 Ga0395899_0000002
429 Ga0395899_0000257
430 Ga0395899_0020548
431 Ga0395899_0630383
432 Ga0395900_0004002
433 Ga0395900_0089500
434 Ga0395900_0363276
435 Ga0395898_0007899
436 Ga0395898_0443733
437 Ga0395905_0004747
438 Ga0395905_0505127
439 Ga0395901_0008324
440 Ga0395901_0040795
441 Ga0395901_0278095
442 Ga0451802_1092479
443 Ga0451837_0714656
444 Ga0451577_0147791
445 Ga0466969_0104283
446 Ga0453683_0000005
447 Ga0453683_0020996
448 Ga0453683_0690976
449 Ga0466966_0004915
450 Ga0466961_0055482
451 Ga0466961_0215511
452 Ga0453684_1576478
453 Ga0453684_1744627
454 Ga0466959_0025420
455 Ga0466959_0145698
456 Ga0451576_1324255
457 Ga0466958_0065502
458 Ga0466967_1016400
459 Ga0495592_0398345
460 Ga0495594_0271361
461 Ga0495640_0263892
462 Ga0495586_0249897
463 Ga0495645_0481607
464 Ga0495634_0046294
465 Ga0495600_0346157
466 Ga0495674_0270233
467 Ga0495672_0266516
468 Ga0495687_002357
469 Ga0495684_0311070
470 Ga0495684_0360031
471 Ga0495686_0524871
472 Ga0501033_0325118
473 Ga0501033_0478069
474 Ga0501034_0000152
475 Ga0501034_0012790
476 Ga0501034_0214923
477 Ga0501034_1081682
478 Ga0501038_0105879
479 Ga0501043_0991810
480 Ga0501269_007891
481 Ga0501035_0108820
482 Ga0501044_0311091
483 nmdc:mga07m45_135894_c1
484 nmdc:mga0qj67_415608_c1
485 nmdc:mga06r32_1081236_c1
486 Ga0500618_000002
487 Ga0500568_0017183
488 Ga0500661_017750
489 2819590065
490 2852628443
491 2896113885
492 2929158070

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

21

202

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.9041 2 188
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8591 2 188
2gd9-assembly1.cif.gz_A crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8562 2 186
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8175 1 188
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8131 1 188
ID Description Score Start End Superfamily
af_Q59P53_422_536_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9046 168 187 3.30.70.240
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9008 3 184 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8845 3 184 3.40.430.10
af_P24719_156_494_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.8808 168 186 1.10.510.10
af_Q54JK7_720_839_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.871 168 187 3.30.70.240
ID Description Score Start End GO Terms
AF-A0A173MEU7-F1-model_v4 Dihydrofolate reductase 0.9906 1 190 GO:0008703
GO:0009231
AF-A0A173MEU7-F1-model_v4 Dihydrofolate reductase 0.9854 1 190 GO:0008703
GO:0009231
AF-A0A4Q3F100-F1-model_v4 Dihydrofolate reductase 0.9848 1 189 GO:0008703
GO:0009231
AF-A0A1M7LC87-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9823 1 190 GO:0008703
GO:0009231
AF-A0A4Q3F100-F1-model_v4 Dihydrofolate reductase 0.9797 1 189 GO:0008703
GO:0009231

Map