F357770

General Info

Members Datasets Scaffolds Average Seq Length
245 189 490 219

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2511231119|2511699903
Length 227
Sequence IAERESIARRAASEITSGMIVNLGIGIPSLVPNFLPAGMEVMLQAENGVLGIGGSPERGEEDELLCNAAGFPVSTVKGASYFDSALSFAMIRKGLIDITILGALQVSRTGDLANWLVPGKKVPGMGGAMELAQGAKKVVVVMSHTDQKGRPKLVESCSLPLTAAGCADLIITEKAVISIDDGAFVLEELLNGTTIDDVIQTTDAEIRLGECFLKRGSVHGSIRKESH

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
16 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
17 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
18 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
19 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
20 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
21 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
22 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
23 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
24 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
26 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
27 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
35 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
36 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
37 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
38 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
39 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
40 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
41 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
42 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
43 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
44 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
45 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
46 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
47 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
48 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
49 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
50 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
51 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
52 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
53 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
54 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
55 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
56 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
57 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
58 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
59 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
60 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
61 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
62 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
63 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
64 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
65 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
66 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
67 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
68 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
69 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
70 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
71 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
72 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
73 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
74 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
75 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
76 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
77 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
78 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
79 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
80 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
81 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
82 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
83 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
84 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
85 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
86 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
87 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
88 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
89 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
90 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
93 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
94 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
95 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
96 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
97 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
98 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
99 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
100 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
101 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
102 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
103 2643221729 Bacillus sp. Root11 Isolate Unclassified
104 2643221730 Bacillus sp. Root131 Isolate Unclassified
105 2643221731 Bacillus sp. Root147 Isolate Unclassified
106 2643221732 Bacillus sp. Root239 Isolate Unclassified
107 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
108 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
109 2671180694 Paenibacillus sp. A3 Isolate Unclassified
110 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
111 2684622632 Bacillus cereus 905 Isolate Unclassified
112 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
113 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
114 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
115 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
116 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
117 2738541295 Bacillus sp. OK085 Isolate Unclassified
118 2738541358 Bacillus sp. OV752 Isolate Unclassified
119 2738543006 Bacillus sp. OK077 Isolate Unclassified
120 2738543010 Bacillus sp. YR335 Isolate Unclassified
121 2738543017 Bacillus sp. OV186 Isolate Unclassified
122 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
123 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
124 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
125 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
126 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
127 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
128 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
129 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
130 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
131 2842682962 Bacillus sp. R-72492 Isolate Unclassified
132 2842882022 Bacillus sp. R-71893 Isolate Unclassified
133 2849139964 Bacillus sp. R-71875 Isolate Unclassified
134 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
135 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
136 2857581216 Bacillus sp. R-71922 Isolate Unclassified
137 2857586860 Bacillus sp. R-71935 Isolate Unclassified
138 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
139 2860837431 Bacillus sp. WR11 Isolate Unclassified
140 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
141 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
142 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
143 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
144 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
145 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
146 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
147 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
148 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
149 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
150 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
151 2919720352 Priestia megaterium 4340 Isolate Unclassified
152 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
153 2929004312 Priestia megaterium 1104 Isolate Unclassified
154 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
155 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
156 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
157 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
158 2938917290 Bacillus sp. CR71 Isolate Unclassified
159 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
160 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
161 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
162 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
163 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
164 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
165 2969141011 Bacillus velezensis MH25 Isolate Unclassified
166 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
167 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
168 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
169 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
170 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
171 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
172 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
173 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
174 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
175 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
176 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
177 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
178 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
179 8022653035 Bacillus sp. Rc4 Isolate Unclassified
180 8022792930 Bacillus sp. Xin Isolate Rhizosphere
181 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
182 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
183 8023438354 Bacillus sp. BH2 Isolate Unclassified
184 8023444577 Bacillus sp. BH32 Isolate Unclassified
185 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
186 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
187 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
188 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
189 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 57.14
Metatranscriptomes 0.41
Isolates 42.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.88
Nodule 0.41
Rhizoplane 11.43
Rhizosphere 45.31
Stem 0
Stem Tuber 0
Unclassified 0.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10004010 3300003187 Bacteria 7911
2 JGI25151J46595_10007081 3300003187 Bacteria 5537
3 JGI25151J46595_10010837 3300003187 Bacteria 4218
4 JGI25151J46595_10013591 3300003187 Bacteria 3659
5 JGI25151J46595_10014273 3300003187 Bacteria 3543
6 JGI25151J46595_10021841 3300003187 Bacteria 2669
7 JGI25151J46595_10042858 3300003187 Bacteria 1626
8 JGI25151J46595_10043416 3300003187 Bacteria 1609
9 rootH1_10024989 3300003316 Bacteria 22659
10 rootH2_10318506 3300003320 Bacteria 1345
11 rootL2_10010989 3300003322 Bacteria 22901
12 Ga0006562J51391_1005497 3300003578 Bacteria 10860
13 Ga0055532_1000428 3300003758 Bacteria 20089
14 Ga0055532_1009250 3300003758 Bacteria 1203
15 Ga0055536_1003439 3300003781 Bacteria 8492
16 Ga0055536_1004284 3300003781 Bacteria 7353
17 Ga0055528_1001578 3300003790 Bacteria 13575
18 Ga0070680_100361967 3300005336 Bacteria 1234
19 Ga0070671_100091794 3300005355 Bacteria 2544
20 Ga0070709_10005449 3300005434 Bacteria 6891
21 Ga0070710_10000130 3300005437 Bacteria 34963
22 Ga0070707_100000161 3300005468 Bacteria 63936
23 Ga0070672_100430509 3300005543 Bacteria 1134
24 Ga0105244_10019258 3300009036 Bacteria 3816
25 Ga0105244_10023415 3300009036 Bacteria 3386
26 Ga0105250_10002663 3300009092 Bacteria 8854
27 Ga0105250_10009805 3300009092 Bacteria 4022
28 Ga0105245_10278093 3300009098 Bacteria 1635
29 Ga0105243_10173373 3300009148 Bacteria 1870
30 Ga0105242_10492068 3300009176 Bacteria 1165
31 Ga0105246_10249561 3300011119 Bacteria 1408
32 Ga0209147_100014 3300025229 Bacteria 597841
33 Ga0209147_100068 3300025229 Bacteria 230150
34 Ga0209147_100218 3300025229 Bacteria 59672
35 Ga0209147_105006 3300025229 Bacteria 2067
36 Ga0209673_1009527 3300025273 Bacteria 4191
37 Ga0209130_1000657 3300025284 Bacteria 31685
38 Ga0209676_1000315 3300025292 Bacteria 94699
39 Ga0209676_1001082 3300025292 Bacteria 30762
40 Ga0209025_1000041 3300025294 Bacteria 373694
41 Ga0209025_1001356 3300025294 Bacteria 32891
42 Ga0209025_1001690 3300025294 Bacteria 26947
43 Ga0209025_1002446 3300025294 Bacteria 19658
44 Ga0209025_1002493 3300025294 Bacteria 19366
45 Ga0209025_1003848 3300025294 Bacteria 13635
46 Ga0209025_1006445 3300025294 Bacteria 9102
47 Ga0209025_1006486 3300025294 Bacteria 9056
48 Ga0209025_1006561 3300025294 Bacteria 8973
49 Ga0209025_1009423 3300025294 Bacteria 6804
50 Ga0209025_1018644 3300025294 Bacteria 3914
51 Ga0209025_1039392 3300025294 Bacteria 2061
52 Ga0207426_1009643 3300025302 Bacteria 3802
53 Ga0207696_1009487 3300025711 Bacteria 3627
54 Ga0207655_1067580 3300025728 Bacteria 1345
55 Ga0207655_1119517 3300025728 Bacteria 876
56 Ga0207692_10000053 3300025898 Bacteria 34210
57 Ga0207660_10310135 3300025917 Bacteria 1258
58 Ga0207687_10125147 3300025927 Bacteria 1928
59 Ga0207644_10459809 3300025931 Bacteria 1046
60 Ga0207691_10420699 3300025940 Bacteria 1139
61 Ga0265334_10005728 3300028573 Bacteria 5417
62 Ga0265338_10051387 3300028800 Bacteria 3711
63 Ga0265338_10097095 3300028800 Bacteria 2415
64 Ga0237817_10011 3300030083 Bacteria 77632
65 Ga0265320_10088329 3300031240 Bacteria 1438
66 Ga0307408_100021193 3300031548 Bacteria 4395
67 Ga0307408_100050401 3300031548 Bacteria 2994
68 Ga0307408_100428966 3300031548 Bacteria 1142
69 Ga0307409_100505596 3300031995 Bacteria 1178
70 Ga0307416_100062516 3300032002 Bacteria 3045
71 Ga0373934_0003401 3300035086 Bacteria 5832
72 Ga0373933_0000116 3300035724 Bacteria 51474
73 Ga0373937_0000001 3300036401 Bacteria 478903
74 Ga0395898_0107419 3300037466 Bacteria 2677
75 Ga0395898_0239974 3300037466 Bacteria 1729
76 Ga0237819_00510 3300038705 Bacteria 13077
77 Ga0451577_0040942 3300042876 Bacteria 4160
78 Ga0451577_0068604 3300042876 Unclassified 3162
79 Ga0466972_0000609 3300044658 Bacteria 17503
80 Ga0466965_0059727 3300044683 Bacteria 1903
81 Ga0453684_0005629 3300044712 Bacteria 24626
82 Ga0466968_0046646 3300044735 Bacteria 1841
83 Ga0451576_0002248 3300045051 Bacteria 29543
84 Ga0451576_0015876 3300045051 Bacteria 8329
85 Ga0451576_0138597 3300045051 Bacteria 2537
86 Ga0451576_0174594 3300045051 Bacteria 2243
87 Ga0495651_0053338 3300046462 Bacteria 3113
88 Ga0495584_0071469 3300046491 Bacteria 1744
89 Ga0495637_0087581 3300046520 Bacteria 1233
90 Ga0495652_0011982 3300046529 Bacteria 7837
91 Ga0495587_0000087 3300046536 Bacteria 71152
92 Ga0495609_0089062 3300046538 Bacteria 1343
93 Ga0495622_0192957 3300046557 Bacteria 910
94 Ga0495633_0027457 3300046558 Bacteria 2783
95 Ga0495667_0311889 3300046559 Bacteria 996
96 Ga0495661_0319343 3300046665 Bacteria 772
97 Ga0495624_0028776 3300046690 Bacteria 3628
98 Ga0495660_0081678 3300046810 Bacteria 1694
99 Ga0495604_0193760 3300047317 Bacteria 1414
100 Ga0495676_0184916 3300047321 Bacteria 1458
101 Ga0495683_0137765 3300047323 Bacteria 1146
102 Ga0495675_0000227 3300047444 Bacteria 40596
103 Ga0495602_0000086 3300048088 Bacteria 90226
104 Ga0496100_0000170 3300048903 Bacteria 36100
105 Ga0496101_0191716 3300048904 Bacteria 1577
106 Ga0496102_0010406 3300048905 Bacteria 8004
107 Ga0496102_0028727 3300048905 Bacteria 4971
108 Ga0496103_0013769 3300048906 Bacteria 4801
109 Ga0496103_0026699 3300048906 Bacteria 3495
110 Ga0496104_0001257 3300048907 Bacteria 21868
111 Ga0496105_0029831 3300048908 Bacteria 4465
112 Ga0496106_0000652 3300048909 Bacteria 24820
113 Ga0496107_0000135 3300048910 Bacteria 36318
114 Ga0496107_0261899 3300048910 Bacteria 1287
115 Ga0496108_0010776 3300048911 Bacteria 7420
116 Ga0496109_0000924 3300048912 Bacteria 24441
117 Ga0496109_0478784 3300048912 Bacteria 1175
118 Ga0496110_0002511 3300048913 Bacteria 13780
119 Ga0496110_0006251 3300048913 Bacteria 9394
120 Ga0496110_0006925 3300048913 Bacteria 9016
121 Ga0496110_1121354 3300048913 Bacteria 695
122 Ga0496110_1181830 3300048913 Bacteria 674
123 Ga0496111_0012650 3300048914 Bacteria 5719
124 Ga0496111_0028889 3300048914 Bacteria 3932
125 Ga0496111_0046508 3300048914 Bacteria 3125
126 Ga0496112_0002872 3300048915 Bacteria 14004
127 Ga0496112_0057287 3300048915 Bacteria 3836
128 Ga0496112_0327531 3300048915 Bacteria 1476
129 Ga0496113_0001084 3300048916 Bacteria 14756
130 Ga0496113_0305118 3300048916 Bacteria 1275
131 Ga0496118_0026289 3300048921 Bacteria 4963
132 Ga0496119_0001957 3300048922 Bacteria 23421
133 Ga0496120_0019145 3300048923 Bacteria 4388
134 Ga0496122_0002947 3300048925 Bacteria 23203
135 Ga0496123_0037586 3300048926 Bacteria 3417
136 Ga0496125_0055755 3300048928 Bacteria 3216
137 Ga0496126_0009131 3300048929 Bacteria 10581
138 Ga0501034_0176511 3300049571 Bacteria 2102
139 Ga0501043_0173755 3300049579 Bacteria 1680
140 Ga0501035_0068641 3300049822 Bacteria 3143
141 nmdc:mga08y16_443924_c1 3300050511 Unclassified 1324
142 2511699903 2511231119 Bacteria 4019861
143 2511179643 2510917027 Bacteria 5287437
144 2512638981 2512564013 Bacteria 6286191
145 2540607092 2540341094 Bacteria 4061186
146 2545559323 2545555800 Bacteria 4222588
147 2553395465 2551306519 Bacteria 5465154
148 2578930276 2576861599 Bacteria 4217202
149 2595087572 2593339131 Bacteria 5116855
150 2631983693 2630968484 Bacteria 3876276
151 2644704701 2643221729 Bacteria 6621700
152 2644709395 2643221730 Bacteria 6523787
153 2644716277 2643221731 Bacteria 5623886
154 2644723850 2643221732 Bacteria 5756404
155 2651533284 2648501850 Bacteria 3975476
156 2672336506 2671180330 Bacteria 5521719
157 2672337657 2671180330 Bacteria 5521719
158 2673817249 2671180694 Bacteria 7506943
159 2674419289 2671180844 Bacteria 4164150
160 2685150196 2684622632 Bacteria 5380049
161 2695627819 2695420354 Bacteria 3922431
162 2698323067 2695420987 Bacteria 6152737
163 2705994160 2703719227 Bacteria 5631989
164 2717916391 2716884898 Bacteria 3928789
165 2721505493 2718218445 Bacteria 5113413
166 2738814122 2738541295 Bacteria 5730091
167 2739158002 2738541358 Bacteria 5932299
168 2739210552 2738543006 Bacteria 5904091
169 2739231716 2738543010 Bacteria 5583595
170 2739270219 2738543017 Bacteria 4271950
171 2739271211 2738543017 Bacteria 4271950
172 2757565559 2757320391 Bacteria 4746095
173 2777761535 2775507177 Bacteria 4384303
174 2777839049 2775507192 Bacteria 4622234
175 2809056746 2808606399 Bacteria 4021018
176 2816861956 2816332186 Bacteria 5331395
177 2816863029 2816332186 Bacteria 5331395
178 2817480390 2816332295 Bacteria 4352468
179 2817617802 2816332336 Bacteria 5207640
180 2819578725 2818991443 Bacteria 6598732
181 2819709745 2818991465 Bacteria 5388835
182 2842683078 2842682962 Bacteria 5589973
183 2842686768 2842682962 Bacteria 5589973
184 2842883993 2842882022 Bacteria 6158489
185 2849141717 2849139964 Bacteria 5613304
186 2849143938 2849139964 Bacteria 5613304
187 2857462120 2857460504 Bacteria 5194327
188 2857470038 2857465823 Bacteria 6772595
189 2857582777 2857581216 Bacteria 5522813
190 2857583829 2857581216 Bacteria 5522813
191 2857590182 2857586860 Bacteria 4354574
192 2857591416 2857591370 Bacteria 6569758
193 2857597096 2857591370 Bacteria 6569758
194 2860839579 2860837431 Bacteria 4202080
195 2877770716 2877768649 Bacteria 3957164
196 2880171649 2880169592 Bacteria 3900066
197 2881645597 2881644220 Bacteria 5302661
198 2881646367 2881644220 Bacteria 5302661
199 2897111679 2897109615 Bacteria 4009619
200 2904524977 2904524088 Bacteria 5887454
201 2904563546 2904560550 Bacteria 4029838
202 2915600713 2915597211 Bacteria 6475886
203 2915606866 2915606848 Bacteria 6032732
204 2919146435 2919143609 Bacteria 6219228
205 2919414872 2919414237 Bacteria 5429133
206 2919518350 2919517244 Bacteria 5858162
207 2919722709 2919720352 Bacteria 5986006
208 2928096728 2928093941 Bacteria 5965005
209 2929005866 2929004312 Bacteria 5678476
210 2929185850 2929183550 Bacteria 6377511
211 2929235401 2929233124 Bacteria 5948380
212 2936341410 2936340661 Bacteria 5139038
213 2936367060 2936361878 Bacteria 5632809
214 2938919578 2938917290 Bacteria 5914775
215 2947428948 2947426588 Bacteria 5357194
216 2956900496 2956897341 Bacteria 5447711
217 2960320337 2960319331 Bacteria 5502575
218 2960379600 2960375949 Bacteria 5361395
219 2962293038 2962290636 Bacteria 4072939
220 2969138959 2969136845 Bacteria 3923176
221 2969143173 2969141011 Bacteria 4118468
222 2969767015 2969765954 Bacteria 4216713
223 2969774518 2969770375 Bacteria 4271280
224 2971895433 2971893375 Bacteria 3929648
225 2977256950 2977254563 Bacteria 4828420
226 2980494784 2980492589 Bacteria 4072961
227 2990277833 2990275345 Bacteria 4887158
228 3001898137 3001892409 Bacteria 6328293
229 3006828035 3006826541 Bacteria 4678913
230 3006860735 3006858327 Bacteria 4317835
231 3006881255 3006879489 Bacteria 4064221
232 3006981409 3006978542 Bacteria 5328100
233 8022625599 8022621104 Bacteria 5241040
234 8022633476 8022630665 Bacteria 3886130
235 8022657279 8022653035 Bacteria 4035078
236 8022795153 8022792930 Bacteria 5693794
237 8022895374 8022893055 Bacteria 5300455
238 8022916843 8022914991 Bacteria 5584517
239 8023444041 8023438354 Bacteria 5779374
240 8023449777 8023444577 Bacteria 5661597
241 8051955615 8051952484 Bacteria 3926774
242 8052176656 8052174270 Bacteria 3881265
243 8054281598 8054280661 Bacteria 4232245
244 8057584978 8057582654 Bacteria 5218944
245 8057635034 8057632132 Bacteria 4726859
246 JGI25151J46595_10004010
247 JGI25151J46595_10007081
248 JGI25151J46595_10010837
249 JGI25151J46595_10013591
250 JGI25151J46595_10014273
251 JGI25151J46595_10021841
252 JGI25151J46595_10042858
253 JGI25151J46595_10043416
254 rootH1_10024989
255 rootH2_10318506
256 rootL2_10010989
257 Ga0006562J51391_1005497
258 Ga0055532_1000428
259 Ga0055532_1009250
260 Ga0055536_1003439
261 Ga0055536_1004284
262 Ga0055528_1001578
263 Ga0070680_100361967
264 Ga0070671_100091794
265 Ga0070709_10005449
266 Ga0070710_10000130
267 Ga0070707_100000161
268 Ga0070672_100430509
269 Ga0105244_10019258
270 Ga0105244_10023415
271 Ga0105250_10002663
272 Ga0105250_10009805
273 Ga0105245_10278093
274 Ga0105243_10173373
275 Ga0105242_10492068
276 Ga0105246_10249561
277 Ga0209147_100014
278 Ga0209147_100068
279 Ga0209147_100218
280 Ga0209147_105006
281 Ga0209673_1009527
282 Ga0209130_1000657
283 Ga0209676_1000315
284 Ga0209676_1001082
285 Ga0209025_1000041
286 Ga0209025_1001356
287 Ga0209025_1001690
288 Ga0209025_1002446
289 Ga0209025_1002493
290 Ga0209025_1003848
291 Ga0209025_1006445
292 Ga0209025_1006486
293 Ga0209025_1006561
294 Ga0209025_1009423
295 Ga0209025_1018644
296 Ga0209025_1039392
297 Ga0207426_1009643
298 Ga0207696_1009487
299 Ga0207655_1067580
300 Ga0207655_1119517
301 Ga0207692_10000053
302 Ga0207660_10310135
303 Ga0207687_10125147
304 Ga0207644_10459809
305 Ga0207691_10420699
306 Ga0265334_10005728
307 Ga0265338_10051387
308 Ga0265338_10097095
309 Ga0237817_10011
310 Ga0265320_10088329
311 Ga0307408_100021193
312 Ga0307408_100050401
313 Ga0307408_100428966
314 Ga0307409_100505596
315 Ga0307416_100062516
316 Ga0373934_0003401
317 Ga0373933_0000116
318 Ga0373937_0000001
319 Ga0395898_0107419
320 Ga0395898_0239974
321 Ga0237819_00510
322 Ga0451577_0040942
323 Ga0451577_0068604
324 Ga0466972_0000609
325 Ga0466965_0059727
326 Ga0453684_0005629
327 Ga0466968_0046646
328 Ga0451576_0002248
329 Ga0451576_0015876
330 Ga0451576_0138597
331 Ga0451576_0174594
332 Ga0495651_0053338
333 Ga0495584_0071469
334 Ga0495637_0087581
335 Ga0495652_0011982
336 Ga0495587_0000087
337 Ga0495609_0089062
338 Ga0495622_0192957
339 Ga0495633_0027457
340 Ga0495667_0311889
341 Ga0495661_0319343
342 Ga0495624_0028776
343 Ga0495660_0081678
344 Ga0495604_0193760
345 Ga0495676_0184916
346 Ga0495683_0137765
347 Ga0495675_0000227
348 Ga0495602_0000086
349 Ga0496100_0000170
350 Ga0496101_0191716
351 Ga0496102_0010406
352 Ga0496102_0028727
353 Ga0496103_0013769
354 Ga0496103_0026699
355 Ga0496104_0001257
356 Ga0496105_0029831
357 Ga0496106_0000652
358 Ga0496107_0000135
359 Ga0496107_0261899
360 Ga0496108_0010776
361 Ga0496109_0000924
362 Ga0496109_0478784
363 Ga0496110_0002511
364 Ga0496110_0006251
365 Ga0496110_0006925
366 Ga0496110_1121354
367 Ga0496110_1181830
368 Ga0496111_0012650
369 Ga0496111_0028889
370 Ga0496111_0046508
371 Ga0496112_0002872
372 Ga0496112_0057287
373 Ga0496112_0327531
374 Ga0496113_0001084
375 Ga0496113_0305118
376 Ga0496118_0026289
377 Ga0496119_0001957
378 Ga0496120_0019145
379 Ga0496122_0002947
380 Ga0496123_0037586
381 Ga0496125_0055755
382 Ga0496126_0009131
383 Ga0501034_0176511
384 Ga0501043_0173755
385 Ga0501035_0068641
386 nmdc:mga08y16_443924_c1
387 2511699903
388 2511179643
389 2512638981
390 2540607092
391 2545559323
392 2553395465
393 2578930276
394 2595087572
395 2631983693
396 2644704701
397 2644709395
398 2644716277
399 2644723850
400 2651533284
401 2672336506
402 2672337657
403 2673817249
404 2674419289
405 2685150196
406 2695627819
407 2698323067
408 2705994160
409 2717916391
410 2721505493
411 2738814122
412 2739158002
413 2739210552
414 2739231716
415 2739270219
416 2739271211
417 2757565559
418 2777761535
419 2777839049
420 2809056746
421 2816861956
422 2816863029
423 2817480390
424 2817617802
425 2819578725
426 2819709745
427 2842683078
428 2842686768
429 2842883993
430 2849141717
431 2849143938
432 2857462120
433 2857470038
434 2857582777
435 2857583829
436 2857590182
437 2857591416
438 2857597096
439 2860839579
440 2877770716
441 2880171649
442 2881645597
443 2881646367
444 2897111679
445 2904524977
446 2904563546
447 2915600713
448 2915606866
449 2919146435
450 2919414872
451 2919518350
452 2919722709
453 2928096728
454 2929005866
455 2929185850
456 2929235401
457 2936341410
458 2936367060
459 2938919578
460 2947428948
461 2956900496
462 2960320337
463 2960379600
464 2962293038
465 2969138959
466 2969143173
467 2969767015
468 2969774518
469 2971895433
470 2977256950
471 2980494784
472 2990277833
473 3001898137
474 3006828035
475 3006860735
476 3006881255
477 3006981409
478 8022625599
479 8022633476
480 8022657279
481 8022795153
482 8022895374
483 8022916843
484 8023444041
485 8023449777
486 8051955615
487 8052176656
488 8054281598
489 8057584978
490 8057635034

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

4

201

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oxo-assembly3.cif.gz_E succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa 0.9564 11 220
3oxo-assembly3.cif.gz_F succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa 0.9562 11 220
3oxo-assembly4.cif.gz_H succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa 0.9552 14 220
3k6m-assembly2.cif.gz_C dynamic domains of succinyl-coa:3-ketoacid-coenzyme a transferase from pig heart. 0.9518 8 220
3oxo-assembly4.cif.gz_G succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa 0.9514 11 220
ID Description Score Start End Superfamily
5dbnD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9383 6 216 3.40.1080.10
2nrcB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9323 6 216 3.40.1080.10
5dbnD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9172 6 216 3.40.1080.10
2nrcB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9077 6 216 3.40.1080.10
1o9lB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9019 6 216 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A096B800-F1-model_v4 Uncharacterized protein 0.9782 134 220 GO:0008410
AF-A0A5N8ZCL1-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9781 130 219 GO:0008410
AF-A0A2X3EW81-F1-model_v4 Putative acetyl-CoA:acetoacetyl-CoA transferase beta subunit (EC 2.8.3.5) 0.9719 139 220 GO:0008260
AF-A0A1G8KE35-F1-model_v4 3-oxoacid CoA-transferase, B subunit 0.9714 130 220 GO:0008410
AF-X0UX17-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9708 145 220 GO:0008410

Map