F357751

General Info

Members Datasets Scaffolds Average Seq Length
245 161 238 169

Family's Representative Sequence

Representative Sequence 3300053104|Ga0500556_0000038|Ga0500556_0000038_31579_32211
Length 200
Sequence MIPSERKGLSCWLANLSTEQNDPPLSSRTGKETDMFGISPLGWVHTLGSLPAIPLAICMFARHGRIVPRSRPGAVYFVSMLIGAATVFLVAHQSVSLVAGYGVGRLSGLGRARRYIETVCLSLTAFLLMVPTVTETLRRVPDGHPLVTDLNSPLLLGSQASLLVILIIGVTAQIIHLRRQGKTAASMGPWNRSGHGAGRQ

Samples

Sample ID Description Type Environment
1 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
2 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
3 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
4 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
5 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
52 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
53 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
59 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
60 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
63 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
95 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
96 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
99 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
100 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
101 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
102 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
103 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
106 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
109 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
110 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
111 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
112 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
113 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
114 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
115 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
116 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
117 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
118 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
124 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
125 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
126 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
127 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
128 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
129 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
130 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
131 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
132 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
133 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
140 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
143 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
144 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
147 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
150 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
151 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
152 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
153 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
154 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
155 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
156 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
157 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
158 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
159 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
160 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
161 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.14
Metatranscriptomes 0
Isolates 2.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.86
Nodule 0.82
Rhizoplane 2.45
Rhizosphere 59.59
Stem 0
Stem Tuber 0
Unclassified 14.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000320 3300002705 Bacteria 31857
2 JGI25162J39368_1008008 3300002737 Bacteria 1565
3 JGI25154J39366_1000264 3300002738 Bacteria 33263
4 JGI25157J39369_1001452 3300002741 Bacteria 8853
5 JGI25159J45721_1000356 3300002987 Bacteria 21189
6 rootH1_10026225 3300003316 Bacteria 1597
7 rootH2_10138489 3300003320 Bacteria 2468
8 rootL2_10061986 3300003322 Bacteria 1489
9 JGI25161J50226_1000250 3300003374 Bacteria 32181
10 Ga0055538_1001991 3300003751 Bacteria 3322
11 Ga0055539_1004124 3300003752 Bacteria 1957
12 Ga0055532_1000089 3300003758 Bacteria 105631
13 Ga0055532_1000278 3300003758 Bacteria 33197
14 Ga0055535_1002569 3300003761 Bacteria 6119
15 Ga0055526_1002042 3300003771 Bacteria 13892
16 Ga0055537_1001367 3300003773 Bacteria 9810
17 Ga0055524_1000031 3300003775 Bacteria 187744
18 Ga0055524_1001574 3300003775 Bacteria 12815
19 Ga0055534_1006022 3300003784 Bacteria 3130
20 Ga0055534_1052082 3300003784 Bacteria 580
21 Ga0055530_10000500 3300003791 Bacteria 33987
22 Ga0055543_1000273 3300004625 Bacteria 38338
23 Ga0065165_1000902 3300005262 Bacteria 38338
24 Ga0065165_1002936 3300005262 Bacteria 12996
25 Ga0065165_1037709 3300005262 Bacteria 1463
26 Ga0070663_100109987 3300005455 Bacteria 2069
27 Ga0068853_101382880 3300005539 Unclassified 681
28 Ga0070665_100000237 3300005548 Bacteria 91478
29 Ga0070665_100003467 3300005548 Bacteria 16809
30 Ga0070665_100033192 3300005548 Bacteria 5193
31 Ga0068855_100027230 3300005563 Bacteria 6839
32 Ga0068859_100001027 3300005617 Bacteria 28602
33 Ga0068863_100588548 3300005841 Bacteria 1101
34 Ga0068858_100280908 3300005842 Unclassified 1585
35 Ga0068860_100214129 3300005843 Bacteria 1869
36 Ga0068862_100000246 3300005844 Bacteria 60352
37 Ga0068862_100492393 3300005844 Bacteria 1162
38 Ga0075364_10310804 3300006051 Bacteria 1073
39 Ga0097620_100001027 3300006931 Bacteria 28602
40 Ga0105240_10055597 3300009093 Bacteria 4955
41 Ga0105247_10315946 3300009101 Bacteria 1088
42 Ga0105237_10010483 3300009545 Bacteria 9848
43 Ga0105237_10076236 3300009545 Bacteria 3343
44 Ga0105238_10000294 3300009551 Bacteria 55283
45 Ga0105249_10000226 3300009553 Bacteria 64018
46 Ga0105249_10071373 3300009553 Bacteria 3208
47 Ga0105239_10001564 3300010375 Bacteria 30239
48 Ga0105239_10023817 3300010375 Bacteria 6742
49 Ga0105239_10128551 3300010375 Bacteria 2817
50 Ga0105239_10208121 3300010375 Bacteria 2192
51 Ga0105239_10454353 3300010375 Bacteria 1453
52 Ga0105239_12081740 3300010375 Bacteria 659
53 Ga0157373_10037452 3300013100 Bacteria 3476
54 Ga0157374_10655266 3300013296 Bacteria 1062
55 Ga0163162_10034893 3300013306 Bacteria 5008
56 Ga0163162_10445382 3300013306 Bacteria 1427
57 Ga0163163_10208901 3300014325 Bacteria 2001
58 Ga0163163_10222917 3300014325 Bacteria 1934
59 Ga0182008_10000284 3300014497 Bacteria 39712
60 Ga0157379_10067909 3300014968 Bacteria 3187
61 Ga0157379_10078132 3300014968 Bacteria 2964
62 Ga0182007_10108339 3300015262 Bacteria 923
63 Ga0213876_10221011 3300021384 Bacteria 1007
64 Ga0209435_100109 3300025206 Bacteria 32283
65 Ga0209436_100300 3300025208 Bacteria 22899
66 Ga0209784_101385 3300025224 Bacteria 3322
67 Ga0209566_102870 3300025225 Bacteria 2919
68 Ga0209147_100021 3300025229 Bacteria 464719
69 Ga0209147_100060 3300025229 Bacteria 249588
70 Ga0209437_100081 3300025233 Bacteria 271072
71 Ga0209437_100590 3300025233 Bacteria 23064
72 Ga0209258_100141 3300025242 Bacteria 166385
73 Ga0209646_1000101 3300025246 Bacteria 164503
74 Ga0209026_1000264 3300025250 Bacteria 64186
75 Ga0209677_101453 3300025253 Bacteria 10244
76 Ga0209148_1014588 3300025254 Bacteria 1387
77 Ga0209759_1000264 3300025256 Bacteria 75893
78 Ga0209565_1001660 3300025263 Bacteria 9298
79 Ga0209673_1022826 3300025273 Bacteria 2147
80 Ga0209673_1073864 3300025273 Bacteria 802
81 Ga0209130_1000301 3300025284 Bacteria 60251
82 Ga0209675_1001764 3300025291 Bacteria 11849
83 Ga0209675_1008088 3300025291 Bacteria 3923
84 Ga0209564_1000098 3300025295 Bacteria 228906
85 Ga0209564_1000135 3300025295 Bacteria 188117
86 Ga0209050_1000533 3300025298 Bacteria 63043
87 Ga0209050_1006433 3300025298 Bacteria 6957
88 Ga0209256_1000107 3300025299 Bacteria 186233
89 Ga0209256_1000765 3300025299 Bacteria 41750
90 Ga0209051_1069127 3300025303 Bacteria 1072
91 Ga0209257_1000303 3300025304 Bacteria 107862
92 Ga0207685_10528339 3300025905 Bacteria 624
93 Ga0207695_10001257 3300025913 Bacteria 43221
94 Ga0207695_10050976 3300025913 Bacteria 4349
95 Ga0207695_10201767 3300025913 Bacteria 1903
96 Ga0207671_10014753 3300025914 Bacteria 6159
97 Ga0207649_10966114 3300025920 Bacteria 669
98 Ga0207694_10000920 3300025924 Bacteria 26083
99 Ga0207667_10008948 3300025949 Bacteria 11841
100 Ga0207667_10261985 3300025949 Bacteria 1768
101 Ga0207712_10000141 3300025961 Bacteria 75812
102 Ga0207712_10042128 3300025961 Bacteria 3142
103 Ga0207658_10104801 3300025986 Bacteria 2223
104 Ga0207703_10862963 3300026035 Unclassified 866
105 Ga0207639_11277738 3300026041 Bacteria 689
106 Ga0207678_10110460 3300026067 Bacteria 2346
107 Ga0207678_10272701 3300026067 Bacteria 1451
108 Ga0207702_10052790 3300026078 Bacteria 3441
109 Ga0207641_10396535 3300026088 Bacteria 1324
110 Ga0268266_10000001 3300028379 Bacteria 4040580
111 Ga0268266_10074819 3300028379 Bacteria 2941
112 Ga0268266_10138729 3300028379 Bacteria 2180
113 Ga0268265_10000492 3300028380 Bacteria 41089
114 Ga0268265_10036779 3300028380 Bacteria 3588
115 Ga0268264_10020451 3300028381 Bacteria 5408
116 Ga0268264_10305360 3300028381 Bacteria 1499
117 Ga0307509_10000021 3300031507 Bacteria 250589
118 Ga0307408_100065139 3300031548 Bacteria 2672
119 Ga0307414_10018983 3300032004 Bacteria 4250
120 Ga0307414_10100903 3300032004 Bacteria 2172
121 Ga0307507_10470269 3300033179 Bacteria 687
122 Ga0395905_0107633 3300037471 Bacteria 2617
123 Ga0436365_0966573 3300039437 Bacteria 4963
124 Ga0436365_1607412 3300039437 Bacteria 2081
125 Ga0436362_1083791 3300039453 Bacteria 1107
126 Ga0451804_0399903 3300041463 Bacteria 729
127 Ga0466965_0037985 3300044683 Bacteria 2365
128 Ga0466957_0026593 3300044842 Bacteria 3434
129 Ga0495627_034893 3300046453 Bacteria 1569
130 Ga0495591_008091 3300046458 Bacteria 4349
131 Ga0495650_0002098 3300046471 Bacteria 17142
132 Ga0495650_0005269 3300046471 Bacteria 8465
133 Ga0495650_0015593 3300046471 Bacteria 3890
134 Ga0495605_0006908 3300046474 Bacteria 6482
135 Ga0495584_0011201 3300046491 Bacteria 4594
136 Ga0495585_0021414 3300046492 Bacteria 3711
137 Ga0495585_0051725 3300046492 Bacteria 2275
138 Ga0495594_0000908 3300046499 Bacteria 15354
139 Ga0495607_0002374 3300046501 Bacteria 15369
140 Ga0495607_0034256 3300046501 Bacteria 3082
141 Ga0495607_0198597 3300046501 Bacteria 994
142 Ga0495583_0000233 3300046506 Bacteria 92142
143 Ga0495583_0000528 3300046506 Bacteria 54010
144 Ga0495606_0000047 3300046507 Bacteria 207892
145 Ga0495606_0016898 3300046507 Bacteria 5540
146 Ga0495606_0053314 3300046507 Bacteria 2624
147 Ga0495610_0003574 3300046512 Bacteria 12018
148 Ga0495610_0126721 3300046512 Bacteria 1112
149 Ga0495616_0002007 3300046513 Bacteria 13696
150 Ga0495616_0035146 3300046513 Bacteria 2595
151 Ga0495616_0318576 3300046513 Bacteria 653
152 Ga0495620_0000214 3300046515 Bacteria 43578
153 Ga0495620_0021383 3300046515 Bacteria 3142
154 Ga0495631_0002090 3300046518 Bacteria 11598
155 Ga0495631_0007308 3300046518 Bacteria 5625
156 Ga0495631_0179349 3300046518 Bacteria 907
157 Ga0495632_0011959 3300046519 Bacteria 5033
158 Ga0495632_0087580 3300046519 Bacteria 1480
159 Ga0495637_0000127 3300046520 Bacteria 56837
160 Ga0495637_0001330 3300046520 Bacteria 14810
161 Ga0495637_0106509 3300046520 Bacteria 1090
162 Ga0495644_0002776 3300046523 Bacteria 6941
163 Ga0495648_0000036 3300046524 Bacteria 195997
164 Ga0495648_0000939 3300046524 Bacteria 30267
165 Ga0495654_0031541 3300046530 Bacteria 2690
166 Ga0495654_0176033 3300046530 Bacteria 929
167 Ga0495609_0000494 3300046538 Bacteria 31611
168 Ga0495609_0129159 3300046538 Bacteria 1083
169 Ga0495597_0030556 3300046542 Bacteria 2455
170 Ga0495633_0018550 3300046558 Bacteria 3531
171 Ga0495633_0018577 3300046558 Bacteria 3528
172 Ga0495633_0109665 3300046558 Bacteria 1279
173 Ga0495668_0049097 3300046616 Bacteria 2340
174 Ga0495668_0134023 3300046616 Bacteria 1356
175 Ga0495611_0041174 3300046648 Bacteria 2060
176 Ga0495625_0000016 3300046660 Bacteria 311353
177 Ga0495625_0000108 3300046660 Bacteria 125604
178 Ga0495625_0058916 3300046660 Bacteria 2726
179 Ga0495661_0000001 3300046665 Bacteria 898372
180 Ga0495661_0002335 3300046665 Bacteria 14634
181 Ga0495670_0026199 3300046691 Bacteria 2885
182 Ga0495670_0144488 3300046691 Bacteria 1246
183 Ga0495670_0404306 3300046691 Bacteria 738
184 Ga0495671_0029969 3300046692 Bacteria 2789
185 Ga0495671_0061288 3300046692 Bacteria 1856
186 Ga0495649_0034133 3300046694 Bacteria 2800
187 Ga0495589_0024713 3300046794 Bacteria 3052
188 Ga0495660_0024611 3300046810 Bacteria 3428
189 Ga0495660_0069701 3300046810 Bacteria 1868
190 Ga0495672_0014600 3300047320 Bacteria 5370
191 Ga0495683_0000150 3300047323 Bacteria 68562
192 Ga0495683_0000268 3300047323 Bacteria 46160
193 Ga0495679_000302 3300047446 Bacteria 39783
194 Ga0495679_023426 3300047446 Bacteria 2094
195 Ga0495673_0001186 3300047469 Bacteria 21914
196 Ga0495673_0011015 3300047469 Bacteria 4890
197 Ga0495673_0085441 3300047469 Bacteria 1298
198 Ga0495681_0000364 3300047470 Bacteria 35327
199 Ga0495681_0005041 3300047470 Bacteria 8903
200 Ga0495681_0026832 3300047470 Bacteria 2989
201 Ga0495686_0045679 3300047472 Bacteria 2770
202 Ga0495686_0173541 3300047472 Bacteria 1253
203 Ga0496100_0402921 3300048903 Bacteria 1042
204 Ga0496102_0701641 3300048905 Bacteria 935
205 Ga0496114_0218110 3300048917 Bacteria 1674
206 Ga0496115_0112644 3300048918 Bacteria 2235
207 Ga0496115_0440908 3300048918 Bacteria 1053
208 Ga0496117_0075408 3300048920 Bacteria 2241
209 Ga0496117_0405790 3300048920 Bacteria 686
210 Ga0496118_0088058 3300048921 Bacteria 2150
211 Ga0496118_0110710 3300048921 Bacteria 1823
212 Ga0496121_0045164 3300048924 Bacteria 3789
213 Ga0496121_0513379 3300048924 Bacteria 758
214 Ga0496122_0001093 3300048925 Bacteria 46994
215 Ga0496122_0001281 3300048925 Bacteria 41818
216 Ga0496122_0020635 3300048925 Bacteria 5938
217 Ga0496123_0001497 3300048926 Bacteria 32439
218 Ga0496123_0002085 3300048926 Bacteria 25741
219 Ga0496125_0000734 3300048928 Bacteria 54288
220 Ga0496125_0061073 3300048928 Bacteria 3025
221 Ga0496126_0042726 3300048929 Bacteria 4185
222 Ga0496126_0100952 3300048929 Bacteria 2524
223 Ga0496126_0148142 3300048929 Bacteria 2014
224 Ga0496126_0790647 3300048929 Bacteria 729
225 Ga0495678_117336 3300049459 Bacteria 898
226 nmdc:mga03683_17299_c2 3300050489 Bacteria 1460
227 nmdc:mga09592_114840_c1 3300050508 Bacteria 2311
228 Ga0500644_0069757 3300053088 Bacteria 1263
229 Ga0500556_0000038 3300053104 Bacteria 138208
230 Ga0500572_000860 3300053111 Bacteria 9428
231 Ga0500595_001365 3300053119 Bacteria 13120
232 Ga0500597_000063 3300053120 Bacteria 21630
233 Ga0500614_131393 3300053123 Bacteria 744
234 Ga0500652_047309 3300053131 Bacteria 1748
235 Ga0500559_0000628 3300053136 Bacteria 23950
236 Ga0500568_0007325 3300053139 Bacteria 5424
237 Ga0500639_007874 3300053163 Bacteria 5540
238 Ga0500576_214371 3300053725 Bacteria 639

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053104 Ga0500556_0000038 Ga0500556_0000038_31579_32211 154
2 3300003316 rootH1_10026225 rootH1_100262252 159
3 3300003320 rootH2_10138489 rootH2_101384891 159
4 3300015262 Ga0182007_10108339 Ga0182007_101083391 159
5 3300032004 Ga0307414_10018983 Ga0307414_100189835 159
6 iso_pu_bacteria 2989776772 2989779519 159
7 3300009553 Ga0105249_10000226 Ga0105249_1000022628 160
8 3300010375 Ga0105239_10128551 Ga0105239_101285512 160
9 3300025961 Ga0207712_10000141 Ga0207712_1000014143 160
10 3300039437 Ga0436365_0966573 Ga0436365_0966573_3855_4349 160
11 3300046524 Ga0495648_0000036 Ga0495648_0000036_110693_111253 160
12 3300046558 Ga0495633_0109665 Ga0495633_0109665_390_950 160
13 3300048929 Ga0496126_0790647 Ga0496126_0790647_110_613 160
14 3300053088 Ga0500644_0069757 Ga0500644_0069757_163_723 160
15 3300053131 Ga0500652_047309 Ga0500652_047309_341_823 160
16 iso_pu_bacteria 2548876994 2550696774 160
17 iso_pu_bacteria 2738543031 2739351186 160
18 iso_pu_bacteria 2909399089 2909400817 160
19 iso_pu_bacteria 2917699015 2917700627 160
20 iso_pu_bacteria 8054795415 8054804164 160
21 3300003758 Ga0055532_1000278 Ga0055532_100027824 161
22 3300025229 Ga0209147_100021 Ga0209147_100021192 161
23 iso_pu_bacteria 8055817908 8055818200 161
24 3300003775 Ga0055524_1000031 Ga0055524_1000031105 162
25 3300003784 Ga0055534_1052082 Ga0055534_10520821 162
26 3300025273 Ga0209673_1022826 Ga0209673_10228263 162
27 3300025291 Ga0209675_1001764 Ga0209675_100176410 162
28 3300025295 Ga0209564_1000135 Ga0209564_100013586 162
29 3300025299 Ga0209256_1000107 Ga0209256_100010785 162
30 3300009545 Ga0105237_10010483 Ga0105237_100104835 163
31 3300009551 Ga0105238_10000294 Ga0105238_1000029425 163
32 3300010375 Ga0105239_10001564 Ga0105239_1000156410 163
33 3300010375 Ga0105239_10454353 Ga0105239_104543532 163
34 3300013306 Ga0163162_10445382 Ga0163162_104453821 163
35 3300014497 Ga0182008_10000284 Ga0182008_1000028415 163
36 3300014968 Ga0157379_10067909 Ga0157379_100679092 163
37 3300021384 Ga0213876_10221011 Ga0213876_102210112 163
38 3300025913 Ga0207695_10001257 Ga0207695_100012576 163
39 3300025914 Ga0207671_10014753 Ga0207671_100147535 163
40 3300025924 Ga0207694_10000920 Ga0207694_100009203 163
41 3300041463 Ga0451804_0399903 Ga0451804_0399903_193_705 163
42 3300046453 Ga0495627_034893 Ga0495627_034893_896_1390 163
43 3300046458 Ga0495591_008091 Ga0495591_008091_430_924 163
44 3300046492 Ga0495585_0051725 Ga0495585_0051725_192_689 163
45 3300046499 Ga0495594_0000908 Ga0495594_0000908_14693_15187 163
46 3300046506 Ga0495583_0000233 Ga0495583_0000233_191_685 163
47 3300046512 Ga0495610_0126721 Ga0495610_0126721_207_701 163
48 3300046515 Ga0495620_0000214 Ga0495620_0000214_42674_43168 163
49 3300046518 Ga0495631_0007308 Ga0495631_0007308_61_555 163
50 3300046524 Ga0495648_0000939 Ga0495648_0000939_170_664 163
51 3300046530 Ga0495654_0176033 Ga0495654_0176033_225_719 163
52 3300046538 Ga0495609_0000494 Ga0495609_0000494_191_685 163
53 3300046542 Ga0495597_0030556 Ga0495597_0030556_1811_2305 163
54 3300046558 Ga0495633_0018550 Ga0495633_0018550_1154_1648 163
55 3300046648 Ga0495611_0041174 Ga0495611_0041174_163_657 163
56 3300046665 Ga0495661_0002335 Ga0495661_0002335_199_693 163
57 3300046691 Ga0495670_0026199 Ga0495670_0026199_497_991 163
58 3300046692 Ga0495671_0061288 Ga0495671_0061288_1164_1658 163
59 3300046810 Ga0495660_0069701 Ga0495660_0069701_995_1489 163
60 3300047323 Ga0495683_0000150 Ga0495683_0000150_191_685 163
61 3300047446 Ga0495679_000302 Ga0495679_000302_39127_39621 163
62 3300047469 Ga0495673_0085441 Ga0495673_0085441_191_685 163
63 3300047470 Ga0495681_0005041 Ga0495681_0005041_220_714 163
64 3300047472 Ga0495686_0045679 Ga0495686_0045679_342_839 163
65 3300048925 Ga0496122_0020635 Ga0496122_0020635_5267_5761 163
66 3300053120 Ga0500597_000063 Ga0500597_000063_16856_17368 163
67 3300002705 JGI25156J39149_1000320 JGI25156J39149_10003203 164
68 3300002737 JGI25162J39368_1008008 JGI25162J39368_10080082 164
69 3300002738 JGI25154J39366_1000264 JGI25154J39366_100026432 164
70 3300002741 JGI25157J39369_1001452 JGI25157J39369_100145211 164
71 3300002987 JGI25159J45721_1000356 JGI25159J45721_100035613 164
72 3300003322 rootL2_10061986 rootL2_100619862 164
73 3300003374 JGI25161J50226_1000250 JGI25161J50226_100025013 164
74 3300003751 Ga0055538_1001991 Ga0055538_10019913 164
75 3300003752 Ga0055539_1004124 Ga0055539_10041242 164
76 3300003758 Ga0055532_1000089 Ga0055532_100008954 164
77 3300003761 Ga0055535_1002569 Ga0055535_10025692 164
78 3300003771 Ga0055526_1002042 Ga0055526_100204213 164
79 3300003773 Ga0055537_1001367 Ga0055537_100136710 164
80 3300003775 Ga0055524_1001574 Ga0055524_10015748 164
81 3300003784 Ga0055534_1006022 Ga0055534_10060221 164
82 3300003791 Ga0055530_10000500 Ga0055530_1000050019 164
83 3300004625 Ga0055543_1000273 Ga0055543_100027323 164
84 3300005262 Ga0065165_1000902 Ga0065165_100090217 164
85 3300005262 Ga0065165_1002936 Ga0065165_10029366 164
86 3300005262 Ga0065165_1037709 Ga0065165_10377092 164
87 3300005455 Ga0070663_100109987 Ga0070663_1001099873 164
88 3300005539 Ga0068853_101382880 Ga0068853_1013828801 164
89 3300005548 Ga0070665_100000237 Ga0070665_10000023751 164
90 3300005548 Ga0070665_100003467 Ga0070665_1000034675 164
91 3300005548 Ga0070665_100033192 Ga0070665_1000331923 164
92 3300005563 Ga0068855_100027230 Ga0068855_1000272308 164
93 3300005617 Ga0068859_100001027 Ga0068859_10000102712 164
94 3300005841 Ga0068863_100588548 Ga0068863_1005885482 164
95 3300005842 Ga0068858_100280908 Ga0068858_1002809081 164
96 3300005843 Ga0068860_100214129 Ga0068860_1002141292 164
97 3300005844 Ga0068862_100000246 Ga0068862_10000024638 164
98 3300005844 Ga0068862_100492393 Ga0068862_1004923932 164
99 3300006051 Ga0075364_10310804 Ga0075364_103108042 164
100 3300006931 Ga0097620_100001027 Ga0097620_10000102721 164
101 3300009093 Ga0105240_10055597 Ga0105240_100555973 164
102 3300009101 Ga0105247_10315946 Ga0105247_103159463 164
103 3300009545 Ga0105237_10076236 Ga0105237_100762361 164
104 3300009553 Ga0105249_10071373 Ga0105249_100713733 164
105 3300010375 Ga0105239_10023817 Ga0105239_100238174 164
106 3300010375 Ga0105239_10208121 Ga0105239_102081214 164
107 3300010375 Ga0105239_12081740 Ga0105239_120817401 164
108 3300013100 Ga0157373_10037452 Ga0157373_100374525 164
109 3300013296 Ga0157374_10655266 Ga0157374_106552662 164
110 3300013306 Ga0163162_10034893 Ga0163162_100348932 164
111 3300014325 Ga0163163_10208901 Ga0163163_102089012 164
112 3300014325 Ga0163163_10222917 Ga0163163_102229172 164
113 3300014968 Ga0157379_10078132 Ga0157379_100781322 164
114 3300025206 Ga0209435_100109 Ga0209435_10010933 164
115 3300025208 Ga0209436_100300 Ga0209436_10030013 164
116 3300025224 Ga0209784_101385 Ga0209784_1013853 164
117 3300025225 Ga0209566_102870 Ga0209566_1028703 164
118 3300025229 Ga0209147_100060 Ga0209147_100060117 164
119 3300025233 Ga0209437_100081 Ga0209437_10008155 164
120 3300025233 Ga0209437_100590 Ga0209437_1005908 164
121 3300025242 Ga0209258_100141 Ga0209258_100141119 164
122 3300025246 Ga0209646_1000101 Ga0209646_1000101107 164
123 3300025250 Ga0209026_1000264 Ga0209026_100026448 164
124 3300025253 Ga0209677_101453 Ga0209677_1014536 164
125 3300025254 Ga0209148_1014588 Ga0209148_10145882 164
126 3300025256 Ga0209759_1000264 Ga0209759_100026433 164
127 3300025263 Ga0209565_1001660 Ga0209565_100166010 164
128 3300025273 Ga0209673_1073864 Ga0209673_10738642 164
129 3300025284 Ga0209130_1000301 Ga0209130_100030135 164
130 3300025291 Ga0209675_1008088 Ga0209675_10080882 164
131 3300025295 Ga0209564_1000098 Ga0209564_1000098183 164
132 3300025298 Ga0209050_1000533 Ga0209050_100053327 164
133 3300025298 Ga0209050_1006433 Ga0209050_10064334 164
134 3300025299 Ga0209256_1000765 Ga0209256_100076517 164
135 3300025303 Ga0209051_1069127 Ga0209051_10691271 164
136 3300025304 Ga0209257_1000303 Ga0209257_100030331 164
137 3300025905 Ga0207685_10528339 Ga0207685_105283391 164
138 3300025913 Ga0207695_10050976 Ga0207695_100509764 164
139 3300025913 Ga0207695_10201767 Ga0207695_102017674 164
140 3300025920 Ga0207649_10966114 Ga0207649_109661141 164
141 3300025949 Ga0207667_10008948 Ga0207667_100089482 164
142 3300025949 Ga0207667_10261985 Ga0207667_102619852 164
143 3300025961 Ga0207712_10042128 Ga0207712_100421283 164
144 3300025986 Ga0207658_10104801 Ga0207658_101048012 164
145 3300026035 Ga0207703_10862963 Ga0207703_108629631 164
146 3300026041 Ga0207639_11277738 Ga0207639_112777381 164
147 3300026067 Ga0207678_10110460 Ga0207678_101104602 164
148 3300026067 Ga0207678_10272701 Ga0207678_102727012 164
149 3300026078 Ga0207702_10052790 Ga0207702_100527903 164
150 3300026088 Ga0207641_10396535 Ga0207641_103965352 164
151 3300028379 Ga0268266_10000001 Ga0268266_100000013430 164
152 3300028379 Ga0268266_10074819 Ga0268266_100748192 164
153 3300028379 Ga0268266_10138729 Ga0268266_101387294 164
154 3300028380 Ga0268265_10000492 Ga0268265_1000049218 164
155 3300028380 Ga0268265_10036779 Ga0268265_100367792 164
156 3300028381 Ga0268264_10020451 Ga0268264_100204513 164
157 3300028381 Ga0268264_10305360 Ga0268264_103053602 164
158 3300031507 Ga0307509_10000021 Ga0307509_1000002192 164
159 3300031548 Ga0307408_100065139 Ga0307408_1000651393 164
160 3300032004 Ga0307414_10100903 Ga0307414_101009033 164
161 3300033179 Ga0307507_10470269 Ga0307507_104702691 164
162 3300037471 Ga0395905_0107633 Ga0395905_0107633_376_894 164
163 3300039437 Ga0436365_1607412 Ga0436365_1607412_1028_1540 164
164 3300039453 Ga0436362_1083791 Ga0436362_1083791_564_1061 164
165 3300044683 Ga0466965_0037985 Ga0466965_0037985_343_858 164
166 3300044842 Ga0466957_0026593 Ga0466957_0026593_2057_2572 164
167 3300046471 Ga0495650_0002098 Ga0495650_0002098_8285_8785 164
168 3300046471 Ga0495650_0005269 Ga0495650_0005269_7750_8250 164
169 3300046471 Ga0495650_0015593 Ga0495650_0015593_2501_3022 164
170 3300046474 Ga0495605_0006908 Ga0495605_0006908_1355_1876 164
171 3300046491 Ga0495584_0011201 Ga0495584_0011201_1246_1746 164
172 3300046492 Ga0495585_0021414 Ga0495585_0021414_2174_2695 164
173 3300046501 Ga0495607_0002374 Ga0495607_0002374_12768_13268 164
174 3300046501 Ga0495607_0034256 Ga0495607_0034256_1547_2068 164
175 3300046501 Ga0495607_0198597 Ga0495607_0198597_271_798 164
176 3300046506 Ga0495583_0000528 Ga0495583_0000528_2974_3474 164
177 3300046507 Ga0495606_0000047 Ga0495606_0000047_204699_205199 164
178 3300046507 Ga0495606_0016898 Ga0495606_0016898_3102_3629 164
179 3300046507 Ga0495606_0053314 Ga0495606_0053314_1728_2249 164
180 3300046512 Ga0495610_0003574 Ga0495610_0003574_9049_9549 164
181 3300046513 Ga0495616_0002007 Ga0495616_0002007_12906_13427 164
182 3300046513 Ga0495616_0035146 Ga0495616_0035146_2072_2572 164
183 3300046513 Ga0495616_0318576 Ga0495616_0318576_49_555 164
184 3300046515 Ga0495620_0021383 Ga0495620_0021383_1766_2287 164
185 3300046518 Ga0495631_0002090 Ga0495631_0002090_6164_6685 164
186 3300046518 Ga0495631_0179349 Ga0495631_0179349_247_747 164
187 3300046519 Ga0495632_0011959 Ga0495632_0011959_679_1179 164
188 3300046519 Ga0495632_0087580 Ga0495632_0087580_440_961 164
189 3300046520 Ga0495637_0000127 Ga0495637_0000127_51300_51800 164
190 3300046520 Ga0495637_0001330 Ga0495637_0001330_1140_1661 164
191 3300046520 Ga0495637_0106509 Ga0495637_0106509_478_999 164
192 3300046523 Ga0495644_0002776 Ga0495644_0002776_2653_3153 164
193 3300046530 Ga0495654_0031541 Ga0495654_0031541_1272_1793 164
194 3300046538 Ga0495609_0129159 Ga0495609_0129159_489_1010 164
195 3300046558 Ga0495633_0018577 Ga0495633_0018577_997_1518 164
196 3300046616 Ga0495668_0049097 Ga0495668_0049097_363_863 164
197 3300046616 Ga0495668_0134023 Ga0495668_0134023_718_1239 164
198 3300046660 Ga0495625_0000016 Ga0495625_0000016_551_1051 164
199 3300046660 Ga0495625_0000108 Ga0495625_0000108_90221_90715 164
200 3300046660 Ga0495625_0058916 Ga0495625_0058916_1979_2500 164
201 3300046665 Ga0495661_0000001 Ga0495661_0000001_879195_879695 164
202 3300046691 Ga0495670_0144488 Ga0495670_0144488_509_1030 164
203 3300046691 Ga0495670_0404306 Ga0495670_0404306_56_556 164
204 3300046692 Ga0495671_0029969 Ga0495671_0029969_470_970 164
205 3300046694 Ga0495649_0034133 Ga0495649_0034133_2071_2592 164
206 3300046794 Ga0495589_0024713 Ga0495589_0024713_2156_2677 164
207 3300046810 Ga0495660_0024611 Ga0495660_0024611_2187_2687 164
208 3300047320 Ga0495672_0014600 Ga0495672_0014600_1977_2477 164
209 3300047323 Ga0495683_0000268 Ga0495683_0000268_5634_6155 164
210 3300047446 Ga0495679_023426 Ga0495679_023426_1528_2028 164
211 3300047469 Ga0495673_0001186 Ga0495673_0001186_3842_4363 164
212 3300047469 Ga0495673_0011015 Ga0495673_0011015_2850_3350 164
213 3300047470 Ga0495681_0000364 Ga0495681_0000364_8274_8774 164
214 3300047470 Ga0495681_0026832 Ga0495681_0026832_1069_1590 164
215 3300047472 Ga0495686_0173541 Ga0495686_0173541_220_741 164
216 3300048903 Ga0496100_0402921 Ga0496100_0402921_321_836 164
217 3300048905 Ga0496102_0701641 Ga0496102_0701641_170_664 164
218 3300048917 Ga0496114_0218110 Ga0496114_0218110_1044_1538 164
219 3300048918 Ga0496115_0112644 Ga0496115_0112644_36_533 164
220 3300048918 Ga0496115_0440908 Ga0496115_0440908_38_580 164
221 3300048920 Ga0496117_0075408 Ga0496117_0075408_21_536 164
222 3300048920 Ga0496117_0405790 Ga0496117_0405790_130_651 164
223 3300048921 Ga0496118_0088058 Ga0496118_0088058_712_1245 164
224 3300048921 Ga0496118_0110710 Ga0496118_0110710_694_1209 164
225 3300048924 Ga0496121_0045164 Ga0496121_0045164_1985_2518 164
226 3300048924 Ga0496121_0513379 Ga0496121_0513379_12_509 164
227 3300048925 Ga0496122_0001093 Ga0496122_0001093_33748_34242 164
228 3300048925 Ga0496122_0001281 Ga0496122_0001281_29792_30409 164
229 3300048926 Ga0496123_0001497 Ga0496123_0001497_30512_31129 164
230 3300048926 Ga0496123_0002085 Ga0496123_0002085_15345_15839 164
231 3300048928 Ga0496125_0000734 Ga0496125_0000734_14073_14567 164
232 3300048928 Ga0496125_0061073 Ga0496125_0061073_1025_1546 164
233 3300048929 Ga0496126_0042726 Ga0496126_0042726_3349_3846 164
234 3300048929 Ga0496126_0100952 Ga0496126_0100952_880_1422 164
235 3300048929 Ga0496126_0148142 Ga0496126_0148142_82_576 164
236 3300049459 Ga0495678_117336 Ga0495678_117336_24_524 164
237 3300050489 nmdc:mga03683_17299_c2 nmdc:mga03683_17299_c2_511_1026 164
238 3300050508 nmdc:mga09592_114840_c1 nmdc:mga09592_114840_c1_74_589 164
239 3300053111 Ga0500572_000860 Ga0500572_000860_6996_7496 164
240 3300053119 Ga0500595_001365 Ga0500595_001365_5213_5710 164
241 3300053123 Ga0500614_131393 Ga0500614_131393_153_650 164
242 3300053136 Ga0500559_0000628 Ga0500559_0000628_5705_6205 164
243 3300053139 Ga0500568_0007325 Ga0500568_0007325_3885_4382 164
244 3300053163 Ga0500639_007874 Ga0500639_007874_3061_3561 164
245 3300053725 Ga0500576_214371 Ga0500576_214371_56_556 164

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ze4-assembly1.cif.gz_C crystal structure of the integral membrane diacylglycerol kinase - wild-type 0.6317 63 151
4bpd-assembly2.cif.gz_D structure determination of an integral membrane kinase 0.6241 50 151
4cjz-assembly1.cif.gz_B crystal structure of the integral membrane diacylglycerol kinase dgka- 9.9, delta 4 0.596 50 153
3ze4-assembly1.cif.gz_C crystal structure of the integral membrane diacylglycerol kinase - wild-type 0.5742 63 151
4brb-assembly2.cif.gz_E crystal structure of the integral membrane enzyme dgka-ref, delta 7 0.551 70 156
ID Description Score Start End Superfamily
4up6C00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6327 63 151 1.10.287.3610
3ze4C00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6317 63 151 1.10.287.3610
4uxxB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.609 49 153 1.10.287.3610
4uxwB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6011 50 151 1.10.287.3610
4bpdB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5999 58 151 1.10.287.3610
ID Description Score Start End GO Terms
AF-A0A108UAN8-F1-model_v4 Transmembrane protein 0.9606 25 161 GO:0016020
AF-A0A3M0A4P8-F1-model_v4 DUF2306 domain-containing protein 0.9473 4 157 GO:0016020
AF-A0A212L0Y9-F1-model_v4 Transmembrane protein 0.9424 1 163 GO:0016020
AF-A0A423I1V7-F1-model_v4 Uncharacterized protein 0.9395 1 164 GO:0016020
AF-A0A2M8UM35-F1-model_v4 deleted 0.9388 1 155

Feature Viewer

pLDDT pTM Quality
81.86 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map