F357729

General Info

Members Datasets Scaffolds Average Seq Length
245 139 490 140

Family's Representative Sequence

Representative Sequence 3300050496|nmdc:mga07m45_90714_c1|nmdc:mga07m45_90714_c1_463_963
Length 166
Sequence MGAVKQFTCVAIGGRAVLIDGPPGSGKSSLALALIDRGAVLVGDDGVSLDLIGGRLKASPPPNTAGLIEVRNVGLVRMATAARIPVALIVRLDGEAPRYIEAAEMIEVGGAALPMVRLWPDTPVLALRAEMALTAYGIGSGGMTFRYQVGVLERRWPQCRRAQAAA

Samples

Sample ID Description Type Environment
1 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
79 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
93 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
94 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
95 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
96 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
97 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
98 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
99 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
102 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
105 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
106 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
107 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
108 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
111 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
115 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
121 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
122 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
127 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
128 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
129 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
130 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
131 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
132 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
133 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
134 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
135 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
136 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
137 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
138 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
139 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0
Isolates 0.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.47
Nodule 0.41
Rhizoplane 4.08
Rhizosphere 78.78
Stem 0
Stem Tuber 0
Unclassified 0.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga07m45_90714_c1 3300050496 Bacteria 1750
2 JGI24751J29686_10000080 3300002459 Bacteria 54264
3 JGI24751J29686_10029629 3300002459 Bacteria 1136
4 Ga0070658_10055186 3300005327 Bacteria 3227
5 Ga0070658_10068334 3300005327 Bacteria 2904
6 Ga0070658_10142849 3300005327 Bacteria 2000
7 Ga0070658_10168644 3300005327 Bacteria 1839
8 Ga0070658_10331742 3300005327 Bacteria 1300
9 Ga0070658_10728603 3300005327 Bacteria 861
10 Ga0070658_11322766 3300005327 Bacteria 626
11 Ga0070683_101962033 3300005329 Bacteria 562
12 Ga0070670_101808954 3300005331 Bacteria 562
13 Ga0070680_100008906 3300005336 Bacteria 7694
14 Ga0070680_100093050 3300005336 Bacteria 2497
15 Ga0070660_100002832 3300005339 Bacteria 11936
16 Ga0070660_100020683 3300005339 Bacteria 4841
17 Ga0070660_100241653 3300005339 Bacteria 1471
18 Ga0070661_100002979 3300005344 Bacteria 11671
19 Ga0070661_100041683 3300005344 Bacteria 3350
20 Ga0070692_10137959 3300005345 Bacteria 1377
21 Ga0070692_10703965 3300005345 Bacteria 680
22 Ga0070668_100478738 3300005347 Bacteria 1075
23 Ga0070659_100213315 3300005366 Bacteria 1591
24 Ga0070659_100384857 3300005366 Bacteria 1182
25 Ga0070667_100883256 3300005367 Bacteria 832
26 Ga0070663_100052795 3300005455 Bacteria 2900
27 Ga0070663_100097938 3300005455 Bacteria 2184
28 Ga0070662_100546869 3300005457 Bacteria 970
29 Ga0070681_10961015 3300005458 Bacteria 774
30 Ga0070706_101160047 3300005467 Bacteria 710
31 Ga0070679_100006503 3300005530 Bacteria 10896
32 Ga0070679_100022930 3300005530 Bacteria 6105
33 Ga0070679_100051197 3300005530 Bacteria 4113
34 Ga0070679_100175303 3300005530 Bacteria 2117
35 Ga0070679_100925065 3300005530 Bacteria 816
36 Ga0070679_100985101 3300005530 Bacteria 787
37 Ga0070684_100044172 3300005535 Bacteria 3852
38 Ga0068853_100013867 3300005539 Bacteria 6587
39 Ga0068853_100658654 3300005539 Bacteria 997
40 Ga0068853_101192906 3300005539 Bacteria 735
41 Ga0070672_100890904 3300005543 Bacteria 786
42 Ga0070686_100291526 3300005544 Bacteria 1207
43 Ga0070665_100042165 3300005548 Bacteria 4587
44 Ga0068855_100007587 3300005563 Bacteria 13122
45 Ga0068855_100025578 3300005563 Bacteria 7060
46 Ga0068855_100534905 3300005563 Bacteria 1270
47 Ga0070664_100014622 3300005564 Bacteria 6405
48 Ga0070664_100055567 3300005564 Bacteria 3362
49 Ga0070664_100591137 3300005564 Bacteria 1029
50 Ga0068857_100007693 3300005577 Bacteria 9284
51 Ga0068857_100063549 3300005577 Bacteria 3282
52 Ga0068857_100214724 3300005577 Bacteria 1756
53 Ga0068857_100701356 3300005577 Bacteria 962
54 Ga0068854_100092721 3300005578 Bacteria 2250
55 Ga0068854_100159682 3300005578 Bacteria 1745
56 Ga0068856_100026088 3300005614 Bacteria 5698
57 Ga0068856_101136136 3300005614 Unclassified 798
58 Ga0068852_100031413 3300005616 Bacteria 4382
59 Ga0068852_100177867 3300005616 Bacteria 1999
60 Ga0068852_100587350 3300005616 Bacteria 1117
61 Ga0068859_100015011 3300005617 Bacteria 7775
62 Ga0068864_100099842 3300005618 Bacteria 2572
63 Ga0068858_100015659 3300005842 Bacteria 7132
64 Ga0068858_100017260 3300005842 Bacteria 6771
65 Ga0068860_100120512 3300005843 Bacteria 2512
66 Ga0068860_100433011 3300005843 Bacteria 1305
67 Ga0075365_10306745 3300006038 Bacteria 1117
68 Ga0075363_100003648 3300006048 Bacteria 6606
69 Ga0075363_100019492 3300006048 Bacteria 3392
70 Ga0075432_10002185 3300006058 Bacteria 6513
71 Ga0075362_10000001 3300006177 Bacteria 215983
72 Ga0075362_10019725 3300006177 Bacteria 2808
73 Ga0075367_10005332 3300006178 Bacteria 6368
74 Ga0075369_10001537 3300006186 Bacteria 7906
75 Ga0075369_10004755 3300006186 Bacteria 5043
76 Ga0075366_10007984 3300006195 Bacteria 5861
77 Ga0075366_10022011 3300006195 Bacteria 3706
78 Ga0075370_10009681 3300006353 Bacteria 5015
79 Ga0075370_10012152 3300006353 Bacteria 4543
80 Ga0075370_10059169 3300006353 Bacteria 2180
81 Ga0097620_100015011 3300006931 Bacteria 7775
82 Ga0079104_1059454 3300006946 Bacteria 827
83 Ga0105241_10015087 3300009174 Bacteria 5659
84 Ga0105248_10022643 3300009177 Bacteria 6973
85 Ga0105248_10118238 3300009177 Bacteria 2990
86 Ga0105238_10912641 3300009551 Bacteria 897
87 Ga0157371_10005723 3300013102 Bacteria 10419
88 Ga0157370_10051425 3300013104 Bacteria 3936
89 Ga0157369_10052683 3300013105 Bacteria 4401
90 Ga0157369_10252490 3300013105 Bacteria 1840
91 Ga0163162_10046502 3300013306 Bacteria 4350
92 Ga0157372_10011782 3300013307 Bacteria 9314
93 Ga0157372_10350608 3300013307 Bacteria 1720
94 Ga0157375_10342116 3300013308 Bacteria 1661
95 Ga0207705_10000537 3300025909 Bacteria 31974
96 Ga0207705_10009457 3300025909 Bacteria 7089
97 Ga0207705_10056400 3300025909 Bacteria 2832
98 Ga0207705_10078135 3300025909 Bacteria 2408
99 Ga0207705_10140678 3300025909 Bacteria 1802
100 Ga0207705_10222189 3300025909 Bacteria 1435
101 Ga0207705_11008751 3300025909 Bacteria 643
102 Ga0207684_11221741 3300025910 Unclassified 622
103 Ga0207654_10019536 3300025911 Bacteria 3577
104 Ga0207660_10082266 3300025917 Bacteria 2368
105 Ga0207660_10165602 3300025917 Bacteria 1708
106 Ga0207657_10001019 3300025919 Bacteria 29733
107 Ga0207657_10032401 3300025919 Bacteria 4723
108 Ga0207657_10110691 3300025919 Bacteria 2268
109 Ga0207657_11092921 3300025919 Bacteria 610
110 Ga0207649_10011196 3300025920 Bacteria 4940
111 Ga0207649_10066321 3300025920 Bacteria 2288
112 Ga0207652_10012124 3300025921 Bacteria 6963
113 Ga0207652_10032844 3300025921 Bacteria 4367
114 Ga0207652_10100282 3300025921 Bacteria 2556
115 Ga0207652_10314348 3300025921 Bacteria 1414
116 Ga0207652_10347452 3300025921 Bacteria 1339
117 Ga0207652_10713519 3300025921 Bacteria 894
118 Ga0207652_11090430 3300025921 Bacteria 699
119 Ga0207681_10339327 3300025923 Bacteria 1200
120 Ga0207694_10420859 3300025924 Bacteria 1113
121 Ga0207690_10046655 3300025932 Bacteria 2871
122 Ga0207690_10135798 3300025932 Bacteria 1806
123 Ga0207690_10247209 3300025932 Bacteria 1376
124 Ga0207690_10297944 3300025932 Bacteria 1261
125 Ga0207690_10899496 3300025932 Bacteria 734
126 Ga0207706_10004727 3300025933 Bacteria 12751
127 Ga0207706_10141489 3300025933 Bacteria 2117
128 Ga0207669_10230251 3300025937 Bacteria 1367
129 Ga0207691_10279712 3300025940 Bacteria 1436
130 Ga0207711_10352646 3300025941 Bacteria 1362
131 Ga0207711_11087636 3300025941 Bacteria 740
132 Ga0207661_10012259 3300025944 Bacteria 6225
133 Ga0207679_10018919 3300025945 Bacteria 4622
134 Ga0207679_10019434 3300025945 Bacteria 4563
135 Ga0207667_10020525 3300025949 Bacteria 7344
136 Ga0207667_10033706 3300025949 Bacteria 5504
137 Ga0207667_10043981 3300025949 Bacteria 4736
138 Ga0207667_10264436 3300025949 Bacteria 1759
139 Ga0207667_10380735 3300025949 Bacteria 1438
140 Ga0207667_10400596 3300025949 Bacteria 1397
141 Ga0207640_10135408 3300025981 Bacteria 1787
142 Ga0207640_10287772 3300025981 Bacteria 1294
143 Ga0207658_10462538 3300025986 Bacteria 1125
144 Ga0207703_10012009 3300026035 Bacteria 6745
145 Ga0207703_10089313 3300026035 Bacteria 2588
146 Ga0207703_10137094 3300026035 Bacteria 2119
147 Ga0207639_10011566 3300026041 Bacteria 6132
148 Ga0207639_10221391 3300026041 Bacteria 1635
149 Ga0207639_10521634 3300026041 Bacteria 1088
150 Ga0207639_12304053 3300026041 Bacteria 500
151 Ga0207678_10006548 3300026067 Bacteria 10323
152 Ga0207678_10017387 3300026067 Bacteria 6313
153 Ga0207702_10176307 3300026078 Bacteria 1965
154 Ga0207676_10087141 3300026095 Bacteria 2553
155 Ga0207674_10044645 3300026116 Bacteria 4565
156 Ga0207674_10081257 3300026116 Bacteria 3243
157 Ga0207674_10699044 3300026116 Bacteria 979
158 Ga0207674_12000044 3300026116 Bacteria 544
159 Ga0207698_10023817 3300026142 Bacteria 4285
160 Ga0207698_10719514 3300026142 Bacteria 995
161 Ga0207698_11145506 3300026142 Bacteria 791
162 Ga0209813_10000064 3300027866 Bacteria 43230
163 Ga0209974_10006831 3300027876 Bacteria 3960
164 Ga0207428_10135588 3300027907 Bacteria 1882
165 Ga0268264_10152119 3300028381 Bacteria 2076
166 Ga0307408_100284847 3300031548 Bacteria 1377
167 Ga0307408_100788562 3300031548 Bacteria 861
168 Ga0307405_10001359 3300031731 Bacteria 10262
169 Ga0307405_10006672 3300031731 Bacteria 5699
170 Ga0307413_10241125 3300031824 Bacteria 1335
171 Ga0307413_10424336 3300031824 Bacteria 1048
172 Ga0307406_10109867 3300031901 Bacteria 1896
173 Ga0307407_10851704 3300031903 Bacteria 697
174 Ga0307412_10007413 3300031911 Bacteria 6222
175 Ga0307412_10260714 3300031911 Bacteria 1351
176 Ga0307412_10800480 3300031911 Bacteria 818
177 Ga0307409_100412634 3300031995 Bacteria 1293
178 Ga0307416_100058528 3300032002 Bacteria 3125
179 Ga0307416_100306222 3300032002 Bacteria 1582
180 Ga0307414_10078644 3300032004 Bacteria 2405
181 Ga0307411_10024731 3300032005 Bacteria 3585
182 Ga0307411_10262719 3300032005 Bacteria 1364
183 Ga0307411_10336532 3300032005 Bacteria 1225
184 Ga0451837_0025463 3300041494 Bacteria 792
185 Ga0451845_0065125 3300041501 Bacteria 1097
186 Ga0451843_1214345 3300041509 Bacteria 1041
187 Ga0451853_0542316 3300041512 Bacteria 551
188 Ga0439443_015411 3300042003 Bacteria 1160
189 Ga0439435_0006936 3300042436 Bacteria 2569
190 Ga0451577_0895973 3300042876 Bacteria 799
191 Ga0453684_0115993 3300044712 Bacteria 3244
192 Ga0451576_0071631 3300045051 Bacteria 3608
193 Ga0495638_0098899 3300046460 Bacteria 1747
194 Ga0495596_0000233 3300046500 Bacteria 37690
195 Ga0495610_0184331 3300046512 Bacteria 866
196 Ga0495631_0446943 3300046518 Bacteria 550
197 Ga0495632_0085211 3300046519 Bacteria 1503
198 Ga0495643_0000746 3300046522 Bacteria 36916
199 Ga0495643_0013722 3300046522 Bacteria 4838
200 Ga0495598_0061764 3300046537 Bacteria 1158
201 Ga0495609_0017348 3300046538 Bacteria 3342
202 Ga0495625_0029865 3300046660 Bacteria 4072
203 Ga0495625_0163177 3300046660 Bacteria 1491
204 Ga0495671_0031359 3300046692 Bacteria 2718
205 Ga0495681_0120223 3300047470 Bacteria 1128
206 Ga0495681_0362988 3300047470 Bacteria 548
207 Ga0496102_0478157 3300048905 Bacteria 1167
208 Ga0496105_0246725 3300048908 Bacteria 1448
209 Ga0496105_0796289 3300048908 Bacteria 719
210 Ga0496106_0002700 3300048909 Bacteria 13158
211 Ga0496107_0012495 3300048910 Bacteria 5926
212 Ga0496109_0128375 3300048912 Bacteria 2365
213 Ga0496109_0189127 3300048912 Bacteria 1934
214 Ga0496111_0156522 3300048914 Bacteria 1691
215 Ga0496113_0346778 3300048916 Bacteria 1191
216 Ga0496114_0010020 3300048917 Bacteria 7535
217 Ga0496125_0021035 3300048928 Bacteria 6098
218 Ga0496125_0458005 3300048928 Bacteria 729
219 Ga0496126_0005189 3300048929 Bacteria 15051
220 Ga0496126_0036329 3300048929 Bacteria 4607
221 Ga0501033_0200055 3300049570 Bacteria 1427
222 Ga0501037_0754949 3300049573 Bacteria 644
223 Ga0501048_0447888 3300049582 Bacteria 925
224 Ga0501044_0111029 3300049823 Bacteria 2750
225 nmdc:mga03683_100_c1 3300050489 Bacteria 30068
226 nmdc:mga03683_35348_c1 3300050489 Bacteria 2027
227 nmdc:mga03n38_123640_c1 3300050490 Bacteria 1275
228 nmdc:mga03n38_1649_c1 3300050490 Bacteria 6538
229 nmdc:mga00v17_169875_c1 3300050491 Bacteria 1406
230 nmdc:mga00v17_24701_c1 3300050491 Bacteria 3488
231 nmdc:mga0yw44_9045_c1 3300050492 Bacteria 5008
232 nmdc:mga0k408_277369_c1 3300050493 Bacteria 1001
233 nmdc:mga0k408_5918_c2 3300050493 Bacteria 3060
234 nmdc:mga0k408_93_c1 3300050493 Bacteria 42678
235 nmdc:mga06z11_1082_c1 3300050494 Bacteria 9916
236 nmdc:mga04h51_1386_c1 3300050495 Bacteria 5595
237 nmdc:mga07m45_55_c1 3300050496 Bacteria 47453
238 nmdc:mga07m45_6232_c1 3300050496 Bacteria 6024
239 nmdc:mga0sz30_1618_c1 3300050516 Bacteria 8022
240 Ga0500607_001592 3300053121 Bacteria 20060
241 Ga0500618_001172 3300053125 Bacteria 12656
242 Ga0500625_149821 3300053729 Bacteria 880
243 Ga0501082_0425754 3300060353 Bacteria 1159
244 2511125729 2510917021 Bacteria 5705459
245 3000866807 3000865235 Bacteria 3106258
246 nmdc:mga07m45_90714_c1
247 JGI24751J29686_10000080
248 JGI24751J29686_10029629
249 Ga0070658_10055186
250 Ga0070658_10068334
251 Ga0070658_10142849
252 Ga0070658_10168644
253 Ga0070658_10331742
254 Ga0070658_10728603
255 Ga0070658_11322766
256 Ga0070683_101962033
257 Ga0070670_101808954
258 Ga0070680_100008906
259 Ga0070680_100093050
260 Ga0070660_100002832
261 Ga0070660_100020683
262 Ga0070660_100241653
263 Ga0070661_100002979
264 Ga0070661_100041683
265 Ga0070692_10137959
266 Ga0070692_10703965
267 Ga0070668_100478738
268 Ga0070659_100213315
269 Ga0070659_100384857
270 Ga0070667_100883256
271 Ga0070663_100052795
272 Ga0070663_100097938
273 Ga0070662_100546869
274 Ga0070681_10961015
275 Ga0070706_101160047
276 Ga0070679_100006503
277 Ga0070679_100022930
278 Ga0070679_100051197
279 Ga0070679_100175303
280 Ga0070679_100925065
281 Ga0070679_100985101
282 Ga0070684_100044172
283 Ga0068853_100013867
284 Ga0068853_100658654
285 Ga0068853_101192906
286 Ga0070672_100890904
287 Ga0070686_100291526
288 Ga0070665_100042165
289 Ga0068855_100007587
290 Ga0068855_100025578
291 Ga0068855_100534905
292 Ga0070664_100014622
293 Ga0070664_100055567
294 Ga0070664_100591137
295 Ga0068857_100007693
296 Ga0068857_100063549
297 Ga0068857_100214724
298 Ga0068857_100701356
299 Ga0068854_100092721
300 Ga0068854_100159682
301 Ga0068856_100026088
302 Ga0068856_101136136
303 Ga0068852_100031413
304 Ga0068852_100177867
305 Ga0068852_100587350
306 Ga0068859_100015011
307 Ga0068864_100099842
308 Ga0068858_100015659
309 Ga0068858_100017260
310 Ga0068860_100120512
311 Ga0068860_100433011
312 Ga0075365_10306745
313 Ga0075363_100003648
314 Ga0075363_100019492
315 Ga0075432_10002185
316 Ga0075362_10000001
317 Ga0075362_10019725
318 Ga0075367_10005332
319 Ga0075369_10001537
320 Ga0075369_10004755
321 Ga0075366_10007984
322 Ga0075366_10022011
323 Ga0075370_10009681
324 Ga0075370_10012152
325 Ga0075370_10059169
326 Ga0097620_100015011
327 Ga0079104_1059454
328 Ga0105241_10015087
329 Ga0105248_10022643
330 Ga0105248_10118238
331 Ga0105238_10912641
332 Ga0157371_10005723
333 Ga0157370_10051425
334 Ga0157369_10052683
335 Ga0157369_10252490
336 Ga0163162_10046502
337 Ga0157372_10011782
338 Ga0157372_10350608
339 Ga0157375_10342116
340 Ga0207705_10000537
341 Ga0207705_10009457
342 Ga0207705_10056400
343 Ga0207705_10078135
344 Ga0207705_10140678
345 Ga0207705_10222189
346 Ga0207705_11008751
347 Ga0207684_11221741
348 Ga0207654_10019536
349 Ga0207660_10082266
350 Ga0207660_10165602
351 Ga0207657_10001019
352 Ga0207657_10032401
353 Ga0207657_10110691
354 Ga0207657_11092921
355 Ga0207649_10011196
356 Ga0207649_10066321
357 Ga0207652_10012124
358 Ga0207652_10032844
359 Ga0207652_10100282
360 Ga0207652_10314348
361 Ga0207652_10347452
362 Ga0207652_10713519
363 Ga0207652_11090430
364 Ga0207681_10339327
365 Ga0207694_10420859
366 Ga0207690_10046655
367 Ga0207690_10135798
368 Ga0207690_10247209
369 Ga0207690_10297944
370 Ga0207690_10899496
371 Ga0207706_10004727
372 Ga0207706_10141489
373 Ga0207669_10230251
374 Ga0207691_10279712
375 Ga0207711_10352646
376 Ga0207711_11087636
377 Ga0207661_10012259
378 Ga0207679_10018919
379 Ga0207679_10019434
380 Ga0207667_10020525
381 Ga0207667_10033706
382 Ga0207667_10043981
383 Ga0207667_10264436
384 Ga0207667_10380735
385 Ga0207667_10400596
386 Ga0207640_10135408
387 Ga0207640_10287772
388 Ga0207658_10462538
389 Ga0207703_10012009
390 Ga0207703_10089313
391 Ga0207703_10137094
392 Ga0207639_10011566
393 Ga0207639_10221391
394 Ga0207639_10521634
395 Ga0207639_12304053
396 Ga0207678_10006548
397 Ga0207678_10017387
398 Ga0207702_10176307
399 Ga0207676_10087141
400 Ga0207674_10044645
401 Ga0207674_10081257
402 Ga0207674_10699044
403 Ga0207674_12000044
404 Ga0207698_10023817
405 Ga0207698_10719514
406 Ga0207698_11145506
407 Ga0209813_10000064
408 Ga0209974_10006831
409 Ga0207428_10135588
410 Ga0268264_10152119
411 Ga0307408_100284847
412 Ga0307408_100788562
413 Ga0307405_10001359
414 Ga0307405_10006672
415 Ga0307413_10241125
416 Ga0307413_10424336
417 Ga0307406_10109867
418 Ga0307407_10851704
419 Ga0307412_10007413
420 Ga0307412_10260714
421 Ga0307412_10800480
422 Ga0307409_100412634
423 Ga0307416_100058528
424 Ga0307416_100306222
425 Ga0307414_10078644
426 Ga0307411_10024731
427 Ga0307411_10262719
428 Ga0307411_10336532
429 Ga0451837_0025463
430 Ga0451845_0065125
431 Ga0451843_1214345
432 Ga0451853_0542316
433 Ga0439443_015411
434 Ga0439435_0006936
435 Ga0451577_0895973
436 Ga0453684_0115993
437 Ga0451576_0071631
438 Ga0495638_0098899
439 Ga0495596_0000233
440 Ga0495610_0184331
441 Ga0495631_0446943
442 Ga0495632_0085211
443 Ga0495643_0000746
444 Ga0495643_0013722
445 Ga0495598_0061764
446 Ga0495609_0017348
447 Ga0495625_0029865
448 Ga0495625_0163177
449 Ga0495671_0031359
450 Ga0495681_0120223
451 Ga0495681_0362988
452 Ga0496102_0478157
453 Ga0496105_0246725
454 Ga0496105_0796289
455 Ga0496106_0002700
456 Ga0496107_0012495
457 Ga0496109_0128375
458 Ga0496109_0189127
459 Ga0496111_0156522
460 Ga0496113_0346778
461 Ga0496114_0010020
462 Ga0496125_0021035
463 Ga0496125_0458005
464 Ga0496126_0005189
465 Ga0496126_0036329
466 Ga0501033_0200055
467 Ga0501037_0754949
468 Ga0501048_0447888
469 Ga0501044_0111029
470 nmdc:mga03683_100_c1
471 nmdc:mga03683_35348_c1
472 nmdc:mga03n38_123640_c1
473 nmdc:mga03n38_1649_c1
474 nmdc:mga00v17_169875_c1
475 nmdc:mga00v17_24701_c1
476 nmdc:mga0yw44_9045_c1
477 nmdc:mga0k408_277369_c1
478 nmdc:mga0k408_5918_c2
479 nmdc:mga0k408_93_c1
480 nmdc:mga06z11_1082_c1
481 nmdc:mga04h51_1386_c1
482 nmdc:mga07m45_55_c1
483 nmdc:mga07m45_6232_c1
484 nmdc:mga0sz30_1618_c1
485 Ga0500607_001592
486 Ga0500618_001172
487 Ga0500625_149821
488 Ga0501082_0425754
489 2511125729
490 3000866807

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07475

Hpr_kinase_C

HPr Serine kinase C-terminal domain

4

83

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tqf-assembly2.cif.gz_B structure of the hpr(ser) kinase/phosphatase from coxiella burnetii 0.8783 1 134
3tqf-assembly1.cif.gz_A structure of the hpr(ser) kinase/phosphatase from coxiella burnetii 0.8753 1 134
2qmh-assembly2.cif.gz_J structure of v267f mutant hprk/p 0.8725 2 132
1knx-assembly1.cif.gz_D hpr kinase/phosphatase from mycoplasma pneumoniae 0.8683 2 132
1knx-assembly1.cif.gz_A hpr kinase/phosphatase from mycoplasma pneumoniae 0.8528 2 134
ID Description Score Start End Superfamily
3tqfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8803 1 134 3.40.50.300
1knxD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8683 2 132 3.40.50.300
3tqfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8505 1 134 3.40.50.300
3crrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8476 14 36 3.40.50.300
1knxD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8221 2 132 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7X1FXI7-F1-model_v4 HPr kinase/phosphatase C-terminal domain-containing protein 0.994 1 137 GO:0000155
GO:0005524
GO:0006109
AF-A0A117V022-F1-model_v4 Serine kinase 0.9893 1 138 GO:0000155
GO:0005524
GO:0006109
AF-A0A124JWG4-F1-model_v4 Serine kinase 0.9879 2 138 GO:0000155
GO:0005524
GO:0006109
AF-A0A2D6EEM2-F1-model_v4 Serine kinase 0.9879 2 138 GO:0000155
GO:0005524
GO:0006109
AF-A0A4R7DLT0-F1-model_v4 deleted 0.9877 2 138

Map