F357696
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 245 | 176 | 245 | 693 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0083967|Ga0501034_0083967_848_3175 |
| Length | 759 |
| Sequence | MLARLARWSFRRRRLMVFGIWLPFLVLVSVISGAVGSDFHTSFDLPDSESKEVQDVVTAVQPEDAGDVAQIVFTAPQGTDDPAVEAAMTKLFDRGKQFNSTTEPISFAQIQFSERDQAGYLQLADDIQKLDDDIHVDGLTIEYGGQLFGIFEFPESEALGILAAVVILLIAFGSVLAMGLPIGTALFGLGXXXXIVGLSSRVFSMPDFALQMTAMIGXXXGIDYALFIVTRYRENLHAGMDPEAAVVDSVDTSGRAVVFAGITVMISLLGLFVMGIAFVRGLAVAGAIGVLVMMVAAITMLPALLGFVGRRIDNTSRAAXXXXAFFVVLGLLGIFSGLPLAAALLLGAVLAAVVMGVSFLPFGRPLRRALPHRHVKPREQQFWYRWSRFIQHRPWPALAGGLIVMLLLAVPLLSIRLGFGDTGNLSQEQTARRAYDLIAEGFGPGFNGPFVMVSKLPAKGESAGIDELCSTLKQEEGVASVTSVTFNPAKTVGLCSVYPTTSPQSEDTTELLDHIRNDVIPPIESKTGTVLHVGGITAIFEDFGDAISEKLPLFIGVVILLSAILLMAVFRSVLVPLKAIVMNLLSIGAAFGIVTAVFQHGWGASIIGVDQTGPIIAFFPIFLFSIVFGLSMDYEVFLMSRIHEEWEHKKNASEAVTRGLALTGRVITAAALIMITVFASFMLGDERIVKLFGLGLSSAVLVDALIIRSVLVPAIMQLFGTKAWWMPEWLSKVLPNLAVEPAAHHHDGTAEPAVATESE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 5 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 6 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 22 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 23 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 24 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 25 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 26 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 27 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 28 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 29 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 30 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 31 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 32 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 33 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 34 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 35 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 36 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 78 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 79 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 80 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 81 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 82 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 83 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 84 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 85 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 86 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 87 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 88 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 89 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 90 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 91 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 92 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 93 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 94 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 95 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 96 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 97 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 98 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 132 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 133 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 134 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 135 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 136 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 137 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 139 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 140 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 141 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 142 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 143 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 144 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 172 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 173 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 176 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.82 |
| Nodule | 0 |
| Rhizoplane | 11.02 |
| Rhizosphere | 87.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100008891 | 3300005329 | Bacteria | 8557 |
| 2 | Ga0070683_100010142 | 3300005329 | Bacteria | 8086 |
| 3 | Ga0070683_100015368 | 3300005329 | Bacteria | 6722 |
| 4 | Ga0070666_10026450 | 3300005335 | Bacteria | 3791 |
| 5 | Ga0070682_100000017 | 3300005337 | Bacteria | 235228 |
| 6 | Ga0070682_100000708 | 3300005337 | Bacteria | 19980 |
| 7 | Ga0068868_100000954 | 3300005338 | Bacteria | 19677 |
| 8 | Ga0070691_10000001 | 3300005341 | Bacteria | 94744 |
| 9 | Ga0070668_100063607 | 3300005347 | Bacteria | 2860 |
| 10 | Ga0070674_100000005 | 3300005356 | Bacteria | 168443 |
| 11 | Ga0070688_100001589 | 3300005365 | Bacteria | 11359 |
| 12 | Ga0070659_100026903 | 3300005366 | Bacteria | 4428 |
| 13 | Ga0070667_100003792 | 3300005367 | Bacteria | 12859 |
| 14 | Ga0070667_100059312 | 3300005367 | Bacteria | 3237 |
| 15 | Ga0070709_10018935 | 3300005434 | Bacteria | 3972 |
| 16 | Ga0070663_100000454 | 3300005455 | Bacteria | 21701 |
| 17 | Ga0070662_100000342 | 3300005457 | Bacteria | 27963 |
| 18 | Ga0070681_10042542 | 3300005458 | Bacteria | 4552 |
| 19 | Ga0070685_10001752 | 3300005466 | Bacteria | 11359 |
| 20 | Ga0070679_100000244 | 3300005530 | Bacteria | 45433 |
| 21 | Ga0070679_100000982 | 3300005530 | Bacteria | 24847 |
| 22 | Ga0070684_100093248 | 3300005535 | Bacteria | 2680 |
| 23 | Ga0070686_100070208 | 3300005544 | Bacteria | 2290 |
| 24 | Ga0070693_100001368 | 3300005547 | Bacteria | 10985 |
| 25 | Ga0070665_100000040 | 3300005548 | Bacteria | 305480 |
| 26 | Ga0070665_100010065 | 3300005548 | Bacteria | 9570 |
| 27 | Ga0068854_100000065 | 3300005578 | Bacteria | 76046 |
| 28 | Ga0068856_100096358 | 3300005614 | Bacteria | 2947 |
| 29 | Ga0068852_100000094 | 3300005616 | Bacteria | 59653 |
| 30 | Ga0068866_10000340 | 3300005718 | Bacteria | 22024 |
| 31 | Ga0068851_10000355 | 3300005834 | Bacteria | 20703 |
| 32 | Ga0068851_10004042 | 3300005834 | Bacteria | 6584 |
| 33 | Ga0068863_100000170 | 3300005841 | Bacteria | 70180 |
| 34 | Ga0068858_100000353 | 3300005842 | Bacteria | 48412 |
| 35 | Ga0068858_100001002 | 3300005842 | Bacteria | 29191 |
| 36 | Ga0068860_100011100 | 3300005843 | Bacteria | 8880 |
| 37 | Ga0068862_100000891 | 3300005844 | Bacteria | 28985 |
| 38 | Ga0081455_10014182 | 3300005937 | Bacteria | 7826 |
| 39 | Ga0081539_10002182 | 3300005985 | Bacteria | 28755 |
| 40 | Ga0075428_100080735 | 3300006844 | Bacteria | 3549 |
| 41 | Ga0075430_100009376 | 3300006846 | Bacteria | 8274 |
| 42 | Ga0075429_100008150 | 3300006880 | Bacteria | 9108 |
| 43 | Ga0068865_100000013 | 3300006881 | Bacteria | 141352 |
| 44 | Ga0105245_10001072 | 3300009098 | Bacteria | 24802 |
| 45 | Ga0105245_10013217 | 3300009098 | Bacteria | 7192 |
| 46 | Ga0105245_10022169 | 3300009098 | Bacteria | 5577 |
| 47 | Ga0105247_10001002 | 3300009101 | Bacteria | 21329 |
| 48 | Ga0114129_10102484 | 3300009147 | Bacteria | 3958 |
| 49 | Ga0105248_10000008 | 3300009177 | Bacteria | 403910 |
| 50 | Ga0105238_10000009 | 3300009551 | Bacteria | 288729 |
| 51 | Ga0105249_10000050 | 3300009553 | Bacteria | 169617 |
| 52 | Ga0105249_10004494 | 3300009553 | Bacteria | 12059 |
| 53 | Ga0157371_10017938 | 3300013102 | Bacteria | 5246 |
| 54 | Ga0157370_10018467 | 3300013104 | Bacteria | 7011 |
| 55 | Ga0157374_10000678 | 3300013296 | Bacteria | 29993 |
| 56 | Ga0157372_10000882 | 3300013307 | Bacteria | 32603 |
| 57 | Ga0157379_10040722 | 3300014968 | Bacteria | 4147 |
| 58 | Ga0157376_10027159 | 3300014969 | Bacteria | 4534 |
| 59 | Ga0163161_10000021 | 3300017792 | Bacteria | 208779 |
| 60 | Ga0163161_10012179 | 3300017792 | Bacteria | 5965 |
| 61 | Ga0207656_10000215 | 3300025321 | Bacteria | 20720 |
| 62 | Ga0207642_10001965 | 3300025899 | Bacteria | 6347 |
| 63 | Ga0207710_10000461 | 3300025900 | Bacteria | 26087 |
| 64 | Ga0207680_10006566 | 3300025903 | Bacteria | 5636 |
| 65 | Ga0207707_10012902 | 3300025912 | Bacteria | 7273 |
| 66 | Ga0207707_10081654 | 3300025912 | Bacteria | 2822 |
| 67 | Ga0207652_10000395 | 3300025921 | Bacteria | 45460 |
| 68 | Ga0207652_10000709 | 3300025921 | Bacteria | 32351 |
| 69 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 70 | Ga0207687_10000031 | 3300025927 | Bacteria | 150246 |
| 71 | Ga0207687_10000412 | 3300025927 | Bacteria | 29013 |
| 72 | Ga0207687_10000695 | 3300025927 | Bacteria | 22726 |
| 73 | Ga0207690_10018634 | 3300025932 | Bacteria | 4258 |
| 74 | Ga0207706_10000001 | 3300025933 | Bacteria | 423014 |
| 75 | Ga0207669_10000006 | 3300025937 | Bacteria | 176348 |
| 76 | Ga0207704_10000040 | 3300025938 | Bacteria | 90178 |
| 77 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 78 | Ga0207661_10001689 | 3300025944 | Bacteria | 15060 |
| 79 | Ga0207661_10040275 | 3300025944 | Bacteria | 3672 |
| 80 | Ga0207667_10115629 | 3300025949 | Bacteria | 2765 |
| 81 | Ga0207712_10000019 | 3300025961 | Bacteria | 317060 |
| 82 | Ga0207712_10018932 | 3300025961 | Bacteria | 4491 |
| 83 | Ga0207668_10001873 | 3300025972 | Bacteria | 12291 |
| 84 | Ga0207640_10000076 | 3300025981 | Bacteria | 76366 |
| 85 | Ga0207658_10001829 | 3300025986 | Bacteria | 15927 |
| 86 | Ga0207658_10005232 | 3300025986 | Bacteria | 8924 |
| 87 | Ga0207677_10000385 | 3300026023 | Bacteria | 30475 |
| 88 | Ga0207703_10000078 | 3300026035 | Bacteria | 115634 |
| 89 | Ga0207703_10000339 | 3300026035 | Bacteria | 50936 |
| 90 | Ga0207678_10000436 | 3300026067 | Bacteria | 37859 |
| 91 | Ga0207702_10004702 | 3300026078 | Bacteria | 12068 |
| 92 | Ga0207641_10000301 | 3300026088 | Bacteria | 61780 |
| 93 | Ga0207683_10004739 | 3300026121 | Bacteria | 11718 |
| 94 | Ga0207698_10000013 | 3300026142 | Bacteria | 255414 |
| 95 | Ga0268266_10000045 | 3300028379 | Bacteria | 312955 |
| 96 | Ga0268266_10000114 | 3300028379 | Bacteria | 166519 |
| 97 | Ga0268266_10002392 | 3300028379 | Bacteria | 20242 |
| 98 | Ga0268264_10007761 | 3300028381 | Bacteria | 8934 |
| 99 | Ga0265326_10000072 | 3300028558 | Bacteria | 57044 |
| 100 | Ga0265322_10000001 | 3300028654 | Bacteria | 543854 |
| 101 | Ga0265336_10002644 | 3300028666 | Bacteria | 7274 |
| 102 | Ga0265324_10001524 | 3300029957 | Bacteria | 13044 |
| 103 | Ga0265328_10003027 | 3300031239 | Bacteria | 7503 |
| 104 | Ga0265320_10000002 | 3300031240 | Bacteria | 542875 |
| 105 | Ga0265331_10000921 | 3300031250 | Bacteria | 23544 |
| 106 | Ga0265327_10000011 | 3300031251 | Bacteria | 543807 |
| 107 | Ga0265327_10030218 | 3300031251 | Bacteria | 3066 |
| 108 | Ga0265316_10031056 | 3300031344 | Bacteria | 4372 |
| 109 | Ga0265314_10000487 | 3300031711 | Bacteria | 51708 |
| 110 | Ga0436365_1730663 | 3300039437 | Bacteria | 10846 |
| 111 | Ga0439448_0003424 | 3300042005 | Bacteria | 4395 |
| 112 | Ga0439463_006222 | 3300042016 | Bacteria | 2959 |
| 113 | Ga0439460_0003510 | 3300042461 | Bacteria | 3793 |
| 114 | Ga0466965_0031475 | 3300044683 | Bacteria | 2587 |
| 115 | Ga0466963_0040945 | 3300044694 | Bacteria | 3037 |
| 116 | Ga0466964_0010644 | 3300044706 | Bacteria | 3469 |
| 117 | Ga0466971_0026179 | 3300044719 | Bacteria | 2605 |
| 118 | Ga0466957_0019530 | 3300044842 | Bacteria | 3985 |
| 119 | Ga0466958_0037473 | 3300045836 | Bacteria | 2905 |
| 120 | Ga0466967_0000019 | 3300045976 | Bacteria | 79629 |
| 121 | Ga0466967_0106253 | 3300045976 | Bacteria | 2573 |
| 122 | Ga0495592_0009914 | 3300046454 | Bacteria | 7172 |
| 123 | Ga0495629_0001331 | 3300046459 | Bacteria | 19420 |
| 124 | Ga0495629_0005118 | 3300046459 | Bacteria | 9803 |
| 125 | Ga0495641_0000050 | 3300046461 | Bacteria | 73259 |
| 126 | Ga0495641_0016393 | 3300046461 | Bacteria | 3906 |
| 127 | Ga0495582_0000004 | 3300046473 | Bacteria | 168322 |
| 128 | Ga0495662_0000102 | 3300046476 | Bacteria | 31112 |
| 129 | Ga0495606_0000108 | 3300046507 | Bacteria | 140473 |
| 130 | Ga0495608_0000288 | 3300046511 | Bacteria | 35332 |
| 131 | Ga0495618_0000134 | 3300046514 | Bacteria | 53541 |
| 132 | Ga0495628_0003282 | 3300046516 | Bacteria | 14470 |
| 133 | Ga0495628_0070820 | 3300046516 | Bacteria | 2718 |
| 134 | Ga0495630_0000012 | 3300046517 | Bacteria | 223330 |
| 135 | Ga0495630_0002527 | 3300046517 | Bacteria | 12688 |
| 136 | Ga0495630_0011471 | 3300046517 | Bacteria | 6417 |
| 137 | Ga0495652_0041765 | 3300046529 | Bacteria | 3957 |
| 138 | Ga0495640_0007254 | 3300046533 | Bacteria | 8734 |
| 139 | Ga0495586_0000426 | 3300046535 | Bacteria | 25579 |
| 140 | Ga0495587_0008704 | 3300046536 | Bacteria | 6515 |
| 141 | Ga0495645_0010222 | 3300046543 | Bacteria | 6575 |
| 142 | Ga0495634_0001463 | 3300046642 | Bacteria | 20931 |
| 143 | Ga0495625_0002906 | 3300046660 | Bacteria | 17907 |
| 144 | Ga0495635_0000034 | 3300046663 | Bacteria | 96408 |
| 145 | Ga0495657_0019003 | 3300046675 | Bacteria | 4965 |
| 146 | Ga0495657_0065017 | 3300046675 | Bacteria | 2400 |
| 147 | Ga0495599_0005015 | 3300046678 | Bacteria | 7877 |
| 148 | Ga0495599_0067963 | 3300046678 | Bacteria | 2225 |
| 149 | Ga0495647_0000016 | 3300046681 | Bacteria | 86316 |
| 150 | Ga0495647_0001039 | 3300046681 | Bacteria | 8460 |
| 151 | Ga0495658_0000004 | 3300046683 | Bacteria | 173598 |
| 152 | Ga0495669_0000580 | 3300046684 | Bacteria | 16226 |
| 153 | Ga0495613_0000083 | 3300046689 | Bacteria | 90138 |
| 154 | Ga0495624_0000024 | 3300046690 | Bacteria | 98577 |
| 155 | Ga0495624_0000847 | 3300046690 | Bacteria | 24263 |
| 156 | Ga0495649_0002449 | 3300046694 | Bacteria | 13064 |
| 157 | Ga0495600_0010795 | 3300046809 | Bacteria | 5679 |
| 158 | Ga0495600_0027041 | 3300046809 | Bacteria | 3706 |
| 159 | Ga0495604_0000395 | 3300047317 | Bacteria | 39441 |
| 160 | Ga0495676_0000127 | 3300047321 | Bacteria | 57750 |
| 161 | Ga0495676_0016222 | 3300047321 | Bacteria | 6616 |
| 162 | Ga0495676_0017309 | 3300047321 | Bacteria | 6376 |
| 163 | Ga0495680_0000569 | 3300047322 | Bacteria | 41472 |
| 164 | Ga0495680_0001770 | 3300047322 | Bacteria | 22883 |
| 165 | Ga0495679_003327 | 3300047446 | Bacteria | 7769 |
| 166 | Ga0495602_0036818 | 3300048088 | Bacteria | 4549 |
| 167 | Ga0496100_0000005 | 3300048903 | Bacteria | 312112 |
| 168 | Ga0496100_0049371 | 3300048903 | Bacteria | 2721 |
| 169 | Ga0496101_0000022 | 3300048904 | Bacteria | 216728 |
| 170 | Ga0496101_0025813 | 3300048904 | Bacteria | 4079 |
| 171 | Ga0496104_0000009 | 3300048907 | Bacteria | 488055 |
| 172 | Ga0496104_0000462 | 3300048907 | Bacteria | 35037 |
| 173 | Ga0496104_0090282 | 3300048907 | Bacteria | 2927 |
| 174 | Ga0496105_0000007 | 3300048908 | Bacteria | 339658 |
| 175 | Ga0496106_0000108 | 3300048909 | Bacteria | 64484 |
| 176 | Ga0496106_0000464 | 3300048909 | Bacteria | 29073 |
| 177 | Ga0496107_0000011 | 3300048910 | Bacteria | 201631 |
| 178 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 179 | Ga0496108_0000005 | 3300048911 | Bacteria | 535059 |
| 180 | Ga0496108_0010280 | 3300048911 | Bacteria | 7596 |
| 181 | Ga0496109_0000002 | 3300048912 | Bacteria | 443393 |
| 182 | Ga0496109_0000004 | 3300048912 | Bacteria | 404818 |
| 183 | Ga0496109_0000115 | 3300048912 | Bacteria | 82707 |
| 184 | Ga0496110_0002910 | 3300048913 | Bacteria | 12960 |
| 185 | Ga0496110_0030094 | 3300048913 | Bacteria | 4678 |
| 186 | Ga0496111_0000014 | 3300048914 | Bacteria | 80292 |
| 187 | Ga0496112_0014652 | 3300048915 | Bacteria | 7286 |
| 188 | Ga0496113_0000052 | 3300048916 | Bacteria | 49918 |
| 189 | Ga0496114_0000133 | 3300048917 | Bacteria | 53994 |
| 190 | Ga0496114_0030515 | 3300048917 | Bacteria | 4436 |
| 191 | Ga0496114_0043236 | 3300048917 | Bacteria | 3736 |
| 192 | Ga0496115_0000506 | 3300048918 | Bacteria | 30541 |
| 193 | Ga0496115_0094614 | 3300048918 | Bacteria | 2444 |
| 194 | Ga0501033_0022427 | 3300049570 | Bacteria | 4763 |
| 195 | Ga0501034_0000255 | 3300049571 | Bacteria | 97887 |
| 196 | Ga0501034_0083967 | 3300049571 | Bacteria | 3187 |
| 197 | Ga0501036_0077406 | 3300049572 | Bacteria | 2814 |
| 198 | Ga0501038_0004356 | 3300049574 | Bacteria | 13173 |
| 199 | Ga0501039_0002568 | 3300049575 | Bacteria | 13557 |
| 200 | Ga0501040_0000638 | 3300049576 | Bacteria | 21462 |
| 201 | Ga0501040_0045389 | 3300049576 | Bacteria | 2997 |
| 202 | Ga0501041_0069021 | 3300049577 | Bacteria | 2167 |
| 203 | Ga0501042_0001542 | 3300049578 | Bacteria | 13649 |
| 204 | Ga0501042_0006726 | 3300049578 | Bacteria | 7494 |
| 205 | Ga0501046_0003943 | 3300049580 | Bacteria | 13554 |
| 206 | Ga0501048_0001512 | 3300049582 | Bacteria | 17604 |
| 207 | Ga0501048_0043036 | 3300049582 | Bacteria | 3232 |
| 208 | Ga0501068_0017721 | 3300049584 | Bacteria | 4121 |
| 209 | Ga0501071_0008555 | 3300049587 | Bacteria | 6767 |
| 210 | Ga0501071_0066039 | 3300049587 | Bacteria | 2628 |
| 211 | Ga0501072_0000289 | 3300049588 | Bacteria | 36033 |
| 212 | Ga0501072_0028494 | 3300049588 | Bacteria | 4360 |
| 213 | Ga0501074_0003243 | 3300049590 | Bacteria | 11494 |
| 214 | Ga0501075_0000277 | 3300049591 | Bacteria | 28298 |
| 215 | Ga0501075_0092909 | 3300049591 | Bacteria | 2290 |
| 216 | Ga0501076_0001433 | 3300049592 | Bacteria | 16010 |
| 217 | Ga0501076_0010069 | 3300049592 | Bacteria | 6998 |
| 218 | Ga0501077_0016032 | 3300049593 | Bacteria | 4720 |
| 219 | Ga0501079_0001955 | 3300049741 | Bacteria | 14761 |
| 220 | Ga0501079_0022863 | 3300049741 | Bacteria | 4799 |
| 221 | Ga0501079_0050946 | 3300049741 | Bacteria | 3195 |
| 222 | Ga0501081_0001720 | 3300049743 | Bacteria | 13589 |
| 223 | Ga0501035_0031684 | 3300049822 | Bacteria | 4815 |
| 224 | Ga0501045_0001662 | 3300049824 | Bacteria | 14952 |
| 225 | Ga0501045_0047397 | 3300049824 | Bacteria | 3130 |
| 226 | nmdc:mga05p37_222939_c1 | 3300050507 | Bacteria | 2275 |
| 227 | nmdc:mga09592_18825_c1 | 3300050508 | Bacteria | 5665 |
| 228 | nmdc:mga09592_51642_c1 | 3300050508 | Bacteria | 3469 |
| 229 | Ga0495601_0001717 | 3300053077 | Bacteria | 12112 |
| 230 | Ga0495601_0003080 | 3300053077 | Bacteria | 9512 |
| 231 | Ga0495601_0021604 | 3300053077 | Bacteria | 3942 |
| 232 | Ga0495601_0024182 | 3300053077 | Bacteria | 3740 |
| 233 | Ga0495612_0000022 | 3300053078 | Bacteria | 119126 |
| 234 | Ga0495595_0004637 | 3300053084 | Bacteria | 5525 |
| 235 | Ga0495595_0029889 | 3300053084 | Bacteria | 2441 |
| 236 | Ga0495619_0000037 | 3300053085 | Bacteria | 124007 |
| 237 | Ga0495619_0001853 | 3300053085 | Bacteria | 14075 |
| 238 | Ga0495619_0013770 | 3300053085 | Bacteria | 5102 |
| 239 | Ga0500566_0001686 | 3300053094 | Bacteria | 12959 |
| 240 | Ga0500616_0001642 | 3300053153 | Bacteria | 20699 |
| 241 | Ga0501084_0002917 | 3300054114 | Bacteria | 13845 |
| 242 | Ga0501084_0036740 | 3300054114 | Bacteria | 4093 |
| 243 | Ga0501082_0003080 | 3300060353 | Bacteria | 14544 |
| 244 | Ga0466962_0024952 | 3300061719 | Bacteria | 2870 |
| 245 | Ga0530510_0009982 | 3300061734 | Bacteria | 6661 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049577 | Ga0501041_0069021 | Ga0501041_0069021_16_1911 | 530 |
| 2 | 3300050507 | nmdc:mga05p37_222939_c1 | nmdc:mga05p37_222939_c1_21_1907 | 539 |
| 3 | 3300044683 | Ga0466965_0031475 | Ga0466965_0031475_275_2467 | 586 |
| 4 | 3300044694 | Ga0466963_0040945 | Ga0466963_0040945_216_2408 | 586 |
| 5 | 3300044706 | Ga0466964_0010644 | Ga0466964_0010644_945_3137 | 586 |
| 6 | 3300044719 | Ga0466971_0026179 | Ga0466971_0026179_254_2446 | 586 |
| 7 | 3300044842 | Ga0466957_0019530 | Ga0466957_0019530_418_2610 | 586 |
| 8 | 3300045836 | Ga0466958_0037473 | Ga0466958_0037473_402_2594 | 586 |
| 9 | 3300061719 | Ga0466962_0024952 | Ga0466962_0024952_253_2445 | 586 |
| 10 | 3300046678 | Ga0495599_0067963 | Ga0495599_0067963_44_1975 | 589 |
| 11 | 3300042005 | Ga0439448_0003424 | Ga0439448_0003424_844_3069 | 597 |
| 12 | 3300042461 | Ga0439460_0003510 | Ga0439460_0003510_628_2853 | 597 |
| 13 | 3300005937 | Ga0081455_10014182 | Ga0081455_100141827 | 598 |
| 14 | 3300006844 | Ga0075428_100080735 | Ga0075428_1000807352 | 603 |
| 15 | 3300006846 | Ga0075430_100009376 | Ga0075430_1000093766 | 619 |
| 16 | 3300042016 | Ga0439463_006222 | Ga0439463_006222_25_2250 | 619 |
| 17 | 3300006880 | Ga0075429_100008150 | Ga0075429_1000081502 | 625 |
| 18 | 3300009147 | Ga0114129_10102484 | Ga0114129_101024841 | 625 |
| 19 | 3300050508 | nmdc:mga09592_18825_c1 | nmdc:mga09592_18825_c1_3275_5464 | 625 |
| 20 | 3300050508 | nmdc:mga09592_51642_c1 | nmdc:mga09592_51642_c1_48_2237 | 625 |
| 21 | 3300039437 | Ga0436365_1730663 | Ga0436365_1730663_8482_10755 | 628 |
| 22 | 3300049572 | Ga0501036_0077406 | Ga0501036_0077406_212_2425 | 631 |
| 23 | 3300049576 | Ga0501040_0045389 | Ga0501040_0045389_279_2492 | 631 |
| 24 | 3300049578 | Ga0501042_0006726 | Ga0501042_0006726_3306_5519 | 631 |
| 25 | 3300049587 | Ga0501071_0066039 | Ga0501071_0066039_401_2614 | 631 |
| 26 | 3300049588 | Ga0501072_0028494 | Ga0501072_0028494_1008_3221 | 631 |
| 27 | 3300049591 | Ga0501075_0092909 | Ga0501075_0092909_45_2258 | 631 |
| 28 | 3300049592 | Ga0501076_0010069 | Ga0501076_0010069_881_3094 | 631 |
| 29 | 3300049741 | Ga0501079_0022863 | Ga0501079_0022863_2108_4321 | 631 |
| 30 | 3300049824 | Ga0501045_0047397 | Ga0501045_0047397_149_2362 | 631 |
| 31 | 3300046535 | Ga0495586_0000426 | Ga0495586_0000426_1017_3200 | 633 |
| 32 | 3300046517 | Ga0495630_0011471 | Ga0495630_0011471_2222_4432 | 635 |
| 33 | 3300013296 | Ga0157374_10000678 | Ga0157374_1000067812 | 638 |
| 34 | 3300028558 | Ga0265326_10000072 | Ga0265326_1000007240 | 638 |
| 35 | 3300028654 | Ga0265322_10000001 | Ga0265322_10000001538 | 638 |
| 36 | 3300028666 | Ga0265336_10002644 | Ga0265336_100026444 | 638 |
| 37 | 3300029957 | Ga0265324_10001524 | Ga0265324_1000152410 | 638 |
| 38 | 3300031239 | Ga0265328_10003027 | Ga0265328_100030277 | 638 |
| 39 | 3300031240 | Ga0265320_10000002 | Ga0265320_10000002537 | 638 |
| 40 | 3300031250 | Ga0265331_10000921 | Ga0265331_1000092110 | 638 |
| 41 | 3300031251 | Ga0265327_10000011 | Ga0265327_10000011537 | 638 |
| 42 | 3300031344 | Ga0265316_10031056 | Ga0265316_100310562 | 638 |
| 43 | 3300031711 | Ga0265314_10000487 | Ga0265314_1000048727 | 638 |
| 44 | 3300049570 | Ga0501033_0022427 | Ga0501033_0022427_396_2732 | 641 |
| 45 | 3300049582 | Ga0501048_0043036 | Ga0501048_0043036_301_2637 | 641 |
| 46 | 3300049741 | Ga0501079_0050946 | Ga0501079_0050946_617_2953 | 641 |
| 47 | 3300054114 | Ga0501084_0036740 | Ga0501084_0036740_690_3026 | 641 |
| 48 | 3300061734 | Ga0530510_0009982 | Ga0530510_0009982_1873_4209 | 641 |
| 49 | 3300017792 | Ga0163161_10000021 | Ga0163161_1000002160 | 643 |
| 50 | 3300047321 | Ga0495676_0016222 | Ga0495676_0016222_1918_4107 | 644 |
| 51 | 3300048903 | Ga0496100_0000005 | Ga0496100_0000005_129102_131291 | 644 |
| 52 | 3300048904 | Ga0496101_0000022 | Ga0496101_0000022_110395_112584 | 644 |
| 53 | 3300048909 | Ga0496106_0000108 | Ga0496106_0000108_13014_15203 | 644 |
| 54 | 3300048910 | Ga0496107_0000011 | Ga0496107_0000011_180592_182781 | 644 |
| 55 | 3300046473 | Ga0495582_0000004 | Ga0495582_0000004_111704_113824 | 645 |
| 56 | 3300046683 | Ga0495658_0000004 | Ga0495658_0000004_25732_27852 | 645 |
| 57 | 3300047321 | Ga0495676_0000127 | Ga0495676_0000127_51114_53303 | 645 |
| 58 | 3300048909 | Ga0496106_0000464 | Ga0496106_0000464_3615_5801 | 646 |
| 59 | 3300046675 | Ga0495657_0065017 | Ga0495657_0065017_13_2112 | 648 |
| 60 | 3300046681 | Ga0495647_0000016 | Ga0495647_0000016_79413_81596 | 649 |
| 61 | 3300048917 | Ga0496114_0000133 | Ga0496114_0000133_15643_17832 | 649 |
| 62 | 3300048918 | Ga0496115_0000506 | Ga0496115_0000506_14096_16285 | 649 |
| 63 | 3300005547 | Ga0070693_100001368 | Ga0070693_1000013683 | 650 |
| 64 | 3300048088 | Ga0495602_0036818 | Ga0495602_0036818_1745_3979 | 652 |
| 65 | 3300005347 | Ga0070668_100063607 | Ga0070668_1000636072 | 653 |
| 66 | 3300005367 | Ga0070667_100003792 | Ga0070667_1000037926 | 653 |
| 67 | 3300005844 | Ga0068862_100000891 | Ga0068862_1000008916 | 653 |
| 68 | 3300009553 | Ga0105249_10004494 | Ga0105249_100044949 | 653 |
| 69 | 3300025961 | Ga0207712_10018932 | Ga0207712_100189322 | 653 |
| 70 | 3300025972 | Ga0207668_10001873 | Ga0207668_100018735 | 653 |
| 71 | 3300025986 | Ga0207658_10001829 | Ga0207658_100018299 | 653 |
| 72 | 3300046516 | Ga0495628_0070820 | Ga0495628_0070820_479_2668 | 654 |
| 73 | 3300046536 | Ga0495587_0008704 | Ga0495587_0008704_2864_5053 | 654 |
| 74 | 3300009098 | Ga0105245_10022169 | Ga0105245_100221693 | 655 |
| 75 | 3300046461 | Ga0495641_0000050 | Ga0495641_0000050_40042_42231 | 655 |
| 76 | 3300047322 | Ga0495680_0001770 | Ga0495680_0001770_38_2227 | 655 |
| 77 | 3300046533 | Ga0495640_0007254 | Ga0495640_0007254_865_3057 | 658 |
| 78 | 3300047322 | Ga0495680_0000569 | Ga0495680_0000569_6960_9143 | 658 |
| 79 | 3300053077 | Ga0495601_0003080 | Ga0495601_0003080_627_2804 | 658 |
| 80 | 3300046454 | Ga0495592_0009914 | Ga0495592_0009914_2213_4393 | 659 |
| 81 | 3300046476 | Ga0495662_0000102 | Ga0495662_0000102_2230_4413 | 659 |
| 82 | 3300046511 | Ga0495608_0000288 | Ga0495608_0000288_14211_16391 | 659 |
| 83 | 3300046514 | Ga0495618_0000134 | Ga0495618_0000134_36208_38391 | 659 |
| 84 | 3300046516 | Ga0495628_0003282 | Ga0495628_0003282_5440_7632 | 659 |
| 85 | 3300046675 | Ga0495657_0019003 | Ga0495657_0019003_482_2665 | 659 |
| 86 | 3300046684 | Ga0495669_0000580 | Ga0495669_0000580_10043_12226 | 659 |
| 87 | 3300046689 | Ga0495613_0000083 | Ga0495613_0000083_15731_17914 | 659 |
| 88 | 3300046809 | Ga0495600_0010795 | Ga0495600_0010795_1285_3468 | 659 |
| 89 | 3300053084 | Ga0495595_0004637 | Ga0495595_0004637_2289_4472 | 659 |
| 90 | 3300046663 | Ga0495635_0000034 | Ga0495635_0000034_18891_21074 | 660 |
| 91 | 3300046461 | Ga0495641_0016393 | Ga0495641_0016393_314_2488 | 661 |
| 92 | 3300046517 | Ga0495630_0002527 | Ga0495630_0002527_1247_3427 | 661 |
| 93 | 3300053077 | Ga0495601_0001717 | Ga0495601_0001717_7950_10130 | 661 |
| 94 | 3300005356 | Ga0070674_100000005 | Ga0070674_100000005141 | 664 |
| 95 | 3300005718 | Ga0068866_10000340 | Ga0068866_100003406 | 664 |
| 96 | 3300025899 | Ga0207642_10001965 | Ga0207642_100019657 | 664 |
| 97 | 3300025937 | Ga0207669_10000006 | Ga0207669_1000000652 | 664 |
| 98 | 3300046529 | Ga0495652_0041765 | Ga0495652_0041765_813_2999 | 664 |
| 99 | 3300046543 | Ga0495645_0010222 | Ga0495645_0010222_1520_3706 | 664 |
| 100 | 3300048907 | Ga0496104_0000009 | Ga0496104_0000009_442681_444867 | 664 |
| 101 | 3300048908 | Ga0496105_0000007 | Ga0496105_0000007_43189_45375 | 664 |
| 102 | 3300005337 | Ga0070682_100000017 | Ga0070682_10000001760 | 666 |
| 103 | 3300046690 | Ga0495624_0000024 | Ga0495624_0000024_25946_28129 | 666 |
| 104 | 3300048907 | Ga0496104_0000462 | Ga0496104_0000462_24770_26965 | 666 |
| 105 | 3300048917 | Ga0496114_0043236 | Ga0496114_0043236_1460_3643 | 666 |
| 106 | 3300005341 | Ga0070691_10000001 | Ga0070691_100000015 | 667 |
| 107 | 3300005616 | Ga0068852_100000094 | Ga0068852_10000009440 | 667 |
| 108 | 3300026142 | Ga0207698_10000013 | Ga0207698_10000013226 | 667 |
| 109 | 3300048911 | Ga0496108_0010280 | Ga0496108_0010280_864_3026 | 667 |
| 110 | 3300005335 | Ga0070666_10026450 | Ga0070666_100264502 | 668 |
| 111 | 3300025903 | Ga0207680_10006566 | Ga0207680_100065662 | 668 |
| 112 | 3300025986 | Ga0207658_10005232 | Ga0207658_100052324 | 668 |
| 113 | 3300028379 | Ga0268266_10000114 | Ga0268266_10000114136 | 668 |
| 114 | 3300005614 | Ga0068856_100096358 | Ga0068856_1000963582 | 669 |
| 115 | 3300009177 | Ga0105248_10000008 | Ga0105248_10000008118 | 669 |
| 116 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006514 | 669 |
| 117 | 3300026078 | Ga0207702_10004702 | Ga0207702_1000470213 | 669 |
| 118 | 3300053085 | Ga0495619_0001853 | Ga0495619_0001853_11553_13715 | 669 |
| 119 | 3300046459 | Ga0495629_0005118 | Ga0495629_0005118_2229_4418 | 670 |
| 120 | 3300053094 | Ga0500566_0001686 | Ga0500566_0001686_2000_4189 | 670 |
| 121 | 3300005367 | Ga0070667_100059312 | Ga0070667_1000593121 | 671 |
| 122 | 3300005841 | Ga0068863_100000170 | Ga0068863_10000017056 | 671 |
| 123 | 3300026088 | Ga0207641_10000301 | Ga0207641_100003013 | 671 |
| 124 | 3300006881 | Ga0068865_100000013 | Ga0068865_10000001369 | 673 |
| 125 | 3300025938 | Ga0207704_10000040 | Ga0207704_1000004065 | 673 |
| 126 | 3300046507 | Ga0495606_0000108 | Ga0495606_0000108_13388_15583 | 673 |
| 127 | 3300046660 | Ga0495625_0002906 | Ga0495625_0002906_8516_10693 | 673 |
| 128 | 3300009098 | Ga0105245_10001072 | Ga0105245_1000107218 | 674 |
| 129 | 3300025927 | Ga0207687_10000031 | Ga0207687_1000003118 | 674 |
| 130 | 3300046459 | Ga0495629_0001331 | Ga0495629_0001331_3817_6021 | 674 |
| 131 | 3300046517 | Ga0495630_0000012 | Ga0495630_0000012_89740_91944 | 674 |
| 132 | 3300049571 | Ga0501034_0000255 | Ga0501034_0000255_5048_7375 | 674 |
| 133 | 3300049588 | Ga0501072_0000289 | Ga0501072_0000289_16703_19030 | 674 |
| 134 | 3300047321 | Ga0495676_0017309 | Ga0495676_0017309_3890_6073 | 675 |
| 135 | 3300049571 | Ga0501034_0083967 | Ga0501034_0083967_848_3175 | 675 |
| 136 | 3300005434 | Ga0070709_10018935 | Ga0070709_100189353 | 676 |
| 137 | 3300048903 | Ga0496100_0049371 | Ga0496100_0049371_229_2418 | 676 |
| 138 | 3300048904 | Ga0496101_0025813 | Ga0496101_0025813_669_2858 | 676 |
| 139 | 3300048907 | Ga0496104_0090282 | Ga0496104_0090282_349_2538 | 676 |
| 140 | 3300048917 | Ga0496114_0030515 | Ga0496114_0030515_2209_4398 | 676 |
| 141 | 3300048918 | Ga0496115_0094614 | Ga0496115_0094614_164_2353 | 676 |
| 142 | 3300049574 | Ga0501038_0004356 | Ga0501038_0004356_3183_5378 | 676 |
| 143 | 3300049575 | Ga0501039_0002568 | Ga0501039_0002568_6420_8615 | 676 |
| 144 | 3300049576 | Ga0501040_0000638 | Ga0501040_0000638_6427_8622 | 676 |
| 145 | 3300049578 | Ga0501042_0001542 | Ga0501042_0001542_5031_7226 | 676 |
| 146 | 3300049580 | Ga0501046_0003943 | Ga0501046_0003943_4892_7087 | 676 |
| 147 | 3300049582 | Ga0501048_0001512 | Ga0501048_0001512_4845_7040 | 676 |
| 148 | 3300049584 | Ga0501068_0017721 | Ga0501068_0017721_91_2286 | 676 |
| 149 | 3300049587 | Ga0501071_0008555 | Ga0501071_0008555_2170_4365 | 676 |
| 150 | 3300049590 | Ga0501074_0003243 | Ga0501074_0003243_8515_10710 | 676 |
| 151 | 3300049591 | Ga0501075_0000277 | Ga0501075_0000277_21305_23500 | 676 |
| 152 | 3300049592 | Ga0501076_0001433 | Ga0501076_0001433_8897_11092 | 676 |
| 153 | 3300049593 | Ga0501077_0016032 | Ga0501077_0016032_2087_4282 | 676 |
| 154 | 3300049741 | Ga0501079_0001955 | Ga0501079_0001955_6408_8603 | 676 |
| 155 | 3300049743 | Ga0501081_0001720 | Ga0501081_0001720_7749_9944 | 676 |
| 156 | 3300049822 | Ga0501035_0031684 | Ga0501035_0031684_2137_4332 | 676 |
| 157 | 3300049824 | Ga0501045_0001662 | Ga0501045_0001662_4857_7052 | 676 |
| 158 | 3300054114 | Ga0501084_0002917 | Ga0501084_0002917_7997_10192 | 676 |
| 159 | 3300060353 | Ga0501082_0003080 | Ga0501082_0003080_5173_7368 | 676 |
| 160 | 3300053153 | Ga0500616_0001642 | Ga0500616_0001642_18414_20627 | 678 |
| 161 | 3300046681 | Ga0495647_0001039 | Ga0495647_0001039_3535_5739 | 680 |
| 162 | 3300005842 | Ga0068858_100000353 | Ga0068858_10000035348 | 682 |
| 163 | 3300026035 | Ga0207703_10000339 | Ga0207703_1000033947 | 682 |
| 164 | 3300005329 | Ga0070683_100010142 | Ga0070683_1000101421 | 683 |
| 165 | 3300005455 | Ga0070663_100000454 | Ga0070663_10000045418 | 683 |
| 166 | 3300005530 | Ga0070679_100000982 | Ga0070679_1000009826 | 683 |
| 167 | 3300025912 | Ga0207707_10081654 | Ga0207707_100816541 | 683 |
| 168 | 3300025921 | Ga0207652_10000709 | Ga0207652_100007097 | 683 |
| 169 | 3300025944 | Ga0207661_10040275 | Ga0207661_100402751 | 683 |
| 170 | 3300026067 | Ga0207678_10000436 | Ga0207678_1000043629 | 683 |
| 171 | 3300009101 | Ga0105247_10001002 | Ga0105247_1000100215 | 685 |
| 172 | 3300025900 | Ga0207710_10000461 | Ga0207710_1000046115 | 685 |
| 173 | 3300031251 | Ga0265327_10030218 | Ga0265327_100302182 | 687 |
| 174 | 3300013104 | Ga0157370_10018467 | Ga0157370_100184676 | 690 |
| 175 | 3300047317 | Ga0495604_0000395 | Ga0495604_0000395_34171_36354 | 692 |
| 176 | 3300053077 | Ga0495601_0024182 | Ga0495601_0024182_651_2846 | 692 |
| 177 | 3300017792 | Ga0163161_10012179 | Ga0163161_100121793 | 694 |
| 178 | 3300048913 | Ga0496110_0030094 | Ga0496110_0030094_2367_4550 | 694 |
| 179 | 3300053084 | Ga0495595_0029889 | Ga0495595_0029889_162_2345 | 694 |
| 180 | 3300045976 | Ga0466967_0106253 | Ga0466967_0106253_229_2409 | 697 |
| 181 | 3300013307 | Ga0157372_10000882 | Ga0157372_1000088232 | 698 |
| 182 | 3300005985 | Ga0081539_10002182 | Ga0081539_1000218216 | 701 |
| 183 | 3300046642 | Ga0495634_0001463 | Ga0495634_0001463_11373_13556 | 701 |
| 184 | 3300053077 | Ga0495601_0021604 | Ga0495601_0021604_1346_3532 | 704 |
| 185 | 3300053078 | Ga0495612_0000022 | Ga0495612_0000022_113419_115605 | 704 |
| 186 | 3300053085 | Ga0495619_0013770 | Ga0495619_0013770_1516_3702 | 704 |
| 187 | 3300005457 | Ga0070662_100000342 | Ga0070662_10000034210 | 705 |
| 188 | 3300005458 | Ga0070681_10042542 | Ga0070681_100425424 | 705 |
| 189 | 3300005530 | Ga0070679_100000244 | Ga0070679_10000024426 | 705 |
| 190 | 3300005548 | Ga0070665_100000040 | Ga0070665_100000040258 | 705 |
| 191 | 3300005842 | Ga0068858_100001002 | Ga0068858_10000100212 | 705 |
| 192 | 3300005843 | Ga0068860_100011100 | Ga0068860_1000111003 | 705 |
| 193 | 3300009551 | Ga0105238_10000009 | Ga0105238_1000000963 | 705 |
| 194 | 3300009553 | Ga0105249_10000050 | Ga0105249_10000050114 | 705 |
| 195 | 3300014968 | Ga0157379_10040722 | Ga0157379_100407222 | 705 |
| 196 | 3300025912 | Ga0207707_10012902 | Ga0207707_100129027 | 705 |
| 197 | 3300025921 | Ga0207652_10000395 | Ga0207652_1000039520 | 705 |
| 198 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004232 | 705 |
| 199 | 3300025927 | Ga0207687_10000695 | Ga0207687_1000069519 | 705 |
| 200 | 3300025933 | Ga0207706_10000001 | Ga0207706_10000001161 | 705 |
| 201 | 3300025949 | Ga0207667_10115629 | Ga0207667_101156292 | 705 |
| 202 | 3300025961 | Ga0207712_10000019 | Ga0207712_1000001954 | 705 |
| 203 | 3300026035 | Ga0207703_10000078 | Ga0207703_1000007840 | 705 |
| 204 | 3300028379 | Ga0268266_10000045 | Ga0268266_10000045259 | 705 |
| 205 | 3300028381 | Ga0268264_10007761 | Ga0268264_100077618 | 705 |
| 206 | 3300046678 | Ga0495599_0005015 | Ga0495599_0005015_5462_7678 | 705 |
| 207 | 3300046694 | Ga0495649_0002449 | Ga0495649_0002449_6733_8922 | 705 |
| 208 | 3300047446 | Ga0495679_003327 | Ga0495679_003327_1266_3455 | 705 |
| 209 | 3300048911 | Ga0496108_0000001 | Ga0496108_0000001_881205_883391 | 705 |
| 210 | 3300048912 | Ga0496109_0000004 | Ga0496109_0000004_135016_137202 | 705 |
| 211 | 3300005329 | Ga0070683_100015368 | Ga0070683_1000153682 | 706 |
| 212 | 3300005338 | Ga0068868_100000954 | Ga0068868_1000009548 | 707 |
| 213 | 3300005544 | Ga0070686_100070208 | Ga0070686_1000702081 | 707 |
| 214 | 3300026023 | Ga0207677_10000385 | Ga0207677_100003857 | 707 |
| 215 | 3300005548 | Ga0070665_100010065 | Ga0070665_1000100656 | 708 |
| 216 | 3300028379 | Ga0268266_10002392 | Ga0268266_1000239215 | 708 |
| 217 | 3300005329 | Ga0070683_100008891 | Ga0070683_1000088917 | 709 |
| 218 | 3300005337 | Ga0070682_100000708 | Ga0070682_10000070815 | 709 |
| 219 | 3300005365 | Ga0070688_100001589 | Ga0070688_1000015896 | 709 |
| 220 | 3300005366 | Ga0070659_100026903 | Ga0070659_1000269032 | 709 |
| 221 | 3300005466 | Ga0070685_10001752 | Ga0070685_100017526 | 709 |
| 222 | 3300005535 | Ga0070684_100093248 | Ga0070684_1000932482 | 709 |
| 223 | 3300005578 | Ga0068854_100000065 | Ga0068854_10000006555 | 709 |
| 224 | 3300005834 | Ga0068851_10000355 | Ga0068851_100003557 | 709 |
| 225 | 3300005834 | Ga0068851_10004042 | Ga0068851_100040424 | 709 |
| 226 | 3300009098 | Ga0105245_10013217 | Ga0105245_100132173 | 709 |
| 227 | 3300013102 | Ga0157371_10017938 | Ga0157371_100179385 | 709 |
| 228 | 3300014969 | Ga0157376_10027159 | Ga0157376_100271592 | 709 |
| 229 | 3300025321 | Ga0207656_10000215 | Ga0207656_100002159 | 709 |
| 230 | 3300025927 | Ga0207687_10000412 | Ga0207687_1000041229 | 709 |
| 231 | 3300025932 | Ga0207690_10018634 | Ga0207690_100186343 | 709 |
| 232 | 3300025944 | Ga0207661_10001689 | Ga0207661_100016892 | 709 |
| 233 | 3300025981 | Ga0207640_10000076 | Ga0207640_1000007611 | 709 |
| 234 | 3300026121 | Ga0207683_10004739 | Ga0207683_100047397 | 709 |
| 235 | 3300045976 | Ga0466967_0000019 | Ga0466967_0000019_41821_44022 | 709 |
| 236 | 3300046690 | Ga0495624_0000847 | Ga0495624_0000847_2156_4357 | 709 |
| 237 | 3300046809 | Ga0495600_0027041 | Ga0495600_0027041_1054_3258 | 709 |
| 238 | 3300048911 | Ga0496108_0000005 | Ga0496108_0000005_105027_107222 | 709 |
| 239 | 3300048912 | Ga0496109_0000002 | Ga0496109_0000002_427870_430065 | 709 |
| 240 | 3300048912 | Ga0496109_0000115 | Ga0496109_0000115_53962_56157 | 709 |
| 241 | 3300048913 | Ga0496110_0002910 | Ga0496110_0002910_9146_11350 | 709 |
| 242 | 3300048914 | Ga0496111_0000014 | Ga0496111_0000014_61798_64002 | 709 |
| 243 | 3300048915 | Ga0496112_0014652 | Ga0496112_0014652_4871_7075 | 709 |
| 244 | 3300048916 | Ga0496113_0000052 | Ga0496113_0000052_7570_9774 | 709 |
| 245 | 3300053085 | Ga0495619_0000037 | Ga0495619_0000037_111335_113539 | 709 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7nvh-assembly1.cif.gz_A | cryo-em structure of the mycolic acid transporter mmpl3 from m. tuberculosis | 0.8367 | 2 | 685 |
| 7k7m-assembly2.cif.gz_B | crystal structure of a membrane protein | 0.8304 | 2 | 681 |
| 8qkk-assembly1.cif.gz_A | cryo-em structure of mmpl3 from mycobacterium smegmatis reconstituted into peptidiscs | 0.8296 | 2 | 672 |
| 7n6b-assembly1.cif.gz_A | structure of mmpl3 reconstituted into lipid nanodisc in the tmm bound state | 0.8206 | 2 | 681 |
| 7k8b-assembly1.cif.gz_A | cryoem structure of a trehalose monomycolate transporter in lipid nanodiscs | 0.8193 | 4 | 681 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FV70_468_685_1.20.1640.10 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.972 | 452 | 669 | 1.20.1640.10 |
| af_P9WJT9_146_343_1.20.1640.10 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.9684 | 176 | 307 | 1.20.1640.10 |
| af_P9WJV5_535_729_1.20.1640.10 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.9675 | 481 | 668 | 1.20.1640.10 |
| af_Q2FV70_468_685_1.20.1640.10 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.9633 | 452 | 669 | 1.20.1640.10 |
| af_Q4DFK7_607_812_1.20.1640.10 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.9559 | 489 | 665 | 1.20.1640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5B8U2W3-F1-model_v4 | MMPL family transporter | 0.9569 | 1 | 700 |
GO:0005886
|
| AF-A0A1M3BH10-F1-model_v4 | SSD domain-containing protein | 0.9484 | 1 | 699 |
GO:0005886
|
| AF-A0A3N1A6P7-F1-model_v4 | RND superfamily putative drug exporter | 0.9449 | 2 | 672 |
GO:0005886
|
| AF-A0A5B8U2W3-F1-model_v4 | MMPL family transporter | 0.9438 | 1 | 700 |
GO:0005886
|
| AF-A0A6B3CV21-F1-model_v4 | MMPL family transporter | 0.9421 | 396 | 501 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar