F357696

General Info

Members Datasets Scaffolds Average Seq Length
245 176 245 693

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0083967|Ga0501034_0083967_848_3175
Length 759
Sequence MLARLARWSFRRRRLMVFGIWLPFLVLVSVISGAVGSDFHTSFDLPDSESKEVQDVVTAVQPEDAGDVAQIVFTAPQGTDDPAVEAAMTKLFDRGKQFNSTTEPISFAQIQFSERDQAGYLQLADDIQKLDDDIHVDGLTIEYGGQLFGIFEFPESEALGILAAVVILLIAFGSVLAMGLPIGTALFGLGXXXXIVGLSSRVFSMPDFALQMTAMIGXXXGIDYALFIVTRYRENLHAGMDPEAAVVDSVDTSGRAVVFAGITVMISLLGLFVMGIAFVRGLAVAGAIGVLVMMVAAITMLPALLGFVGRRIDNTSRAAXXXXAFFVVLGLLGIFSGLPLAAALLLGAVLAAVVMGVSFLPFGRPLRRALPHRHVKPREQQFWYRWSRFIQHRPWPALAGGLIVMLLLAVPLLSIRLGFGDTGNLSQEQTARRAYDLIAEGFGPGFNGPFVMVSKLPAKGESAGIDELCSTLKQEEGVASVTSVTFNPAKTVGLCSVYPTTSPQSEDTTELLDHIRNDVIPPIESKTGTVLHVGGITAIFEDFGDAISEKLPLFIGVVILLSAILLMAVFRSVLVPLKAIVMNLLSIGAAFGIVTAVFQHGWGASIIGVDQTGPIIAFFPIFLFSIVFGLSMDYEVFLMSRIHEEWEHKKNASEAVTRGLALTGRVITAAALIMITVFASFMLGDERIVKLFGLGLSSAVLVDALIIRSVLVPAIMQLFGTKAWWMPEWLSKVLPNLAVEPAAHHHDGTAEPAVATESE

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
78 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
79 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
80 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
81 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
82 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
83 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
89 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
90 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
91 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
94 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
117 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
118 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
169 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
172 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
176 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0
Rhizoplane 11.02
Rhizosphere 87.76
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100008891 3300005329 Bacteria 8557
2 Ga0070683_100010142 3300005329 Bacteria 8086
3 Ga0070683_100015368 3300005329 Bacteria 6722
4 Ga0070666_10026450 3300005335 Bacteria 3791
5 Ga0070682_100000017 3300005337 Bacteria 235228
6 Ga0070682_100000708 3300005337 Bacteria 19980
7 Ga0068868_100000954 3300005338 Bacteria 19677
8 Ga0070691_10000001 3300005341 Bacteria 94744
9 Ga0070668_100063607 3300005347 Bacteria 2860
10 Ga0070674_100000005 3300005356 Bacteria 168443
11 Ga0070688_100001589 3300005365 Bacteria 11359
12 Ga0070659_100026903 3300005366 Bacteria 4428
13 Ga0070667_100003792 3300005367 Bacteria 12859
14 Ga0070667_100059312 3300005367 Bacteria 3237
15 Ga0070709_10018935 3300005434 Bacteria 3972
16 Ga0070663_100000454 3300005455 Bacteria 21701
17 Ga0070662_100000342 3300005457 Bacteria 27963
18 Ga0070681_10042542 3300005458 Bacteria 4552
19 Ga0070685_10001752 3300005466 Bacteria 11359
20 Ga0070679_100000244 3300005530 Bacteria 45433
21 Ga0070679_100000982 3300005530 Bacteria 24847
22 Ga0070684_100093248 3300005535 Bacteria 2680
23 Ga0070686_100070208 3300005544 Bacteria 2290
24 Ga0070693_100001368 3300005547 Bacteria 10985
25 Ga0070665_100000040 3300005548 Bacteria 305480
26 Ga0070665_100010065 3300005548 Bacteria 9570
27 Ga0068854_100000065 3300005578 Bacteria 76046
28 Ga0068856_100096358 3300005614 Bacteria 2947
29 Ga0068852_100000094 3300005616 Bacteria 59653
30 Ga0068866_10000340 3300005718 Bacteria 22024
31 Ga0068851_10000355 3300005834 Bacteria 20703
32 Ga0068851_10004042 3300005834 Bacteria 6584
33 Ga0068863_100000170 3300005841 Bacteria 70180
34 Ga0068858_100000353 3300005842 Bacteria 48412
35 Ga0068858_100001002 3300005842 Bacteria 29191
36 Ga0068860_100011100 3300005843 Bacteria 8880
37 Ga0068862_100000891 3300005844 Bacteria 28985
38 Ga0081455_10014182 3300005937 Bacteria 7826
39 Ga0081539_10002182 3300005985 Bacteria 28755
40 Ga0075428_100080735 3300006844 Bacteria 3549
41 Ga0075430_100009376 3300006846 Bacteria 8274
42 Ga0075429_100008150 3300006880 Bacteria 9108
43 Ga0068865_100000013 3300006881 Bacteria 141352
44 Ga0105245_10001072 3300009098 Bacteria 24802
45 Ga0105245_10013217 3300009098 Bacteria 7192
46 Ga0105245_10022169 3300009098 Bacteria 5577
47 Ga0105247_10001002 3300009101 Bacteria 21329
48 Ga0114129_10102484 3300009147 Bacteria 3958
49 Ga0105248_10000008 3300009177 Bacteria 403910
50 Ga0105238_10000009 3300009551 Bacteria 288729
51 Ga0105249_10000050 3300009553 Bacteria 169617
52 Ga0105249_10004494 3300009553 Bacteria 12059
53 Ga0157371_10017938 3300013102 Bacteria 5246
54 Ga0157370_10018467 3300013104 Bacteria 7011
55 Ga0157374_10000678 3300013296 Bacteria 29993
56 Ga0157372_10000882 3300013307 Bacteria 32603
57 Ga0157379_10040722 3300014968 Bacteria 4147
58 Ga0157376_10027159 3300014969 Bacteria 4534
59 Ga0163161_10000021 3300017792 Bacteria 208779
60 Ga0163161_10012179 3300017792 Bacteria 5965
61 Ga0207656_10000215 3300025321 Bacteria 20720
62 Ga0207642_10001965 3300025899 Bacteria 6347
63 Ga0207710_10000461 3300025900 Bacteria 26087
64 Ga0207680_10006566 3300025903 Bacteria 5636
65 Ga0207707_10012902 3300025912 Bacteria 7273
66 Ga0207707_10081654 3300025912 Bacteria 2822
67 Ga0207652_10000395 3300025921 Bacteria 45460
68 Ga0207652_10000709 3300025921 Bacteria 32351
69 Ga0207694_10000004 3300025924 Bacteria 967075
70 Ga0207687_10000031 3300025927 Bacteria 150246
71 Ga0207687_10000412 3300025927 Bacteria 29013
72 Ga0207687_10000695 3300025927 Bacteria 22726
73 Ga0207690_10018634 3300025932 Bacteria 4258
74 Ga0207706_10000001 3300025933 Bacteria 423014
75 Ga0207669_10000006 3300025937 Bacteria 176348
76 Ga0207704_10000040 3300025938 Bacteria 90178
77 Ga0207711_10000006 3300025941 Bacteria 792692
78 Ga0207661_10001689 3300025944 Bacteria 15060
79 Ga0207661_10040275 3300025944 Bacteria 3672
80 Ga0207667_10115629 3300025949 Bacteria 2765
81 Ga0207712_10000019 3300025961 Bacteria 317060
82 Ga0207712_10018932 3300025961 Bacteria 4491
83 Ga0207668_10001873 3300025972 Bacteria 12291
84 Ga0207640_10000076 3300025981 Bacteria 76366
85 Ga0207658_10001829 3300025986 Bacteria 15927
86 Ga0207658_10005232 3300025986 Bacteria 8924
87 Ga0207677_10000385 3300026023 Bacteria 30475
88 Ga0207703_10000078 3300026035 Bacteria 115634
89 Ga0207703_10000339 3300026035 Bacteria 50936
90 Ga0207678_10000436 3300026067 Bacteria 37859
91 Ga0207702_10004702 3300026078 Bacteria 12068
92 Ga0207641_10000301 3300026088 Bacteria 61780
93 Ga0207683_10004739 3300026121 Bacteria 11718
94 Ga0207698_10000013 3300026142 Bacteria 255414
95 Ga0268266_10000045 3300028379 Bacteria 312955
96 Ga0268266_10000114 3300028379 Bacteria 166519
97 Ga0268266_10002392 3300028379 Bacteria 20242
98 Ga0268264_10007761 3300028381 Bacteria 8934
99 Ga0265326_10000072 3300028558 Bacteria 57044
100 Ga0265322_10000001 3300028654 Bacteria 543854
101 Ga0265336_10002644 3300028666 Bacteria 7274
102 Ga0265324_10001524 3300029957 Bacteria 13044
103 Ga0265328_10003027 3300031239 Bacteria 7503
104 Ga0265320_10000002 3300031240 Bacteria 542875
105 Ga0265331_10000921 3300031250 Bacteria 23544
106 Ga0265327_10000011 3300031251 Bacteria 543807
107 Ga0265327_10030218 3300031251 Bacteria 3066
108 Ga0265316_10031056 3300031344 Bacteria 4372
109 Ga0265314_10000487 3300031711 Bacteria 51708
110 Ga0436365_1730663 3300039437 Bacteria 10846
111 Ga0439448_0003424 3300042005 Bacteria 4395
112 Ga0439463_006222 3300042016 Bacteria 2959
113 Ga0439460_0003510 3300042461 Bacteria 3793
114 Ga0466965_0031475 3300044683 Bacteria 2587
115 Ga0466963_0040945 3300044694 Bacteria 3037
116 Ga0466964_0010644 3300044706 Bacteria 3469
117 Ga0466971_0026179 3300044719 Bacteria 2605
118 Ga0466957_0019530 3300044842 Bacteria 3985
119 Ga0466958_0037473 3300045836 Bacteria 2905
120 Ga0466967_0000019 3300045976 Bacteria 79629
121 Ga0466967_0106253 3300045976 Bacteria 2573
122 Ga0495592_0009914 3300046454 Bacteria 7172
123 Ga0495629_0001331 3300046459 Bacteria 19420
124 Ga0495629_0005118 3300046459 Bacteria 9803
125 Ga0495641_0000050 3300046461 Bacteria 73259
126 Ga0495641_0016393 3300046461 Bacteria 3906
127 Ga0495582_0000004 3300046473 Bacteria 168322
128 Ga0495662_0000102 3300046476 Bacteria 31112
129 Ga0495606_0000108 3300046507 Bacteria 140473
130 Ga0495608_0000288 3300046511 Bacteria 35332
131 Ga0495618_0000134 3300046514 Bacteria 53541
132 Ga0495628_0003282 3300046516 Bacteria 14470
133 Ga0495628_0070820 3300046516 Bacteria 2718
134 Ga0495630_0000012 3300046517 Bacteria 223330
135 Ga0495630_0002527 3300046517 Bacteria 12688
136 Ga0495630_0011471 3300046517 Bacteria 6417
137 Ga0495652_0041765 3300046529 Bacteria 3957
138 Ga0495640_0007254 3300046533 Bacteria 8734
139 Ga0495586_0000426 3300046535 Bacteria 25579
140 Ga0495587_0008704 3300046536 Bacteria 6515
141 Ga0495645_0010222 3300046543 Bacteria 6575
142 Ga0495634_0001463 3300046642 Bacteria 20931
143 Ga0495625_0002906 3300046660 Bacteria 17907
144 Ga0495635_0000034 3300046663 Bacteria 96408
145 Ga0495657_0019003 3300046675 Bacteria 4965
146 Ga0495657_0065017 3300046675 Bacteria 2400
147 Ga0495599_0005015 3300046678 Bacteria 7877
148 Ga0495599_0067963 3300046678 Bacteria 2225
149 Ga0495647_0000016 3300046681 Bacteria 86316
150 Ga0495647_0001039 3300046681 Bacteria 8460
151 Ga0495658_0000004 3300046683 Bacteria 173598
152 Ga0495669_0000580 3300046684 Bacteria 16226
153 Ga0495613_0000083 3300046689 Bacteria 90138
154 Ga0495624_0000024 3300046690 Bacteria 98577
155 Ga0495624_0000847 3300046690 Bacteria 24263
156 Ga0495649_0002449 3300046694 Bacteria 13064
157 Ga0495600_0010795 3300046809 Bacteria 5679
158 Ga0495600_0027041 3300046809 Bacteria 3706
159 Ga0495604_0000395 3300047317 Bacteria 39441
160 Ga0495676_0000127 3300047321 Bacteria 57750
161 Ga0495676_0016222 3300047321 Bacteria 6616
162 Ga0495676_0017309 3300047321 Bacteria 6376
163 Ga0495680_0000569 3300047322 Bacteria 41472
164 Ga0495680_0001770 3300047322 Bacteria 22883
165 Ga0495679_003327 3300047446 Bacteria 7769
166 Ga0495602_0036818 3300048088 Bacteria 4549
167 Ga0496100_0000005 3300048903 Bacteria 312112
168 Ga0496100_0049371 3300048903 Bacteria 2721
169 Ga0496101_0000022 3300048904 Bacteria 216728
170 Ga0496101_0025813 3300048904 Bacteria 4079
171 Ga0496104_0000009 3300048907 Bacteria 488055
172 Ga0496104_0000462 3300048907 Bacteria 35037
173 Ga0496104_0090282 3300048907 Bacteria 2927
174 Ga0496105_0000007 3300048908 Bacteria 339658
175 Ga0496106_0000108 3300048909 Bacteria 64484
176 Ga0496106_0000464 3300048909 Bacteria 29073
177 Ga0496107_0000011 3300048910 Bacteria 201631
178 Ga0496108_0000001 3300048911 Bacteria 919044
179 Ga0496108_0000005 3300048911 Bacteria 535059
180 Ga0496108_0010280 3300048911 Bacteria 7596
181 Ga0496109_0000002 3300048912 Bacteria 443393
182 Ga0496109_0000004 3300048912 Bacteria 404818
183 Ga0496109_0000115 3300048912 Bacteria 82707
184 Ga0496110_0002910 3300048913 Bacteria 12960
185 Ga0496110_0030094 3300048913 Bacteria 4678
186 Ga0496111_0000014 3300048914 Bacteria 80292
187 Ga0496112_0014652 3300048915 Bacteria 7286
188 Ga0496113_0000052 3300048916 Bacteria 49918
189 Ga0496114_0000133 3300048917 Bacteria 53994
190 Ga0496114_0030515 3300048917 Bacteria 4436
191 Ga0496114_0043236 3300048917 Bacteria 3736
192 Ga0496115_0000506 3300048918 Bacteria 30541
193 Ga0496115_0094614 3300048918 Bacteria 2444
194 Ga0501033_0022427 3300049570 Bacteria 4763
195 Ga0501034_0000255 3300049571 Bacteria 97887
196 Ga0501034_0083967 3300049571 Bacteria 3187
197 Ga0501036_0077406 3300049572 Bacteria 2814
198 Ga0501038_0004356 3300049574 Bacteria 13173
199 Ga0501039_0002568 3300049575 Bacteria 13557
200 Ga0501040_0000638 3300049576 Bacteria 21462
201 Ga0501040_0045389 3300049576 Bacteria 2997
202 Ga0501041_0069021 3300049577 Bacteria 2167
203 Ga0501042_0001542 3300049578 Bacteria 13649
204 Ga0501042_0006726 3300049578 Bacteria 7494
205 Ga0501046_0003943 3300049580 Bacteria 13554
206 Ga0501048_0001512 3300049582 Bacteria 17604
207 Ga0501048_0043036 3300049582 Bacteria 3232
208 Ga0501068_0017721 3300049584 Bacteria 4121
209 Ga0501071_0008555 3300049587 Bacteria 6767
210 Ga0501071_0066039 3300049587 Bacteria 2628
211 Ga0501072_0000289 3300049588 Bacteria 36033
212 Ga0501072_0028494 3300049588 Bacteria 4360
213 Ga0501074_0003243 3300049590 Bacteria 11494
214 Ga0501075_0000277 3300049591 Bacteria 28298
215 Ga0501075_0092909 3300049591 Bacteria 2290
216 Ga0501076_0001433 3300049592 Bacteria 16010
217 Ga0501076_0010069 3300049592 Bacteria 6998
218 Ga0501077_0016032 3300049593 Bacteria 4720
219 Ga0501079_0001955 3300049741 Bacteria 14761
220 Ga0501079_0022863 3300049741 Bacteria 4799
221 Ga0501079_0050946 3300049741 Bacteria 3195
222 Ga0501081_0001720 3300049743 Bacteria 13589
223 Ga0501035_0031684 3300049822 Bacteria 4815
224 Ga0501045_0001662 3300049824 Bacteria 14952
225 Ga0501045_0047397 3300049824 Bacteria 3130
226 nmdc:mga05p37_222939_c1 3300050507 Bacteria 2275
227 nmdc:mga09592_18825_c1 3300050508 Bacteria 5665
228 nmdc:mga09592_51642_c1 3300050508 Bacteria 3469
229 Ga0495601_0001717 3300053077 Bacteria 12112
230 Ga0495601_0003080 3300053077 Bacteria 9512
231 Ga0495601_0021604 3300053077 Bacteria 3942
232 Ga0495601_0024182 3300053077 Bacteria 3740
233 Ga0495612_0000022 3300053078 Bacteria 119126
234 Ga0495595_0004637 3300053084 Bacteria 5525
235 Ga0495595_0029889 3300053084 Bacteria 2441
236 Ga0495619_0000037 3300053085 Bacteria 124007
237 Ga0495619_0001853 3300053085 Bacteria 14075
238 Ga0495619_0013770 3300053085 Bacteria 5102
239 Ga0500566_0001686 3300053094 Bacteria 12959
240 Ga0500616_0001642 3300053153 Bacteria 20699
241 Ga0501084_0002917 3300054114 Bacteria 13845
242 Ga0501084_0036740 3300054114 Bacteria 4093
243 Ga0501082_0003080 3300060353 Bacteria 14544
244 Ga0466962_0024952 3300061719 Bacteria 2870
245 Ga0530510_0009982 3300061734 Bacteria 6661

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049577 Ga0501041_0069021 Ga0501041_0069021_16_1911 530
2 3300050507 nmdc:mga05p37_222939_c1 nmdc:mga05p37_222939_c1_21_1907 539
3 3300044683 Ga0466965_0031475 Ga0466965_0031475_275_2467 586
4 3300044694 Ga0466963_0040945 Ga0466963_0040945_216_2408 586
5 3300044706 Ga0466964_0010644 Ga0466964_0010644_945_3137 586
6 3300044719 Ga0466971_0026179 Ga0466971_0026179_254_2446 586
7 3300044842 Ga0466957_0019530 Ga0466957_0019530_418_2610 586
8 3300045836 Ga0466958_0037473 Ga0466958_0037473_402_2594 586
9 3300061719 Ga0466962_0024952 Ga0466962_0024952_253_2445 586
10 3300046678 Ga0495599_0067963 Ga0495599_0067963_44_1975 589
11 3300042005 Ga0439448_0003424 Ga0439448_0003424_844_3069 597
12 3300042461 Ga0439460_0003510 Ga0439460_0003510_628_2853 597
13 3300005937 Ga0081455_10014182 Ga0081455_100141827 598
14 3300006844 Ga0075428_100080735 Ga0075428_1000807352 603
15 3300006846 Ga0075430_100009376 Ga0075430_1000093766 619
16 3300042016 Ga0439463_006222 Ga0439463_006222_25_2250 619
17 3300006880 Ga0075429_100008150 Ga0075429_1000081502 625
18 3300009147 Ga0114129_10102484 Ga0114129_101024841 625
19 3300050508 nmdc:mga09592_18825_c1 nmdc:mga09592_18825_c1_3275_5464 625
20 3300050508 nmdc:mga09592_51642_c1 nmdc:mga09592_51642_c1_48_2237 625
21 3300039437 Ga0436365_1730663 Ga0436365_1730663_8482_10755 628
22 3300049572 Ga0501036_0077406 Ga0501036_0077406_212_2425 631
23 3300049576 Ga0501040_0045389 Ga0501040_0045389_279_2492 631
24 3300049578 Ga0501042_0006726 Ga0501042_0006726_3306_5519 631
25 3300049587 Ga0501071_0066039 Ga0501071_0066039_401_2614 631
26 3300049588 Ga0501072_0028494 Ga0501072_0028494_1008_3221 631
27 3300049591 Ga0501075_0092909 Ga0501075_0092909_45_2258 631
28 3300049592 Ga0501076_0010069 Ga0501076_0010069_881_3094 631
29 3300049741 Ga0501079_0022863 Ga0501079_0022863_2108_4321 631
30 3300049824 Ga0501045_0047397 Ga0501045_0047397_149_2362 631
31 3300046535 Ga0495586_0000426 Ga0495586_0000426_1017_3200 633
32 3300046517 Ga0495630_0011471 Ga0495630_0011471_2222_4432 635
33 3300013296 Ga0157374_10000678 Ga0157374_1000067812 638
34 3300028558 Ga0265326_10000072 Ga0265326_1000007240 638
35 3300028654 Ga0265322_10000001 Ga0265322_10000001538 638
36 3300028666 Ga0265336_10002644 Ga0265336_100026444 638
37 3300029957 Ga0265324_10001524 Ga0265324_1000152410 638
38 3300031239 Ga0265328_10003027 Ga0265328_100030277 638
39 3300031240 Ga0265320_10000002 Ga0265320_10000002537 638
40 3300031250 Ga0265331_10000921 Ga0265331_1000092110 638
41 3300031251 Ga0265327_10000011 Ga0265327_10000011537 638
42 3300031344 Ga0265316_10031056 Ga0265316_100310562 638
43 3300031711 Ga0265314_10000487 Ga0265314_1000048727 638
44 3300049570 Ga0501033_0022427 Ga0501033_0022427_396_2732 641
45 3300049582 Ga0501048_0043036 Ga0501048_0043036_301_2637 641
46 3300049741 Ga0501079_0050946 Ga0501079_0050946_617_2953 641
47 3300054114 Ga0501084_0036740 Ga0501084_0036740_690_3026 641
48 3300061734 Ga0530510_0009982 Ga0530510_0009982_1873_4209 641
49 3300017792 Ga0163161_10000021 Ga0163161_1000002160 643
50 3300047321 Ga0495676_0016222 Ga0495676_0016222_1918_4107 644
51 3300048903 Ga0496100_0000005 Ga0496100_0000005_129102_131291 644
52 3300048904 Ga0496101_0000022 Ga0496101_0000022_110395_112584 644
53 3300048909 Ga0496106_0000108 Ga0496106_0000108_13014_15203 644
54 3300048910 Ga0496107_0000011 Ga0496107_0000011_180592_182781 644
55 3300046473 Ga0495582_0000004 Ga0495582_0000004_111704_113824 645
56 3300046683 Ga0495658_0000004 Ga0495658_0000004_25732_27852 645
57 3300047321 Ga0495676_0000127 Ga0495676_0000127_51114_53303 645
58 3300048909 Ga0496106_0000464 Ga0496106_0000464_3615_5801 646
59 3300046675 Ga0495657_0065017 Ga0495657_0065017_13_2112 648
60 3300046681 Ga0495647_0000016 Ga0495647_0000016_79413_81596 649
61 3300048917 Ga0496114_0000133 Ga0496114_0000133_15643_17832 649
62 3300048918 Ga0496115_0000506 Ga0496115_0000506_14096_16285 649
63 3300005547 Ga0070693_100001368 Ga0070693_1000013683 650
64 3300048088 Ga0495602_0036818 Ga0495602_0036818_1745_3979 652
65 3300005347 Ga0070668_100063607 Ga0070668_1000636072 653
66 3300005367 Ga0070667_100003792 Ga0070667_1000037926 653
67 3300005844 Ga0068862_100000891 Ga0068862_1000008916 653
68 3300009553 Ga0105249_10004494 Ga0105249_100044949 653
69 3300025961 Ga0207712_10018932 Ga0207712_100189322 653
70 3300025972 Ga0207668_10001873 Ga0207668_100018735 653
71 3300025986 Ga0207658_10001829 Ga0207658_100018299 653
72 3300046516 Ga0495628_0070820 Ga0495628_0070820_479_2668 654
73 3300046536 Ga0495587_0008704 Ga0495587_0008704_2864_5053 654
74 3300009098 Ga0105245_10022169 Ga0105245_100221693 655
75 3300046461 Ga0495641_0000050 Ga0495641_0000050_40042_42231 655
76 3300047322 Ga0495680_0001770 Ga0495680_0001770_38_2227 655
77 3300046533 Ga0495640_0007254 Ga0495640_0007254_865_3057 658
78 3300047322 Ga0495680_0000569 Ga0495680_0000569_6960_9143 658
79 3300053077 Ga0495601_0003080 Ga0495601_0003080_627_2804 658
80 3300046454 Ga0495592_0009914 Ga0495592_0009914_2213_4393 659
81 3300046476 Ga0495662_0000102 Ga0495662_0000102_2230_4413 659
82 3300046511 Ga0495608_0000288 Ga0495608_0000288_14211_16391 659
83 3300046514 Ga0495618_0000134 Ga0495618_0000134_36208_38391 659
84 3300046516 Ga0495628_0003282 Ga0495628_0003282_5440_7632 659
85 3300046675 Ga0495657_0019003 Ga0495657_0019003_482_2665 659
86 3300046684 Ga0495669_0000580 Ga0495669_0000580_10043_12226 659
87 3300046689 Ga0495613_0000083 Ga0495613_0000083_15731_17914 659
88 3300046809 Ga0495600_0010795 Ga0495600_0010795_1285_3468 659
89 3300053084 Ga0495595_0004637 Ga0495595_0004637_2289_4472 659
90 3300046663 Ga0495635_0000034 Ga0495635_0000034_18891_21074 660
91 3300046461 Ga0495641_0016393 Ga0495641_0016393_314_2488 661
92 3300046517 Ga0495630_0002527 Ga0495630_0002527_1247_3427 661
93 3300053077 Ga0495601_0001717 Ga0495601_0001717_7950_10130 661
94 3300005356 Ga0070674_100000005 Ga0070674_100000005141 664
95 3300005718 Ga0068866_10000340 Ga0068866_100003406 664
96 3300025899 Ga0207642_10001965 Ga0207642_100019657 664
97 3300025937 Ga0207669_10000006 Ga0207669_1000000652 664
98 3300046529 Ga0495652_0041765 Ga0495652_0041765_813_2999 664
99 3300046543 Ga0495645_0010222 Ga0495645_0010222_1520_3706 664
100 3300048907 Ga0496104_0000009 Ga0496104_0000009_442681_444867 664
101 3300048908 Ga0496105_0000007 Ga0496105_0000007_43189_45375 664
102 3300005337 Ga0070682_100000017 Ga0070682_10000001760 666
103 3300046690 Ga0495624_0000024 Ga0495624_0000024_25946_28129 666
104 3300048907 Ga0496104_0000462 Ga0496104_0000462_24770_26965 666
105 3300048917 Ga0496114_0043236 Ga0496114_0043236_1460_3643 666
106 3300005341 Ga0070691_10000001 Ga0070691_100000015 667
107 3300005616 Ga0068852_100000094 Ga0068852_10000009440 667
108 3300026142 Ga0207698_10000013 Ga0207698_10000013226 667
109 3300048911 Ga0496108_0010280 Ga0496108_0010280_864_3026 667
110 3300005335 Ga0070666_10026450 Ga0070666_100264502 668
111 3300025903 Ga0207680_10006566 Ga0207680_100065662 668
112 3300025986 Ga0207658_10005232 Ga0207658_100052324 668
113 3300028379 Ga0268266_10000114 Ga0268266_10000114136 668
114 3300005614 Ga0068856_100096358 Ga0068856_1000963582 669
115 3300009177 Ga0105248_10000008 Ga0105248_10000008118 669
116 3300025941 Ga0207711_10000006 Ga0207711_10000006514 669
117 3300026078 Ga0207702_10004702 Ga0207702_1000470213 669
118 3300053085 Ga0495619_0001853 Ga0495619_0001853_11553_13715 669
119 3300046459 Ga0495629_0005118 Ga0495629_0005118_2229_4418 670
120 3300053094 Ga0500566_0001686 Ga0500566_0001686_2000_4189 670
121 3300005367 Ga0070667_100059312 Ga0070667_1000593121 671
122 3300005841 Ga0068863_100000170 Ga0068863_10000017056 671
123 3300026088 Ga0207641_10000301 Ga0207641_100003013 671
124 3300006881 Ga0068865_100000013 Ga0068865_10000001369 673
125 3300025938 Ga0207704_10000040 Ga0207704_1000004065 673
126 3300046507 Ga0495606_0000108 Ga0495606_0000108_13388_15583 673
127 3300046660 Ga0495625_0002906 Ga0495625_0002906_8516_10693 673
128 3300009098 Ga0105245_10001072 Ga0105245_1000107218 674
129 3300025927 Ga0207687_10000031 Ga0207687_1000003118 674
130 3300046459 Ga0495629_0001331 Ga0495629_0001331_3817_6021 674
131 3300046517 Ga0495630_0000012 Ga0495630_0000012_89740_91944 674
132 3300049571 Ga0501034_0000255 Ga0501034_0000255_5048_7375 674
133 3300049588 Ga0501072_0000289 Ga0501072_0000289_16703_19030 674
134 3300047321 Ga0495676_0017309 Ga0495676_0017309_3890_6073 675
135 3300049571 Ga0501034_0083967 Ga0501034_0083967_848_3175 675
136 3300005434 Ga0070709_10018935 Ga0070709_100189353 676
137 3300048903 Ga0496100_0049371 Ga0496100_0049371_229_2418 676
138 3300048904 Ga0496101_0025813 Ga0496101_0025813_669_2858 676
139 3300048907 Ga0496104_0090282 Ga0496104_0090282_349_2538 676
140 3300048917 Ga0496114_0030515 Ga0496114_0030515_2209_4398 676
141 3300048918 Ga0496115_0094614 Ga0496115_0094614_164_2353 676
142 3300049574 Ga0501038_0004356 Ga0501038_0004356_3183_5378 676
143 3300049575 Ga0501039_0002568 Ga0501039_0002568_6420_8615 676
144 3300049576 Ga0501040_0000638 Ga0501040_0000638_6427_8622 676
145 3300049578 Ga0501042_0001542 Ga0501042_0001542_5031_7226 676
146 3300049580 Ga0501046_0003943 Ga0501046_0003943_4892_7087 676
147 3300049582 Ga0501048_0001512 Ga0501048_0001512_4845_7040 676
148 3300049584 Ga0501068_0017721 Ga0501068_0017721_91_2286 676
149 3300049587 Ga0501071_0008555 Ga0501071_0008555_2170_4365 676
150 3300049590 Ga0501074_0003243 Ga0501074_0003243_8515_10710 676
151 3300049591 Ga0501075_0000277 Ga0501075_0000277_21305_23500 676
152 3300049592 Ga0501076_0001433 Ga0501076_0001433_8897_11092 676
153 3300049593 Ga0501077_0016032 Ga0501077_0016032_2087_4282 676
154 3300049741 Ga0501079_0001955 Ga0501079_0001955_6408_8603 676
155 3300049743 Ga0501081_0001720 Ga0501081_0001720_7749_9944 676
156 3300049822 Ga0501035_0031684 Ga0501035_0031684_2137_4332 676
157 3300049824 Ga0501045_0001662 Ga0501045_0001662_4857_7052 676
158 3300054114 Ga0501084_0002917 Ga0501084_0002917_7997_10192 676
159 3300060353 Ga0501082_0003080 Ga0501082_0003080_5173_7368 676
160 3300053153 Ga0500616_0001642 Ga0500616_0001642_18414_20627 678
161 3300046681 Ga0495647_0001039 Ga0495647_0001039_3535_5739 680
162 3300005842 Ga0068858_100000353 Ga0068858_10000035348 682
163 3300026035 Ga0207703_10000339 Ga0207703_1000033947 682
164 3300005329 Ga0070683_100010142 Ga0070683_1000101421 683
165 3300005455 Ga0070663_100000454 Ga0070663_10000045418 683
166 3300005530 Ga0070679_100000982 Ga0070679_1000009826 683
167 3300025912 Ga0207707_10081654 Ga0207707_100816541 683
168 3300025921 Ga0207652_10000709 Ga0207652_100007097 683
169 3300025944 Ga0207661_10040275 Ga0207661_100402751 683
170 3300026067 Ga0207678_10000436 Ga0207678_1000043629 683
171 3300009101 Ga0105247_10001002 Ga0105247_1000100215 685
172 3300025900 Ga0207710_10000461 Ga0207710_1000046115 685
173 3300031251 Ga0265327_10030218 Ga0265327_100302182 687
174 3300013104 Ga0157370_10018467 Ga0157370_100184676 690
175 3300047317 Ga0495604_0000395 Ga0495604_0000395_34171_36354 692
176 3300053077 Ga0495601_0024182 Ga0495601_0024182_651_2846 692
177 3300017792 Ga0163161_10012179 Ga0163161_100121793 694
178 3300048913 Ga0496110_0030094 Ga0496110_0030094_2367_4550 694
179 3300053084 Ga0495595_0029889 Ga0495595_0029889_162_2345 694
180 3300045976 Ga0466967_0106253 Ga0466967_0106253_229_2409 697
181 3300013307 Ga0157372_10000882 Ga0157372_1000088232 698
182 3300005985 Ga0081539_10002182 Ga0081539_1000218216 701
183 3300046642 Ga0495634_0001463 Ga0495634_0001463_11373_13556 701
184 3300053077 Ga0495601_0021604 Ga0495601_0021604_1346_3532 704
185 3300053078 Ga0495612_0000022 Ga0495612_0000022_113419_115605 704
186 3300053085 Ga0495619_0013770 Ga0495619_0013770_1516_3702 704
187 3300005457 Ga0070662_100000342 Ga0070662_10000034210 705
188 3300005458 Ga0070681_10042542 Ga0070681_100425424 705
189 3300005530 Ga0070679_100000244 Ga0070679_10000024426 705
190 3300005548 Ga0070665_100000040 Ga0070665_100000040258 705
191 3300005842 Ga0068858_100001002 Ga0068858_10000100212 705
192 3300005843 Ga0068860_100011100 Ga0068860_1000111003 705
193 3300009551 Ga0105238_10000009 Ga0105238_1000000963 705
194 3300009553 Ga0105249_10000050 Ga0105249_10000050114 705
195 3300014968 Ga0157379_10040722 Ga0157379_100407222 705
196 3300025912 Ga0207707_10012902 Ga0207707_100129027 705
197 3300025921 Ga0207652_10000395 Ga0207652_1000039520 705
198 3300025924 Ga0207694_10000004 Ga0207694_10000004232 705
199 3300025927 Ga0207687_10000695 Ga0207687_1000069519 705
200 3300025933 Ga0207706_10000001 Ga0207706_10000001161 705
201 3300025949 Ga0207667_10115629 Ga0207667_101156292 705
202 3300025961 Ga0207712_10000019 Ga0207712_1000001954 705
203 3300026035 Ga0207703_10000078 Ga0207703_1000007840 705
204 3300028379 Ga0268266_10000045 Ga0268266_10000045259 705
205 3300028381 Ga0268264_10007761 Ga0268264_100077618 705
206 3300046678 Ga0495599_0005015 Ga0495599_0005015_5462_7678 705
207 3300046694 Ga0495649_0002449 Ga0495649_0002449_6733_8922 705
208 3300047446 Ga0495679_003327 Ga0495679_003327_1266_3455 705
209 3300048911 Ga0496108_0000001 Ga0496108_0000001_881205_883391 705
210 3300048912 Ga0496109_0000004 Ga0496109_0000004_135016_137202 705
211 3300005329 Ga0070683_100015368 Ga0070683_1000153682 706
212 3300005338 Ga0068868_100000954 Ga0068868_1000009548 707
213 3300005544 Ga0070686_100070208 Ga0070686_1000702081 707
214 3300026023 Ga0207677_10000385 Ga0207677_100003857 707
215 3300005548 Ga0070665_100010065 Ga0070665_1000100656 708
216 3300028379 Ga0268266_10002392 Ga0268266_1000239215 708
217 3300005329 Ga0070683_100008891 Ga0070683_1000088917 709
218 3300005337 Ga0070682_100000708 Ga0070682_10000070815 709
219 3300005365 Ga0070688_100001589 Ga0070688_1000015896 709
220 3300005366 Ga0070659_100026903 Ga0070659_1000269032 709
221 3300005466 Ga0070685_10001752 Ga0070685_100017526 709
222 3300005535 Ga0070684_100093248 Ga0070684_1000932482 709
223 3300005578 Ga0068854_100000065 Ga0068854_10000006555 709
224 3300005834 Ga0068851_10000355 Ga0068851_100003557 709
225 3300005834 Ga0068851_10004042 Ga0068851_100040424 709
226 3300009098 Ga0105245_10013217 Ga0105245_100132173 709
227 3300013102 Ga0157371_10017938 Ga0157371_100179385 709
228 3300014969 Ga0157376_10027159 Ga0157376_100271592 709
229 3300025321 Ga0207656_10000215 Ga0207656_100002159 709
230 3300025927 Ga0207687_10000412 Ga0207687_1000041229 709
231 3300025932 Ga0207690_10018634 Ga0207690_100186343 709
232 3300025944 Ga0207661_10001689 Ga0207661_100016892 709
233 3300025981 Ga0207640_10000076 Ga0207640_1000007611 709
234 3300026121 Ga0207683_10004739 Ga0207683_100047397 709
235 3300045976 Ga0466967_0000019 Ga0466967_0000019_41821_44022 709
236 3300046690 Ga0495624_0000847 Ga0495624_0000847_2156_4357 709
237 3300046809 Ga0495600_0027041 Ga0495600_0027041_1054_3258 709
238 3300048911 Ga0496108_0000005 Ga0496108_0000005_105027_107222 709
239 3300048912 Ga0496109_0000002 Ga0496109_0000002_427870_430065 709
240 3300048912 Ga0496109_0000115 Ga0496109_0000115_53962_56157 709
241 3300048913 Ga0496110_0002910 Ga0496110_0002910_9146_11350 709
242 3300048914 Ga0496111_0000014 Ga0496111_0000014_61798_64002 709
243 3300048915 Ga0496112_0014652 Ga0496112_0014652_4871_7075 709
244 3300048916 Ga0496113_0000052 Ga0496113_0000052_7570_9774 709
245 3300053085 Ga0495619_0000037 Ga0495619_0000037_111335_113539 709

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03176

MMPL

MMPL family

154

397

0.92

PF03176

MMPL

MMPL family

429

736

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nvh-assembly1.cif.gz_A cryo-em structure of the mycolic acid transporter mmpl3 from m. tuberculosis 0.8367 2 685
7k7m-assembly2.cif.gz_B crystal structure of a membrane protein 0.8304 2 681
8qkk-assembly1.cif.gz_A cryo-em structure of mmpl3 from mycobacterium smegmatis reconstituted into peptidiscs 0.8296 2 672
7n6b-assembly1.cif.gz_A structure of mmpl3 reconstituted into lipid nanodisc in the tmm bound state 0.8206 2 681
7k8b-assembly1.cif.gz_A cryoem structure of a trehalose monomycolate transporter in lipid nanodiscs 0.8193 4 681
ID Description Score Start End Superfamily
af_Q2FV70_468_685_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.972 452 669 1.20.1640.10
af_P9WJT9_146_343_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.9684 176 307 1.20.1640.10
af_P9WJV5_535_729_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.9675 481 668 1.20.1640.10
af_Q2FV70_468_685_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.9633 452 669 1.20.1640.10
af_Q4DFK7_607_812_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.9559 489 665 1.20.1640.10
ID Description Score Start End GO Terms
AF-A0A5B8U2W3-F1-model_v4 MMPL family transporter 0.9569 1 700 GO:0005886
AF-A0A1M3BH10-F1-model_v4 SSD domain-containing protein 0.9484 1 699 GO:0005886
AF-A0A3N1A6P7-F1-model_v4 RND superfamily putative drug exporter 0.9449 2 672 GO:0005886
AF-A0A5B8U2W3-F1-model_v4 MMPL family transporter 0.9438 1 700 GO:0005886
AF-A0A6B3CV21-F1-model_v4 MMPL family transporter 0.9421 396 501

Feature Viewer

pLDDT pTM Quality
75.48 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map