F357570

General Info

Members Datasets Scaffolds Average Seq Length
245 150 490 260

Family's Representative Sequence

Representative Sequence 3300041410|Ga0439461_0026007|Ga0439461_0026007_276_1127
Length 283
Sequence MLTRRRSRRPQPQELGTAAVLEIDGASVTIGGRPVLRGVSLTVRAGEFVALMGANGSGKSTLVRAATGLRGLVTGEVRLFGDRLGDFGDWHRIGFVPQRPGAAGGVPASVWEVVASGRLTRRKWLHPLLRDDRAAIRAALEVVGLQDRARDGVATLSGGQQQRVLIARALAGDPELFFLDEPAAGVDLPNQQALADALETLKARGATIVLVAHELGPLSRLVDRAVVMRDGRVAYDGAPLADHEVHGPLFGDHHTHHHEEPGRHAHAPHVAAPLDALGNGDAR

Samples

Sample ID Description Type Environment
1 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
84 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
85 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
86 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
94 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
95 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
99 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
100 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
101 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
112 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
119 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
124 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
125 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
126 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
127 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
128 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
129 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
130 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
131 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
132 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
133 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
134 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
136 2643221561 Nocardioides sp. Root151 Isolate Unclassified
137 2643221576 Nocardioides sp. Root614 Isolate Unclassified
138 2643221590 Nocardioides sp. Root682 Isolate Unclassified
139 2643221615 Nocardioides sp. Root224 Isolate Unclassified
140 2643221617 Nocardioides sp. Root79 Isolate Unclassified
141 2643221620 Nocardioides sp. Root240 Isolate Unclassified
142 2643221641 Nocardioides sp. Root122 Isolate Unclassified
143 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
144 2643221696 Nocardioides sp. Root140 Isolate Unclassified
145 2738541305 Nocardioides sp. CF167 Isolate Unclassified
146 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
147 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
148 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
149 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
150 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.88
Metatranscriptomes 0
Isolates 6.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.9
Nodule 0
Rhizoplane 6.94
Rhizosphere 61.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439461_0026007 3300041410 Bacteria 1192
2 rootL2_10355607 3300003322 Bacteria 1286
3 Ga0070683_100104072 3300005329 Bacteria 2675
4 Ga0070683_100154263 3300005329 Bacteria 2178
5 Ga0070683_100478706 3300005329 Bacteria 1189
6 Ga0070682_100054810 3300005337 Bacteria 2503
7 Ga0068868_100048431 3300005338 Bacteria 3333
8 Ga0070691_10052628 3300005341 Bacteria 1947
9 Ga0070687_100082396 3300005343 Bacteria 1759
10 Ga0070687_100419950 3300005343 Bacteria 882
11 Ga0070692_10020578 3300005345 Bacteria 3200
12 Ga0070668_100028291 3300005347 Bacteria 4256
13 Ga0070669_100285990 3300005353 Bacteria 1322
14 Ga0070675_100055029 3300005354 Bacteria 3275
15 Ga0070701_10008939 3300005438 Bacteria 4362
16 Ga0070708_100112176 3300005445 Bacteria 2507
17 Ga0070663_100195079 3300005455 Bacteria 1578
18 Ga0070678_100096981 3300005456 Bacteria 2276
19 Ga0068867_100021067 3300005459 Bacteria 4650
20 Ga0070707_100224062 3300005468 Bacteria 1831
21 Ga0070698_100006366 3300005471 Bacteria 12815
22 Ga0070684_100067318 3300005535 Bacteria 3145
23 Ga0070672_100002885 3300005543 Bacteria 11054
24 Ga0070664_100266955 3300005564 Bacteria 1541
25 Ga0068854_100198143 3300005578 Bacteria 1577
26 Ga0070702_100077073 3300005615 Bacteria 1986
27 Ga0070702_100194399 3300005615 Bacteria 1338
28 Ga0070702_100484548 3300005615 Bacteria 905
29 Ga0068852_100055362 3300005616 Bacteria 3423
30 Ga0068866_10035737 3300005718 Bacteria 2429
31 Ga0068861_100029934 3300005719 Bacteria 3987
32 Ga0068851_10192876 3300005834 Bacteria 1133
33 Ga0068870_10019804 3300005840 Bacteria 3268
34 Ga0068862_100037712 3300005844 Bacteria 4096
35 Ga0075365_10001232 3300006038 Bacteria 11318
36 Ga0075365_10002778 3300006038 Bacteria 8749
37 Ga0075365_10017251 3300006038 Bacteria 4413
38 Ga0075365_10029842 3300006038 Bacteria 3488
39 Ga0075365_10044008 3300006038 Bacteria 2924
40 Ga0075365_10063642 3300006038 Bacteria 2470
41 Ga0075365_10066496 3300006038 Bacteria 2418
42 Ga0075365_10082488 3300006038 Bacteria 2180
43 Ga0075365_10111788 3300006038 Bacteria 1878
44 Ga0075365_10228566 3300006038 Bacteria 1306
45 Ga0075365_10266563 3300006038 Bacteria 1204
46 Ga0075365_10302861 3300006038 Bacteria 1125
47 Ga0075368_10005717 3300006042 Bacteria 4299
48 Ga0075363_100013906 3300006048 Bacteria 3918
49 Ga0075363_100014686 3300006048 Bacteria 3835
50 Ga0075363_100061854 3300006048 Bacteria 2018
51 Ga0075364_10019565 3300006051 Bacteria 4250
52 Ga0075364_10028980 3300006051 Bacteria 3548
53 Ga0075364_10032255 3300006051 Bacteria 3367
54 Ga0075364_10066921 3300006051 Bacteria 2361
55 Ga0075364_10083463 3300006051 Bacteria 2115
56 Ga0075364_10123441 3300006051 Bacteria 1735
57 Ga0075362_10014731 3300006177 Bacteria 3164
58 Ga0075367_10016390 3300006178 Bacteria 4046
59 Ga0075367_10072133 3300006178 Bacteria 2078
60 Ga0075370_10008621 3300006353 Bacteria 5256
61 Ga0075370_10017679 3300006353 Bacteria 3855
62 Ga0075370_10086359 3300006353 Bacteria 1807
63 Ga0111539_10113095 3300009094 Bacteria 3184
64 Ga0105245_10017372 3300009098 Bacteria 6275
65 Ga0105245_10183698 3300009098 Bacteria 1999
66 Ga0105245_10575671 3300009098 Bacteria 1150
67 Ga0105245_10731940 3300009098 Bacteria 1024
68 Ga0105243_10024435 3300009148 Bacteria 4608
69 Ga0105248_10165302 3300009177 Bacteria 2495
70 Ga0105238_10241104 3300009551 Bacteria 1785
71 Ga0105249_10017899 3300009553 Bacteria 6297
72 Ga0105249_10496352 3300009553 Bacteria 1265
73 Ga0105249_10868842 3300009553 Bacteria 968
74 Ga0105239_10359810 3300010375 Bacteria 1643
75 Ga0157375_10120220 3300013308 Bacteria 2735
76 Ga0157375_10385223 3300013308 Bacteria 1569
77 Ga0157375_10570335 3300013308 Bacteria 1292
78 Ga0157375_10791271 3300013308 Bacteria 1097
79 Ga0163163_10036406 3300014325 Bacteria 4780
80 Ga0157380_10014888 3300014326 Bacteria 5701
81 Ga0157380_10046005 3300014326 Bacteria 3426
82 Ga0157380_10423023 3300014326 Bacteria 1271
83 Ga0157380_10852924 3300014326 Bacteria 933
84 Ga0157377_10058954 3300014745 Bacteria 2186
85 Ga0163161_10036581 3300017792 Bacteria 3516
86 Ga0207642_10067945 3300025899 Bacteria 1684
87 Ga0207688_10012402 3300025901 Bacteria 4636
88 Ga0207688_10071316 3300025901 Bacteria 1972
89 Ga0207643_10002504 3300025908 Bacteria 9928
90 Ga0207662_10128423 3300025918 Bacteria 1596
91 Ga0207657_10255090 3300025919 Bacteria 1397
92 Ga0207659_10049774 3300025926 Bacteria 2973
93 Ga0207659_10174781 3300025926 Bacteria 1697
94 Ga0207687_10078577 3300025927 Bacteria 2376
95 Ga0207709_10014220 3300025935 Bacteria 4392
96 Ga0207709_10596869 3300025935 Bacteria 874
97 Ga0207704_10045687 3300025938 Bacteria 2604
98 Ga0207691_10039854 3300025940 Bacteria 4345
99 Ga0207711_10114547 3300025941 Bacteria 2401
100 Ga0207661_10122538 3300025944 Bacteria 2216
101 Ga0207661_10808943 3300025944 Bacteria 863
102 Ga0207679_10302699 3300025945 Bacteria 1379
103 Ga0207668_10159993 3300025972 Bacteria 1754
104 Ga0207640_10262397 3300025981 Bacteria 1347
105 Ga0207639_10131672 3300026041 Bacteria 2071
106 Ga0207708_10000509 3300026075 Bacteria 29969
107 Ga0207708_10039204 3300026075 Bacteria 3609
108 Ga0207648_10096109 3300026089 Bacteria 2592
109 Ga0207675_100009028 3300026118 Bacteria 9353
110 Ga0207675_100136310 3300026118 Bacteria 2329
111 Ga0207683_10538844 3300026121 Bacteria 1079
112 Ga0207698_10096137 3300026142 Bacteria 2440
113 Ga0209813_10013757 3300027866 Bacteria 2166
114 Ga0207428_10158611 3300027907 Bacteria 1719
115 Ga0268265_10059567 3300028380 Bacteria 2922
116 Ga0307410_10240315 3300031852 Bacteria 1403
117 Ga0307407_10021188 3300031903 Bacteria 3347
118 Ga0307407_10103819 3300031903 Bacteria 1770
119 Ga0307407_10312784 3300031903 Bacteria 1099
120 Ga0307409_100034206 3300031995 Bacteria 3708
121 Ga0307409_100036471 3300031995 Bacteria 3615
122 Ga0307409_100146811 3300031995 Bacteria 2041
123 Ga0307409_100194435 3300031995 Bacteria 1809
124 Ga0307416_100007997 3300032002 Bacteria 6773
125 Ga0307416_100053399 3300032002 Bacteria 3242
126 Ga0307414_10497680 3300032004 Bacteria 1078
127 Ga0307415_100057006 3300032126 Bacteria 2682
128 Ga0307415_100104150 3300032126 Bacteria 2090
129 Ga0307415_100254862 3300032126 Bacteria 1428
130 Ga0395900_0013893 3300037418 Bacteria 8216
131 Ga0395898_0084212 3300037466 Bacteria 3065
132 Ga0395898_0456459 3300037466 Bacteria 1217
133 Ga0395898_0512814 3300037466 Bacteria 1140
134 Ga0395905_0080609 3300037471 Bacteria 3050
135 Ga0395901_0057054 3300038443 Bacteria 4062
136 Ga0451791_0798184 3300041451 Bacteria 1891
137 Ga0439431_0006656 3300041997 Bacteria 2561
138 Ga0439442_011476 3300042002 Bacteria 1805
139 Ga0450907_011527 3300042146 Bacteria 1467
140 Ga0466972_0100838 3300044658 Bacteria 1366
141 Ga0466972_0239111 3300044658 Bacteria 850
142 Ga0466965_0018852 3300044683 Bacteria 3311
143 Ga0466965_0045479 3300044683 Bacteria 2171
144 Ga0466966_0129638 3300044684 Bacteria 1545
145 Ga0466961_0017843 3300044693 Bacteria 4562
146 Ga0466961_0022503 3300044693 Bacteria 4055
147 Ga0466970_0008827 3300044765 Bacteria 5079
148 Ga0466970_0012157 3300044765 Bacteria 4396
149 Ga0466970_0022953 3300044765 Bacteria 3255
150 Ga0466970_0023150 3300044765 Bacteria 3243
151 Ga0466970_0103893 3300044765 Bacteria 1549
152 Ga0466957_0011755 3300044842 Bacteria 5060
153 Ga0466957_0023962 3300044842 Bacteria 3611
154 Ga0466960_0006233 3300044901 Bacteria 4776
155 Ga0466960_0006743 3300044901 Bacteria 4624
156 Ga0466960_0011488 3300044901 Bacteria 3708
157 Ga0466960_0013618 3300044901 Bacteria 3460
158 Ga0466959_0172039 3300045049 Bacteria 1519
159 Ga0466958_0146863 3300045836 Bacteria 1486
160 Ga0466967_0089037 3300045976 Bacteria 2802
161 Ga0466967_0099038 3300045976 Bacteria 2662
162 Ga0466967_0114199 3300045976 Bacteria 2486
163 Ga0466967_0240870 3300045976 Bacteria 1725
164 Ga0495629_0050312 3300046459 Bacteria 2919
165 Ga0495664_0011540 3300046477 Bacteria 4983
166 Ga0495620_0119633 3300046515 Bacteria 1039
167 Ga0496100_0200752 3300048903 Bacteria 1453
168 Ga0496101_0135213 3300048904 Bacteria 1875
169 Ga0496102_0377476 3300048905 Bacteria 1334
170 Ga0496103_0086247 3300048906 Bacteria 1979
171 Ga0496103_0235461 3300048906 Bacteria 1178
172 Ga0496105_0142541 3300048908 Bacteria 1972
173 Ga0496108_0060648 3300048911 Bacteria 3183
174 Ga0496108_0471793 3300048911 Bacteria 1096
175 Ga0496109_0019866 3300048912 Bacteria 5929
176 Ga0496109_0121162 3300048912 Bacteria 2437
177 Ga0496110_0102573 3300048913 Bacteria 2566
178 Ga0496110_0243658 3300048913 Bacteria 1636
179 Ga0496110_0287303 3300048913 Bacteria 1498
180 Ga0496111_0210574 3300048914 Bacteria 1444
181 Ga0496114_0109217 3300048917 Bacteria 2368
182 Ga0496115_0019761 3300048918 Bacteria 5187
183 Ga0496124_0208412 3300048927 Bacteria 1481
184 Ga0501031_0200560 3300049568 Bacteria 1302
185 Ga0501033_0133646 3300049570 Bacteria 1796
186 Ga0501038_0237782 3300049574 Bacteria 1447
187 Ga0501039_0015702 3300049575 Bacteria 5793
188 Ga0501039_0420161 3300049575 Bacteria 1050
189 Ga0501040_0349632 3300049576 Bacteria 1059
190 Ga0501042_0068328 3300049578 Bacteria 2541
191 Ga0501067_0013222 3300049583 Bacteria 4571
192 Ga0501069_0018257 3300049585 Bacteria 3784
193 Ga0501071_0380928 3300049587 Bacteria 1076
194 Ga0501074_0167957 3300049590 Bacteria 1566
195 Ga0501076_0109858 3300049592 Bacteria 2229
196 Ga0501045_0251259 3300049824 Bacteria 1316
197 nmdc:mga03683_116202_c1 3300050489 Bacteria 1186
198 nmdc:mga03n38_4778_c1 3300050490 Bacteria 4532
199 nmdc:mga03n38_92052_c1 3300050490 Bacteria 1446
200 nmdc:mga00v17_144086_c1 3300050491 Bacteria 1529
201 nmdc:mga00v17_1921_c1 3300050491 Bacteria 10733
202 nmdc:mga00v17_25476_c1 3300050491 Bacteria 3439
203 nmdc:mga00v17_36901_c1 3300050491 Bacteria 2915
204 nmdc:mga00v17_64686_c1 3300050491 Bacteria 2254
205 nmdc:mga00v17_81984_c1 3300050491 Bacteria 2015
206 nmdc:mga00v17_96709_c1 3300050491 Bacteria 1860
207 nmdc:mga0yw44_113005_c1 3300050492 Bacteria 1742
208 nmdc:mga0yw44_11365_c1 3300050492 Bacteria 4591
209 nmdc:mga0yw44_11616_c1 3300050492 Bacteria 4557
210 nmdc:mga0yw44_156255_c1 3300050492 Bacteria 1491
211 nmdc:mga0yw44_1757_c1 3300050492 Bacteria 8831
212 nmdc:mga0yw44_22207_c1 3300050492 Bacteria 3554
213 nmdc:mga0yw44_242730_c1 3300050492 Bacteria 1198
214 nmdc:mga0yw44_24683_c1 3300050492 Bacteria 2982
215 nmdc:mga0yw44_255863_c1 3300050492 Bacteria 1166
216 nmdc:mga0yw44_66544_c1 3300050492 Bacteria 2224
217 nmdc:mga0yw44_73573_c1 3300050492 Bacteria 2126
218 nmdc:mga06z11_32274_c1 3300050494 Bacteria 2553
219 nmdc:mga06z11_59958_c1 3300050494 Bacteria 1979
220 nmdc:mga07m45_120282_c1 3300050496 Bacteria 1516
221 nmdc:mga07m45_12388_c1 3300050496 Bacteria 4507
222 nmdc:mga07m45_20748_c1 3300050496 Bacteria 3571
223 nmdc:mga07m45_69307_c1 3300050496 Bacteria 2005
224 Ga0495601_0015005 3300053077 Bacteria 4679
225 Ga0500644_0000053 3300053088 Bacteria 69275
226 Ga0500644_0020673 3300053088 Bacteria 1961
227 Ga0500556_0001035 3300053104 Bacteria 14512
228 Ga0500593_000776 3300053117 Bacteria 11926
229 Ga0500573_0110668 3300053140 Bacteria 1537
230 Ga0501082_0290382 3300060353 Bacteria 1424
231 2643826656 2643221561 Bacteria 4984412
232 2643892954 2643221576 Bacteria 5214352
233 2643962715 2643221590 Bacteria 5214697
234 2644090151 2643221615 Bacteria 5487866
235 2644098667 2643221617 Bacteria 5139111
236 2644116028 2643221620 Bacteria 5134593
237 2644230580 2643221641 Bacteria 4490190
238 2644319995 2643221657 Bacteria 5490246
239 2644532991 2643221696 Bacteria 5431823
240 2738871511 2738541305 Bacteria 4910150
241 2774397125 2773857762 Bacteria 5971770
242 2809198775 2808606439 Bacteria 5952208
243 2812333559 2811994874 Bacteria 5367947
244 2812352655 2811994878 Bacteria 5992952
245 2891969801 2891968417 Bacteria 5821697
246 Ga0439461_0026007
247 rootL2_10355607
248 Ga0070683_100104072
249 Ga0070683_100154263
250 Ga0070683_100478706
251 Ga0070682_100054810
252 Ga0068868_100048431
253 Ga0070691_10052628
254 Ga0070687_100082396
255 Ga0070687_100419950
256 Ga0070692_10020578
257 Ga0070668_100028291
258 Ga0070669_100285990
259 Ga0070675_100055029
260 Ga0070701_10008939
261 Ga0070708_100112176
262 Ga0070663_100195079
263 Ga0070678_100096981
264 Ga0068867_100021067
265 Ga0070707_100224062
266 Ga0070698_100006366
267 Ga0070684_100067318
268 Ga0070672_100002885
269 Ga0070664_100266955
270 Ga0068854_100198143
271 Ga0070702_100077073
272 Ga0070702_100194399
273 Ga0070702_100484548
274 Ga0068852_100055362
275 Ga0068866_10035737
276 Ga0068861_100029934
277 Ga0068851_10192876
278 Ga0068870_10019804
279 Ga0068862_100037712
280 Ga0075365_10001232
281 Ga0075365_10002778
282 Ga0075365_10017251
283 Ga0075365_10029842
284 Ga0075365_10044008
285 Ga0075365_10063642
286 Ga0075365_10066496
287 Ga0075365_10082488
288 Ga0075365_10111788
289 Ga0075365_10228566
290 Ga0075365_10266563
291 Ga0075365_10302861
292 Ga0075368_10005717
293 Ga0075363_100013906
294 Ga0075363_100014686
295 Ga0075363_100061854
296 Ga0075364_10019565
297 Ga0075364_10028980
298 Ga0075364_10032255
299 Ga0075364_10066921
300 Ga0075364_10083463
301 Ga0075364_10123441
302 Ga0075362_10014731
303 Ga0075367_10016390
304 Ga0075367_10072133
305 Ga0075370_10008621
306 Ga0075370_10017679
307 Ga0075370_10086359
308 Ga0111539_10113095
309 Ga0105245_10017372
310 Ga0105245_10183698
311 Ga0105245_10575671
312 Ga0105245_10731940
313 Ga0105243_10024435
314 Ga0105248_10165302
315 Ga0105238_10241104
316 Ga0105249_10017899
317 Ga0105249_10496352
318 Ga0105249_10868842
319 Ga0105239_10359810
320 Ga0157375_10120220
321 Ga0157375_10385223
322 Ga0157375_10570335
323 Ga0157375_10791271
324 Ga0163163_10036406
325 Ga0157380_10014888
326 Ga0157380_10046005
327 Ga0157380_10423023
328 Ga0157380_10852924
329 Ga0157377_10058954
330 Ga0163161_10036581
331 Ga0207642_10067945
332 Ga0207688_10012402
333 Ga0207688_10071316
334 Ga0207643_10002504
335 Ga0207662_10128423
336 Ga0207657_10255090
337 Ga0207659_10049774
338 Ga0207659_10174781
339 Ga0207687_10078577
340 Ga0207709_10014220
341 Ga0207709_10596869
342 Ga0207704_10045687
343 Ga0207691_10039854
344 Ga0207711_10114547
345 Ga0207661_10122538
346 Ga0207661_10808943
347 Ga0207679_10302699
348 Ga0207668_10159993
349 Ga0207640_10262397
350 Ga0207639_10131672
351 Ga0207708_10000509
352 Ga0207708_10039204
353 Ga0207648_10096109
354 Ga0207675_100009028
355 Ga0207675_100136310
356 Ga0207683_10538844
357 Ga0207698_10096137
358 Ga0209813_10013757
359 Ga0207428_10158611
360 Ga0268265_10059567
361 Ga0307410_10240315
362 Ga0307407_10021188
363 Ga0307407_10103819
364 Ga0307407_10312784
365 Ga0307409_100034206
366 Ga0307409_100036471
367 Ga0307409_100146811
368 Ga0307409_100194435
369 Ga0307416_100007997
370 Ga0307416_100053399
371 Ga0307414_10497680
372 Ga0307415_100057006
373 Ga0307415_100104150
374 Ga0307415_100254862
375 Ga0395900_0013893
376 Ga0395898_0084212
377 Ga0395898_0456459
378 Ga0395898_0512814
379 Ga0395905_0080609
380 Ga0395901_0057054
381 Ga0451791_0798184
382 Ga0439431_0006656
383 Ga0439442_011476
384 Ga0450907_011527
385 Ga0466972_0100838
386 Ga0466972_0239111
387 Ga0466965_0018852
388 Ga0466965_0045479
389 Ga0466966_0129638
390 Ga0466961_0017843
391 Ga0466961_0022503
392 Ga0466970_0008827
393 Ga0466970_0012157
394 Ga0466970_0022953
395 Ga0466970_0023150
396 Ga0466970_0103893
397 Ga0466957_0011755
398 Ga0466957_0023962
399 Ga0466960_0006233
400 Ga0466960_0006743
401 Ga0466960_0011488
402 Ga0466960_0013618
403 Ga0466959_0172039
404 Ga0466958_0146863
405 Ga0466967_0089037
406 Ga0466967_0099038
407 Ga0466967_0114199
408 Ga0466967_0240870
409 Ga0495629_0050312
410 Ga0495664_0011540
411 Ga0495620_0119633
412 Ga0496100_0200752
413 Ga0496101_0135213
414 Ga0496102_0377476
415 Ga0496103_0086247
416 Ga0496103_0235461
417 Ga0496105_0142541
418 Ga0496108_0060648
419 Ga0496108_0471793
420 Ga0496109_0019866
421 Ga0496109_0121162
422 Ga0496110_0102573
423 Ga0496110_0243658
424 Ga0496110_0287303
425 Ga0496111_0210574
426 Ga0496114_0109217
427 Ga0496115_0019761
428 Ga0496124_0208412
429 Ga0501031_0200560
430 Ga0501033_0133646
431 Ga0501038_0237782
432 Ga0501039_0015702
433 Ga0501039_0420161
434 Ga0501040_0349632
435 Ga0501042_0068328
436 Ga0501067_0013222
437 Ga0501069_0018257
438 Ga0501071_0380928
439 Ga0501074_0167957
440 Ga0501076_0109858
441 Ga0501045_0251259
442 nmdc:mga03683_116202_c1
443 nmdc:mga03n38_4778_c1
444 nmdc:mga03n38_92052_c1
445 nmdc:mga00v17_144086_c1
446 nmdc:mga00v17_1921_c1
447 nmdc:mga00v17_25476_c1
448 nmdc:mga00v17_36901_c1
449 nmdc:mga00v17_64686_c1
450 nmdc:mga00v17_81984_c1
451 nmdc:mga00v17_96709_c1
452 nmdc:mga0yw44_113005_c1
453 nmdc:mga0yw44_11365_c1
454 nmdc:mga0yw44_11616_c1
455 nmdc:mga0yw44_156255_c1
456 nmdc:mga0yw44_1757_c1
457 nmdc:mga0yw44_22207_c1
458 nmdc:mga0yw44_242730_c1
459 nmdc:mga0yw44_24683_c1
460 nmdc:mga0yw44_255863_c1
461 nmdc:mga0yw44_66544_c1
462 nmdc:mga0yw44_73573_c1
463 nmdc:mga06z11_32274_c1
464 nmdc:mga06z11_59958_c1
465 nmdc:mga07m45_120282_c1
466 nmdc:mga07m45_12388_c1
467 nmdc:mga07m45_20748_c1
468 nmdc:mga07m45_69307_c1
469 Ga0495601_0015005
470 Ga0500644_0000053
471 Ga0500644_0020673
472 Ga0500556_0001035
473 Ga0500593_000776
474 Ga0500573_0110668
475 Ga0501082_0290382
476 2643826656
477 2643892954
478 2643962715
479 2644090151
480 2644098667
481 2644116028
482 2644230580
483 2644319995
484 2644532991
485 2738871511
486 2774397125
487 2809198775
488 2812333559
489 2812352655
490 2891969801

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

36

184

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.8436 5 217
2ihy-assembly1.cif.gz_B structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter 0.8355 1 218
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.8314 4 216
3rlf-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.8209 5 217
3fvq-assembly1.cif.gz_A crystal structure of the nucleotide binding domain fbpc complexed with atp 0.8172 5 216
ID Description Score Start End Superfamily
af_A0A1D6P1I8_181_285_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9446 5 68 3.40.50.300
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9056 2 68 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8412 5 214 3.40.50.300
af_P15031_2_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8385 5 218 3.40.50.300
af_I6YF11_12_276_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8321 2 219 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2Z6B2Y3-F1-model_v4 ABC transporter related protein 0.855 2 219 GO:0005524
GO:0016887
AF-A0A851IW89-F1-model_v4 ABC transporter ATP-binding protein 0.8357 5 218 GO:0005524
GO:0016887
AF-A0A1E3L1L0-F1-model_v4 Iron-chelate-transporting ATPase (EC 3.6.3.34) 0.8329 4 226 GO:0005524
GO:0016887
AF-A0A0D8HIP8-F1-model_v4 Putative ABC transporter ATP-binding protein YlmA (EC 3.6.3.-) 0.8288 2 227 GO:0005524
GO:0016887
AF-A0A2M9LCL9-F1-model_v4 Heme ABC transporter ATP-binding protein 0.8279 1 218 GO:0005524
GO:0016887

Map