F357561

General Info

Members Datasets Scaffolds Average Seq Length
245 181 490 132

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_1181220|Ga0436360_1181220_78_518
Length 146
Sequence MQNQPRTSRAHTRAYWAGWAASGLVIAFLLMDAGMKLLALSFVLEAQETLGFHGEGTSRLLGAILLGCTLLYAAPQTAVLGAILLTGYLGGAVAVKLRIGDPLFSHVLFGVYLGVLVWGGLYLRDARLRRIFPWRSAGEEPAMPTA

Samples

Sample ID Description Type Environment
1 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
21 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
72 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
84 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
85 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
86 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
87 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
88 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
89 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
90 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
94 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
100 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
101 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
106 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
119 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
120 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
123 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
128 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
129 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
145 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
146 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
147 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
148 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
162 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
165 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
166 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
167 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
168 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
169 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
170 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
171 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
172 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
173 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
176 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
177 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
178 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
179 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
180 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
181 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.55
Metatranscriptomes 0
Isolates 2.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.71
Nodule 0
Rhizoplane 0.82
Rhizosphere 86.53
Stem 0
Stem Tuber 0
Unclassified 12.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436360_1181220 3300039438 Bacteria 531
2 Ga0065715_10746962 3300005293 Unclassified 632
3 Ga0068868_100704610 3300005338 Unclassified 903
4 Ga0068868_101556903 3300005338 Unclassified 620
5 Ga0070675_100313798 3300005354 Bacteria 1384
6 Ga0070659_100308914 3300005366 Bacteria 1320
7 Ga0070667_101101655 3300005367 Bacteria 742
8 Ga0070714_100206817 3300005435 Bacteria 1798
9 Ga0070714_100943914 3300005435 Bacteria 838
10 Ga0070713_100369300 3300005436 Bacteria 1335
11 Ga0070710_10565226 3300005437 Bacteria 787
12 Ga0068853_100254061 3300005539 Bacteria 1614
13 Ga0070665_100001829 3300005548 Bacteria 24156
14 Ga0070665_100132016 3300005548 Bacteria 2499
15 Ga0070665_100239849 3300005548 Bacteria 1813
16 Ga0070665_100918821 3300005548 Bacteria 888
17 Ga0068855_100242050 3300005563 Bacteria 2015
18 Ga0070664_100396276 3300005564 Bacteria 1262
19 Ga0068857_100143390 3300005577 Bacteria 2160
20 Ga0068856_100973990 3300005614 Bacteria 867
21 Ga0070702_101045542 3300005615 Bacteria 649
22 Ga0068859_100142035 3300005617 Bacteria 2474
23 Ga0068864_100020314 3300005618 Bacteria 5556
24 Ga0068864_100410469 3300005618 Bacteria 1288
25 Ga0068861_100262180 3300005719 Bacteria 1480
26 Ga0068861_101795035 3300005719 Unclassified 608
27 Ga0068851_10414097 3300005834 Bacteria 795
28 Ga0068870_10179507 3300005840 Unclassified 1270
29 Ga0068863_100335347 3300005841 Unclassified 1470
30 Ga0068863_100377673 3300005841 Bacteria 1384
31 Ga0068860_100344790 3300005843 Bacteria 1465
32 Ga0068862_100281127 3300005844 Bacteria 1525
33 Ga0070717_11465708 3300006028 Bacteria 619
34 Ga0075365_10219076 3300006038 Bacteria 1335
35 Ga0075365_10424057 3300006038 Bacteria 939
36 Ga0070715_10083623 3300006163 Bacteria 1454
37 Ga0075366_10958568 3300006195 Bacteria 533
38 Ga0075431_100107900 3300006847 Bacteria 2873
39 Ga0075434_102095393 3300006871 Unclassified 570
40 Ga0097620_100142031 3300006931 Bacteria 2474
41 Ga0105240_10066159 3300009093 Bacteria 4485
42 Ga0105240_10104408 3300009093 Bacteria 3441
43 Ga0105243_11968138 3300009148 Unclassified 618
44 Ga0105248_10117311 3300009177 Bacteria 3002
45 Ga0105248_12997466 3300009177 Bacteria 538
46 Ga0105237_10516487 3300009545 Bacteria 1201
47 Ga0105237_10595316 3300009545 Bacteria 1113
48 Ga0105238_10307102 3300009551 Bacteria 1571
49 Ga0105238_11444558 3300009551 Bacteria 716
50 Ga0105249_10653198 3300009553 Bacteria 1109
51 Ga0105249_10771614 3300009553 Unclassified 1024
52 Ga0105239_10004739 3300010375 Bacteria 16147
53 Ga0105239_10799808 3300010375 Bacteria 1080
54 Ga0105239_11928749 3300010375 Bacteria 685
55 Ga0105239_12651261 3300010375 Bacteria 585
56 Ga0157370_11726959 3300013104 Bacteria 562
57 Ga0163162_10059381 3300013306 Bacteria 3856
58 Ga0163162_10270032 3300013306 Bacteria 1832
59 Ga0157375_12265363 3300013308 Unclassified 647
60 Ga0163163_10000113 3300014325 Bacteria 86256
61 Ga0157380_10186761 3300014326 Bacteria 1826
62 Ga0157380_10965562 3300014326 Bacteria 883
63 Ga0157379_11814481 3300014968 Bacteria 599
64 Ga0157376_10677315 3300014969 Bacteria 1034
65 Ga0213876_10016920 3300021384 Bacteria 3853
66 Ga0207692_10308029 3300025898 Bacteria 966
67 Ga0207688_10115595 3300025901 Bacteria 1561
68 Ga0207699_10421303 3300025906 Bacteria 954
69 Ga0207695_10013611 3300025913 Bacteria 9688
70 Ga0207695_11047085 3300025913 Bacteria 696
71 Ga0207671_10200015 3300025914 Bacteria 1560
72 Ga0207671_10385846 3300025914 Bacteria 1113
73 Ga0207693_10184419 3300025915 Bacteria 1643
74 Ga0207663_10496885 3300025916 Bacteria 947
75 Ga0207694_10083421 3300025924 Bacteria 2513
76 Ga0207694_10521610 3300025924 Bacteria 996
77 Ga0207694_11699569 3300025924 Bacteria 531
78 Ga0207659_10246478 3300025926 Bacteria 1448
79 Ga0207700_10384230 3300025928 Bacteria 1228
80 Ga0207664_10097431 3300025929 Bacteria 2423
81 Ga0207711_10496406 3300025941 Bacteria 1137
82 Ga0207712_10634476 3300025961 Unclassified 927
83 Ga0207712_12018634 3300025961 Bacteria 516
84 Ga0207658_10363745 3300025986 Bacteria 1263
85 Ga0207658_10836005 3300025986 Bacteria 837
86 Ga0207677_10525625 3300026023 Unclassified 1027
87 Ga0207678_10373216 3300026067 Bacteria 1232
88 Ga0207702_11386445 3300026078 Bacteria 697
89 Ga0207641_10137766 3300026088 Bacteria 2198
90 Ga0207641_10540980 3300026088 Bacteria 1135
91 Ga0207676_10309187 3300026095 Unclassified 1446
92 Ga0207676_10523070 3300026095 Bacteria 1129
93 Ga0207674_11369151 3300026116 Bacteria 677
94 Ga0207675_100262982 3300026118 Unclassified 1673
95 Ga0207675_100505606 3300026118 Bacteria 1203
96 Ga0268266_10002334 3300028379 Bacteria 20540
97 Ga0268266_10059953 3300028379 Bacteria 3279
98 Ga0268266_10275417 3300028379 Bacteria 1563
99 Ga0268264_10189094 3300028381 Bacteria 1876
100 Ga0265338_10084683 3300028800 Bacteria 2646
101 Ga0265331_10005834 3300031250 Bacteria 7371
102 Ga0265327_10000124 3300031251 Bacteria 169233
103 Ga0265327_10000190 3300031251 Bacteria 130086
104 Ga0307408_100950072 3300031548 Unclassified 789
105 Ga0307516_10065606 3300031730 Bacteria 3505
106 Ga0307405_10032077 3300031731 Bacteria 3101
107 Ga0307413_10419681 3300031824 Bacteria 1053
108 Ga0307410_10070656 3300031852 Bacteria 2419
109 Ga0307412_11132160 3300031911 Unclassified 698
110 Ga0307409_100077549 3300031995 Bacteria 2670
111 Ga0307411_10054043 3300032005 Bacteria 2635
112 Ga0307415_100251455 3300032126 Bacteria 1436
113 Ga0373923_0104357 3300035111 Bacteria 1253
114 Ga0373923_0380158 3300035111 Unclassified 677
115 Ga0373923_0663067 3300035111 Bacteria 516
116 Ga0373936_0056232 3300035113 Bacteria 1599
117 Ga0373953_0096766 3300035117 Bacteria 1239
118 Ga0373953_0298545 3300035117 Bacteria 703
119 Ga0373954_0162347 3300035118 Bacteria 1093
120 Ga0373954_0591077 3300035118 Unclassified 550
121 Ga0373956_0127434 3300035119 Bacteria 1190
122 Ga0373957_0107127 3300035120 Bacteria 1123
123 Ga0373946_0462991 3300035171 Unclassified 647
124 Ga0373955_0340392 3300035172 Bacteria 908
125 Ga0373924_0176560 3300035410 Bacteria 939
126 Ga0373935_0062841 3300035692 Bacteria 2379
127 Ga0373935_0390510 3300035692 Bacteria 998
128 Ga0373927_0328886 3300035695 Bacteria 1007
129 Ga0373933_0008006 3300035724 Bacteria 5766
130 Ga0373933_0689335 3300035724 Bacteria 672
131 Ga0373947_0072390 3300035725 Bacteria 2116
132 Ga0373947_0240483 3300035725 Bacteria 1195
133 Ga0373937_0056298 3300036401 Bacteria 3611
134 Ga0373937_0126088 3300036401 Bacteria 2388
135 Ga0373937_0231916 3300036401 Bacteria 1739
136 Ga0373937_0467742 3300036401 Bacteria 1197
137 Ga0373937_0771821 3300036401 Bacteria 909
138 Ga0373925_0104088 3300037068 Bacteria 2185
139 Ga0436365_0211517 3300039437 Bacteria 10464
140 Ga0436361_0463047 3300039447 Bacteria 2247
141 Ga0451839_0491383 3300041496 Bacteria 579
142 Ga0466961_0433176 3300044693 Bacteria 796
143 Ga0466968_0087365 3300044735 Bacteria 1377
144 Ga0466960_0027345 3300044901 Bacteria 2601
145 Ga0466959_0017448 3300045049 Bacteria 5263
146 Ga0451576_0454792 3300045051 Bacteria 1344
147 Ga0495617_263094 3300046452 Unclassified 530
148 Ga0495590_0034411 3300046457 Unclassified 1769
149 Ga0495629_0032768 3300046459 Unclassified 3678
150 Ga0495629_0120738 3300046459 Unclassified 1826
151 Ga0495629_0903194 3300046459 Unclassified 579
152 Ga0495638_0274976 3300046460 Bacteria 918
153 Ga0495641_0263253 3300046461 Bacteria 776
154 Ga0495651_0082686 3300046462 Bacteria 2423
155 Ga0495651_0182069 3300046462 Bacteria 1486
156 Ga0495653_0170924 3300046463 Bacteria 1500
157 Ga0495582_0802216 3300046473 Unclassified 545
158 Ga0495664_0045447 3300046477 Bacteria 2604
159 Ga0495594_0438274 3300046499 Bacteria 743
160 Ga0495606_0114093 3300046507 Bacteria 1626
161 Ga0495606_0380882 3300046507 Bacteria 740
162 Ga0495608_0113512 3300046511 Bacteria 1740
163 Ga0495628_0133122 3300046516 Bacteria 1901
164 Ga0495628_0640157 3300046516 Bacteria 756
165 Ga0495632_0201881 3300046519 Unclassified 905
166 Ga0495652_0129824 3300046529 Bacteria 1997
167 Ga0495652_0274911 3300046529 Bacteria 1236
168 Ga0495652_0896971 3300046529 Unclassified 585
169 Ga0495665_0178829 3300046531 Bacteria 1103
170 Ga0495640_0299808 3300046533 Bacteria 998
171 Ga0495645_0015357 3300046543 Bacteria 5445
172 Ga0495645_0376680 3300046543 Bacteria 909
173 Ga0495667_0014835 3300046559 Bacteria 5265
174 Ga0495625_0420445 3300046660 Archaea 831
175 Ga0495635_0067036 3300046663 Bacteria 2462
176 Ga0495635_0281135 3300046663 Bacteria 1118
177 Ga0495635_0686880 3300046663 Bacteria 664
178 Ga0495657_0017152 3300046675 Bacteria 5262
179 Ga0495657_0442594 3300046675 Bacteria 761
180 Ga0495599_0062875 3300046678 Bacteria 2319
181 Ga0495623_0628192 3300046679 Bacteria 556
182 Ga0495646_0013733 3300046680 Bacteria 5149
183 Ga0495646_0340599 3300046680 Bacteria 787
184 Ga0495658_0959823 3300046683 Bacteria 546
185 Ga0495649_0038487 3300046694 Bacteria 2624
186 Ga0495600_0265414 3300046809 Bacteria 1090
187 Ga0495600_0700385 3300046809 Bacteria 609
188 Ga0495604_0142966 3300047317 Bacteria 1707
189 Ga0495674_0060396 3300047319 Bacteria 3308
190 Ga0495674_0244989 3300047319 Bacteria 1476
191 Ga0495674_0534186 3300047319 Bacteria 935
192 Ga0495672_0206530 3300047320 Unclassified 979
193 Ga0495680_0009279 3300047322 Bacteria 8862
194 Ga0495680_0111100 3300047322 Bacteria 2031
195 Ga0495680_0131659 3300047322 Bacteria 1837
196 Ga0495675_0011754 3300047444 Bacteria 5500
197 Ga0495675_0292642 3300047444 Bacteria 969
198 Ga0495673_0298309 3300047469 Bacteria 578
199 Ga0495686_0050348 3300047472 Bacteria 2618
200 Ga0495602_0018087 3300048088 Bacteria 7049
201 Ga0495626_0096597 3300048091 Unclassified 1293
202 Ga0496102_0000036 3300048905 Bacteria 201896
203 Ga0496103_0000074 3300048906 Bacteria 116385
204 Ga0496116_0016066 3300048919 Bacteria 5879
205 Ga0496117_0000093 3300048920 Bacteria 201862
206 Ga0496118_0000070 3300048921 Bacteria 201866
207 Ga0496119_0078523 3300048922 Bacteria 1909
208 Ga0496120_0093681 3300048923 Bacteria 1600
209 Ga0496124_0000225 3300048927 Bacteria 110516
210 Ga0496125_0150393 3300048928 Bacteria 1600
211 Ga0496126_0172003 3300048929 Bacteria 1845
212 Ga0496126_0233338 3300048929 Bacteria 1541
213 Ga0495678_088076 3300049459 Unclassified 1100
214 Ga0501047_0012249 3300049581 Bacteria 8120
215 Ga0501067_0053708 3300049583 Bacteria 2233
216 Ga0501072_0066198 3300049588 Bacteria 2850
217 Ga0501074_0296654 3300049590 Bacteria 1148
218 Ga0501080_0035785 3300049742 Bacteria 4635
219 Ga0501080_1228192 3300049742 Bacteria 644
220 Ga0501083_0233913 3300049744 Unclassified 1196
221 nmdc:mga0yw44_452417_c1 3300050492 Bacteria 870
222 nmdc:mga06r32_1127748_c1 3300050510 Bacteria 732
223 nmdc:mga06r32_294260_c1 3300050510 Bacteria 1610
224 Ga0495612_0018920 3300053078 Bacteria 2758
225 Ga0495595_0270365 3300053084 Bacteria 852
226 Ga0495619_0070912 3300053085 Bacteria 2331
227 Ga0495619_0470400 3300053085 Bacteria 866
228 Ga0500583_0030564 3300053092 Bacteria 2360
229 Ga0500641_0265023 3300053096 Bacteria 716
230 Ga0500556_0143396 3300053104 Bacteria 939
231 Ga0500595_018387 3300053119 Bacteria 2558
232 Ga0500608_034627 3300053122 Bacteria 2406
233 Ga0500617_201582 3300053124 Bacteria 729
234 Ga0500642_0274467 3300053130 Bacteria 768
235 Ga0500658_0137088 3300053134 Bacteria 1095
236 Ga0500622_0027197 3300053156 Bacteria 3016
237 Ga0500645_002595 3300053730 Bacteria 7942
238 Ga0501084_0030806 3300054114 Bacteria 4485
239 Ga0501082_0014178 3300060353 Bacteria 6860
240 2644088168 2643221614 Bacteria 4260023
241 2644343406 2643221661 Bacteria 4267604
242 2644369117 2643221666 Bacteria 4265935
243 2904580986 2904578770 Bacteria 5302906
244 2917702070 2917699015 Bacteria 7043791
245 2919121295 2919119836 Bacteria 5208557
246 Ga0436360_1181220
247 Ga0065715_10746962
248 Ga0068868_100704610
249 Ga0068868_101556903
250 Ga0070675_100313798
251 Ga0070659_100308914
252 Ga0070667_101101655
253 Ga0070714_100206817
254 Ga0070714_100943914
255 Ga0070713_100369300
256 Ga0070710_10565226
257 Ga0068853_100254061
258 Ga0070665_100001829
259 Ga0070665_100132016
260 Ga0070665_100239849
261 Ga0070665_100918821
262 Ga0068855_100242050
263 Ga0070664_100396276
264 Ga0068857_100143390
265 Ga0068856_100973990
266 Ga0070702_101045542
267 Ga0068859_100142035
268 Ga0068864_100020314
269 Ga0068864_100410469
270 Ga0068861_100262180
271 Ga0068861_101795035
272 Ga0068851_10414097
273 Ga0068870_10179507
274 Ga0068863_100335347
275 Ga0068863_100377673
276 Ga0068860_100344790
277 Ga0068862_100281127
278 Ga0070717_11465708
279 Ga0075365_10219076
280 Ga0075365_10424057
281 Ga0070715_10083623
282 Ga0075366_10958568
283 Ga0075431_100107900
284 Ga0075434_102095393
285 Ga0097620_100142031
286 Ga0105240_10066159
287 Ga0105240_10104408
288 Ga0105243_11968138
289 Ga0105248_10117311
290 Ga0105248_12997466
291 Ga0105237_10516487
292 Ga0105237_10595316
293 Ga0105238_10307102
294 Ga0105238_11444558
295 Ga0105249_10653198
296 Ga0105249_10771614
297 Ga0105239_10004739
298 Ga0105239_10799808
299 Ga0105239_11928749
300 Ga0105239_12651261
301 Ga0157370_11726959
302 Ga0163162_10059381
303 Ga0163162_10270032
304 Ga0157375_12265363
305 Ga0163163_10000113
306 Ga0157380_10186761
307 Ga0157380_10965562
308 Ga0157379_11814481
309 Ga0157376_10677315
310 Ga0213876_10016920
311 Ga0207692_10308029
312 Ga0207688_10115595
313 Ga0207699_10421303
314 Ga0207695_10013611
315 Ga0207695_11047085
316 Ga0207671_10200015
317 Ga0207671_10385846
318 Ga0207693_10184419
319 Ga0207663_10496885
320 Ga0207694_10083421
321 Ga0207694_10521610
322 Ga0207694_11699569
323 Ga0207659_10246478
324 Ga0207700_10384230
325 Ga0207664_10097431
326 Ga0207711_10496406
327 Ga0207712_10634476
328 Ga0207712_12018634
329 Ga0207658_10363745
330 Ga0207658_10836005
331 Ga0207677_10525625
332 Ga0207678_10373216
333 Ga0207702_11386445
334 Ga0207641_10137766
335 Ga0207641_10540980
336 Ga0207676_10309187
337 Ga0207676_10523070
338 Ga0207674_11369151
339 Ga0207675_100262982
340 Ga0207675_100505606
341 Ga0268266_10002334
342 Ga0268266_10059953
343 Ga0268266_10275417
344 Ga0268264_10189094
345 Ga0265338_10084683
346 Ga0265331_10005834
347 Ga0265327_10000124
348 Ga0265327_10000190
349 Ga0307408_100950072
350 Ga0307516_10065606
351 Ga0307405_10032077
352 Ga0307413_10419681
353 Ga0307410_10070656
354 Ga0307412_11132160
355 Ga0307409_100077549
356 Ga0307411_10054043
357 Ga0307415_100251455
358 Ga0373923_0104357
359 Ga0373923_0380158
360 Ga0373923_0663067
361 Ga0373936_0056232
362 Ga0373953_0096766
363 Ga0373953_0298545
364 Ga0373954_0162347
365 Ga0373954_0591077
366 Ga0373956_0127434
367 Ga0373957_0107127
368 Ga0373946_0462991
369 Ga0373955_0340392
370 Ga0373924_0176560
371 Ga0373935_0062841
372 Ga0373935_0390510
373 Ga0373927_0328886
374 Ga0373933_0008006
375 Ga0373933_0689335
376 Ga0373947_0072390
377 Ga0373947_0240483
378 Ga0373937_0056298
379 Ga0373937_0126088
380 Ga0373937_0231916
381 Ga0373937_0467742
382 Ga0373937_0771821
383 Ga0373925_0104088
384 Ga0436365_0211517
385 Ga0436361_0463047
386 Ga0451839_0491383
387 Ga0466961_0433176
388 Ga0466968_0087365
389 Ga0466960_0027345
390 Ga0466959_0017448
391 Ga0451576_0454792
392 Ga0495617_263094
393 Ga0495590_0034411
394 Ga0495629_0032768
395 Ga0495629_0120738
396 Ga0495629_0903194
397 Ga0495638_0274976
398 Ga0495641_0263253
399 Ga0495651_0082686
400 Ga0495651_0182069
401 Ga0495653_0170924
402 Ga0495582_0802216
403 Ga0495664_0045447
404 Ga0495594_0438274
405 Ga0495606_0114093
406 Ga0495606_0380882
407 Ga0495608_0113512
408 Ga0495628_0133122
409 Ga0495628_0640157
410 Ga0495632_0201881
411 Ga0495652_0129824
412 Ga0495652_0274911
413 Ga0495652_0896971
414 Ga0495665_0178829
415 Ga0495640_0299808
416 Ga0495645_0015357
417 Ga0495645_0376680
418 Ga0495667_0014835
419 Ga0495625_0420445
420 Ga0495635_0067036
421 Ga0495635_0281135
422 Ga0495635_0686880
423 Ga0495657_0017152
424 Ga0495657_0442594
425 Ga0495599_0062875
426 Ga0495623_0628192
427 Ga0495646_0013733
428 Ga0495646_0340599
429 Ga0495658_0959823
430 Ga0495649_0038487
431 Ga0495600_0265414
432 Ga0495600_0700385
433 Ga0495604_0142966
434 Ga0495674_0060396
435 Ga0495674_0244989
436 Ga0495674_0534186
437 Ga0495672_0206530
438 Ga0495680_0009279
439 Ga0495680_0111100
440 Ga0495680_0131659
441 Ga0495675_0011754
442 Ga0495675_0292642
443 Ga0495673_0298309
444 Ga0495686_0050348
445 Ga0495602_0018087
446 Ga0495626_0096597
447 Ga0496102_0000036
448 Ga0496103_0000074
449 Ga0496116_0016066
450 Ga0496117_0000093
451 Ga0496118_0000070
452 Ga0496119_0078523
453 Ga0496120_0093681
454 Ga0496124_0000225
455 Ga0496125_0150393
456 Ga0496126_0172003
457 Ga0496126_0233338
458 Ga0495678_088076
459 Ga0501047_0012249
460 Ga0501067_0053708
461 Ga0501072_0066198
462 Ga0501074_0296654
463 Ga0501080_0035785
464 Ga0501080_1228192
465 Ga0501083_0233913
466 nmdc:mga0yw44_452417_c1
467 nmdc:mga06r32_1127748_c1
468 nmdc:mga06r32_294260_c1
469 Ga0495612_0018920
470 Ga0495595_0270365
471 Ga0495619_0070912
472 Ga0495619_0470400
473 Ga0500583_0030564
474 Ga0500641_0265023
475 Ga0500556_0143396
476 Ga0500595_018387
477 Ga0500608_034627
478 Ga0500617_201582
479 Ga0500642_0274467
480 Ga0500658_0137088
481 Ga0500622_0027197
482 Ga0500645_002595
483 Ga0501084_0030806
484 Ga0501082_0014178
485 2644088168
486 2644343406
487 2644369117
488 2904580986
489 2917702070
490 2919121295

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13564

DoxX_2

DoxX-like family

20

120

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bl8-assembly3.cif.gz_C 1.6 angstrom crystal structure of enta-im: a bacterial immunity protein conferring immunity to the antimicrobial activity of the pediocin-like bacteriocin, enterocin a 0.5333 18 113
2cj5-assembly1.cif.gz_A crystal structure of a cell wall invertase inhibitor from tobacco (ph 5.0) 0.477 17 128
2bl8-assembly3.cif.gz_C 1.6 angstrom crystal structure of enta-im: a bacterial immunity protein conferring immunity to the antimicrobial activity of the pediocin-like bacteriocin, enterocin a 0.4759 18 113
8piv-assembly1.cif.gz_F homomeric glua2 flip r/g-unedited q/r-edited f231a mutant in tandem with tarp gamma-2, desensitized conformation 1 0.4642 7 127
6r1o-assembly1.cif.gz_A-2 crystal structure of e. coli seryl-trna synthetase complexed to a seryl sulfamoyl adenosine derivative 0.4577 38 129
ID Description Score Start End Superfamily
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.858 14 117 1.10.10.1740
af_L7N692_9_110_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7824 18 114 1.20.120.550
af_D3ZYP5_7_123_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.755 17 114 1.20.120.550
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7535 14 117 1.10.10.1740
af_L7N692_9_110_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7435 18 114 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A1H4NHY0-F1-model_v4 DoxX-like family protein 0.986 3 131 GO:0016020
AF-H0T6Z3-F1-model_v4 DoxX family protein 0.9833 12 131 GO:0016020
AF-A0A5B9E514-F1-model_v4 DoxX family protein 0.9825 9 129 GO:0016020
AF-A0A5C8TY09-F1-model_v4 DoxX family protein 0.9822 9 131 GO:0016020
AF-A0A0D7N7M5-F1-model_v4 Membrane protein 0.9816 13 131 GO:0016020

Map