F357161

General Info

Members Datasets Scaffolds Average Seq Length
245 190 490 159

Family's Representative Sequence

Representative Sequence 3300005466|Ga0070685_10203520|Ga0070685_102035202
Length 167
Sequence MPTPDFILNLRKKIGHDLLFIPGVSALVFNPANEVLLAKRSDTGRWSVIGGIIDPGEQPAAACIREVMEETGVQVEIERLSGVYTSPVITYPNQDVAQYVITAFRCKPIDGEPRVNDDESLEIKYFPLTDLPEDLKEDHLLRILHAAEPDHPAAAYILDRPDDEDAP

Samples

Sample ID Description Type Environment
1 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
19 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
20 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
21 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
31 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
34 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
46 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
47 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
48 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
49 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
50 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
51 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
52 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
53 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
54 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
55 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
56 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
57 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
58 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
59 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
60 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
61 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
62 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
63 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
64 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
65 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
66 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
67 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
68 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
69 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
74 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
83 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
84 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
85 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
90 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
91 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
92 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
93 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
94 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
95 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
96 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
97 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
98 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
99 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
102 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
103 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
104 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
105 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
106 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
107 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
108 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
109 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
110 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
117 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
120 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
121 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
122 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
123 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
131 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
132 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
133 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
134 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
137 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
157 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
158 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
159 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
160 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
161 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
162 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
163 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
164 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
165 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
166 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
167 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
168 2808606448 Streptomyces sp. 193411 Isolate Unclassified
169 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
170 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
171 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
172 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
173 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
174 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
175 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
176 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
177 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
178 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
179 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
180 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
181 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
182 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
183 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
184 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
185 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
186 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
187 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
188 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
189 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
190 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.94
Metatranscriptomes 0
Isolates 13.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.63
Nodule 0.82
Rhizoplane 2.45
Rhizosphere 86.12
Stem 0
Stem Tuber 0
Unclassified 0.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070685_10203520 3300005466 Bacteria 1288
2 JGI24740J21852_10012068 3300001979 Bacteria 3265
3 JGI24739J22299_10006179 3300001989 Bacteria 4523
4 JGI24737J22298_10001196 3300001990 Bacteria 9156
5 JGI24738J21930_10014761 3300002075 Bacteria 1672
6 rootL2_10005200 3300003322 Bacteria 1072
7 Ga0070668_100383249 3300005347 Bacteria 1197
8 Ga0070659_100988647 3300005366 Bacteria 738
9 Ga0070667_100947843 3300005367 Bacteria 802
10 Ga0070665_100001162 3300005548 Bacteria 32364
11 Ga0068854_101317922 3300005578 Bacteria 650
12 Ga0068856_100351351 3300005614 Bacteria 1493
13 Ga0068856_101161690 3300005614 Bacteria 789
14 Ga0068852_100639162 3300005616 Bacteria 1071
15 Ga0068852_101155794 3300005616 Bacteria 795
16 Ga0068860_100306313 3300005843 Bacteria 1557
17 Ga0068860_100407477 3300005843 Bacteria 1346
18 Ga0081538_10100407 3300005981 Bacteria 1459
19 Ga0081539_10048396 3300005985 Bacteria 2418
20 Ga0105240_10739758 3300009093 Bacteria 1070
21 Ga0105245_11220835 3300009098 Bacteria 800
22 Ga0105247_10688790 3300009101 Bacteria 768
23 Ga0105241_10098204 3300009174 Bacteria 2323
24 Ga0105242_11234911 3300009176 Bacteria 768
25 Ga0105248_12501782 3300009177 Bacteria 588
26 Ga0105238_10685212 3300009551 Bacteria 1036
27 Ga0105249_10031910 3300009553 Bacteria 4765
28 Ga0105246_10000335 3300011119 Bacteria 24992
29 Ga0105246_10027116 3300011119 Bacteria 3750
30 Ga0105246_10153362 3300011119 Bacteria 1746
31 Ga0157369_10077013 3300013105 Bacteria 3575
32 Ga0157374_10516152 3300013296 Bacteria 1200
33 Ga0157372_10046064 3300013307 Bacteria 4840
34 Ga0157372_10678110 3300013307 Bacteria 1200
35 Ga0157380_11429834 3300014326 Bacteria 743
36 Ga0157377_10161995 3300014745 Bacteria 1392
37 Ga0157379_10643493 3300014968 Bacteria 992
38 Ga0157376_10378043 3300014969 Bacteria 1364
39 Ga0209758_1003913 3300025297 Bacteria 12996
40 Ga0209051_1024656 3300025303 Bacteria 2467
41 Ga0207647_10008224 3300025904 Bacteria 7497
42 Ga0207647_10077528 3300025904 Bacteria 1997
43 Ga0207654_10377662 3300025911 Bacteria 981
44 Ga0207690_11617063 3300025932 Bacteria 541
45 Ga0207658_10277775 3300025986 Bacteria 1435
46 Ga0207677_11194651 3300026023 Bacteria 696
47 Ga0207702_10154888 3300026078 Bacteria 2088
48 Ga0207702_10887101 3300026078 Bacteria 883
49 Ga0207698_10250753 3300026142 Bacteria 1620
50 Ga0268266_10000395 3300028379 Bacteria 66128
51 Ga0268265_10727243 3300028380 Bacteria 961
52 Ga0268264_10433027 3300028381 Bacteria 1270
53 Ga0307515_10000189 3300028794 Bacteria 150703
54 Ga0307515_10380225 3300028794 Bacteria 1045
55 Ga0307511_10040295 3300030521 Bacteria 3971
56 Ga0307508_10219723 3300031616 Bacteria 1500
57 Ga0307413_12000002 3300031824 Bacteria 522
58 Ga0307518_10339936 3300031838 Bacteria 882
59 Ga0307510_10124698 3300033180 Bacteria 2269
60 Ga0395899_0664509 3300037312 Bacteria 657
61 Ga0395898_0001399 3300037466 Bacteria 34417
62 Ga0395898_0337643 3300037466 Bacteria 1437
63 Ga0395905_0605754 3300037471 Bacteria 997
64 Ga0395901_0212931 3300038443 Bacteria 2022
65 Ga0439436_0009604 3300041404 Bacteria 2967
66 Ga0439439_0032121 3300041406 Bacteria 1340
67 Ga0451800_1399361 3300041459 Bacteria 628
68 Ga0451802_1312634 3300041460 Bacteria 825
69 Ga0451807_1681026 3300041486 Bacteria 641
70 Ga0451843_0332501 3300041509 Bacteria 727
71 Ga0451853_1799609 3300041512 Bacteria 2864
72 Ga0451853_1883376 3300041512 Bacteria 2973
73 Ga0439433_0001574 3300041999 Bacteria 4735
74 Ga0439442_032629 3300042002 Bacteria 1088
75 Ga0439457_000777 3300042014 Bacteria 9490
76 Ga0450920_045464 3300042122 Unclassified 877
77 Ga0450906_024649 3300042145 Bacteria 1069
78 Ga0439458_0018747 3300042157 Bacteria 1588
79 Ga0466969_0189017 3300044656 Bacteria 941
80 Ga0466969_0328846 3300044656 Bacteria 691
81 Ga0466972_0002566 3300044658 Bacteria 8996
82 Ga0466972_0005877 3300044658 Bacteria 6153
83 Ga0466972_0022744 3300044658 Bacteria 3119
84 Ga0466965_0001168 3300044683 Bacteria 10322
85 Ga0466965_0042120 3300044683 Bacteria 2251
86 Ga0466966_0004765 3300044684 Bacteria 8931
87 Ga0466966_0006920 3300044684 Bacteria 7513
88 Ga0466966_0196051 3300044684 Bacteria 1223
89 Ga0466966_0303025 3300044684 Bacteria 960
90 Ga0466961_0001614 3300044693 Bacteria 13979
91 Ga0466961_0049545 3300044693 Bacteria 2684
92 Ga0466963_0000047 3300044694 Bacteria 40057
93 Ga0466964_0150503 3300044706 Bacteria 1078
94 Ga0466964_0273414 3300044706 Bacteria 842
95 Ga0466971_0000079 3300044719 Bacteria 35332
96 Ga0466970_0000378 3300044765 Bacteria 21629
97 Ga0466957_0000062 3300044842 Bacteria 40831
98 Ga0466960_0008326 3300044901 Bacteria 4243
99 Ga0466959_0000800 3300045049 Bacteria 18533
100 Ga0466959_0059079 3300045049 Bacteria 2793
101 Ga0466958_0000122 3300045836 Bacteria 25398
102 Ga0466967_0000547 3300045976 Bacteria 18283
103 Ga0495617_161361 3300046452 Bacteria 710
104 Ga0495627_030069 3300046453 Bacteria 1724
105 Ga0495627_044771 3300046453 Bacteria 1350
106 Ga0495627_093156 3300046453 Bacteria 865
107 Ga0495592_0025464 3300046454 Bacteria 4492
108 Ga0495603_0117756 3300046455 Bacteria 1548
109 Ga0495629_0000788 3300046459 Bacteria 25587
110 Ga0495629_0088243 3300046459 Bacteria 2163
111 Ga0495638_0036250 3300046460 Bacteria 3143
112 Ga0495638_0222937 3300046460 Bacteria 1053
113 Ga0495651_0018956 3300046462 Bacteria 5330
114 Ga0495580_0048055 3300046472 Bacteria 3024
115 Ga0495605_0028306 3300046474 Bacteria 2893
116 Ga0495605_0148729 3300046474 Bacteria 1046
117 Ga0495662_0211740 3300046476 Bacteria 955
118 Ga0495596_0018351 3300046500 Bacteria 2884
119 Ga0495607_0044884 3300046501 Bacteria 2602
120 Ga0495583_0011753 3300046506 Bacteria 5009
121 Ga0495583_0088547 3300046506 Bacteria 1336
122 Ga0495606_0008498 3300046507 Bacteria 8903
123 Ga0495608_0161165 3300046511 Bacteria 1426
124 Ga0495616_0015944 3300046513 Bacteria 4167
125 Ga0495618_0142022 3300046514 Bacteria 1535
126 Ga0495620_0007049 3300046515 Bacteria 6130
127 Ga0495620_0017191 3300046515 Bacteria 3611
128 Ga0495620_0100794 3300046515 Bacteria 1151
129 Ga0495628_0147288 3300046516 Bacteria 1794
130 Ga0495632_0103623 3300046519 Bacteria 1340
131 Ga0495637_0096621 3300046520 Bacteria 1159
132 Ga0495643_0001005 3300046522 Bacteria 28801
133 Ga0495648_0043157 3300046524 Bacteria 2830
134 Ga0495648_0243143 3300046524 Bacteria 873
135 Ga0495666_0253423 3300046526 Bacteria 801
136 Ga0495652_0080282 3300046529 Bacteria 2695
137 Ga0495586_0085521 3300046535 Bacteria 1738
138 Ga0495597_0007331 3300046542 Bacteria 5613
139 Ga0495622_0110812 3300046557 Bacteria 1256
140 Ga0495633_0012401 3300046558 Bacteria 4535
141 Ga0495668_0088232 3300046616 Bacteria 1700
142 Ga0495634_0086149 3300046642 Bacteria 2046
143 Ga0495625_0038154 3300046660 Bacteria 3518
144 Ga0495625_0123677 3300046660 Bacteria 1758
145 Ga0495625_0468234 3300046660 Bacteria 775
146 Ga0495635_0185892 3300046663 Bacteria 1411
147 Ga0495588_0121196 3300046674 Bacteria 1378
148 Ga0495657_0048700 3300046675 Bacteria 2857
149 Ga0495599_0175457 3300046678 Bacteria 1322
150 Ga0495613_0051217 3300046689 Bacteria 3043
151 Ga0495613_0072100 3300046689 Bacteria 2517
152 Ga0495613_0492112 3300046689 Bacteria 826
153 Ga0495624_0016748 3300046690 Bacteria 4932
154 Ga0495624_0175099 3300046690 Bacteria 1308
155 Ga0495624_0389871 3300046690 Bacteria 836
156 Ga0495649_0039910 3300046694 Bacteria 2573
157 Ga0495649_0311888 3300046694 Bacteria 799
158 Ga0495589_0001582 3300046794 Bacteria 13062
159 Ga0495589_0007872 3300046794 Bacteria 5579
160 Ga0495589_0010549 3300046794 Bacteria 4803
161 Ga0495600_0272221 3300046809 Bacteria 1074
162 Ga0495660_0023883 3300046810 Bacteria 3484
163 Ga0495660_0115519 3300046810 Bacteria 1364
164 Ga0495581_0031494 3300047315 Bacteria 3073
165 Ga0495604_0090991 3300047317 Bacteria 2264
166 Ga0495636_0012732 3300047318 Bacteria 3332
167 Ga0495636_0037228 3300047318 Bacteria 2009
168 Ga0495636_0135523 3300047318 Bacteria 1097
169 Ga0495674_0309386 3300047319 Bacteria 1289
170 Ga0495676_0107926 3300047321 Bacteria 2048
171 Ga0495676_0374348 3300047321 Bacteria 948
172 Ga0495680_0475527 3300047322 Bacteria 851
173 Ga0495687_011249 3300047443 Bacteria 4824
174 Ga0495687_016223 3300047443 Bacteria 3751
175 Ga0495687_020947 3300047443 Bacteria 3176
176 Ga0495675_0029976 3300047444 Bacteria 3471
177 Ga0495685_003220 3300047447 Bacteria 5187
178 Ga0495685_003674 3300047447 Bacteria 4904
179 Ga0495685_144344 3300047447 Bacteria 774
180 Ga0495681_0002925 3300047470 Bacteria 12071
181 Ga0495681_0073157 3300047470 Bacteria 1548
182 Ga0495593_0031808 3300047673 Bacteria 2879
183 Ga0495602_0107996 3300048088 Bacteria 2267
184 Ga0495614_0008568 3300048089 Bacteria 4546
185 Ga0495614_0081321 3300048089 Bacteria 1403
186 Ga0495626_0020611 3300048091 Bacteria 3282
187 Ga0496104_1566088 3300048907 Bacteria 562
188 Ga0496105_1153711 3300048908 Bacteria 573
189 Ga0496110_1509330 3300048913 Bacteria 582
190 Ga0495678_151605 3300049459 Bacteria 748
191 Ga0501033_0004448 3300049570 Bacteria 11209
192 Ga0501034_0054138 3300049571 Bacteria 4039
193 Ga0501034_1631095 3300049571 Bacteria 518
194 Ga0501036_0001638 3300049572 Bacteria 17350
195 Ga0501038_0025384 3300049574 Bacteria 5283
196 Ga0501039_0050177 3300049575 Bacteria 3228
197 Ga0501043_0002899 3300049579 Bacteria 14323
198 Ga0501043_0484160 3300049579 Unclassified 926
199 Ga0501047_0190217 3300049581 Bacteria 1916
200 Ga0501068_0077608 3300049584 Bacteria 2034
201 Ga0501069_0198863 3300049585 Bacteria 1161
202 Ga0501070_0000617 3300049586 Bacteria 32670
203 Ga0501074_0043162 3300049590 Bacteria 3263
204 Ga0501035_0042302 3300049822 Bacteria 4109
205 Ga0501035_0254550 3300049822 Bacteria 1490
206 Ga0501044_0016583 3300049823 Bacteria 7906
207 Ga0501044_0027132 3300049823 Bacteria 6057
208 Ga0501044_0094145 3300049823 Bacteria 3021
209 nmdc:mga03n38_244990_c1 3300050490 Bacteria 945
210 Ga0495619_1018292 3300053085 Bacteria 553
211 Ga0500560_004518 3300053107 Bacteria 2971
212 Ga0466962_0001292 3300061719 Bacteria 11562
213 Ga0466962_0084003 3300061719 Bacteria 1523
214 2547408712 2547132111 Bacteria 8013147
215 2552110913 2551306166 Bacteria 9731570
216 2585315347 2582581314 Bacteria 11452267
217 2616693414 2616644814 Bacteria 11555299
218 2644015627 2643221601 Bacteria 7493239
219 2644177356 2643221631 Bacteria 8168043
220 2784586264 2784132148 Bacteria 8627943
221 2804849363 2802429296 Bacteria 7227771
222 2808847064 2808606359 Bacteria 9866990
223 2809229759 2808606448 Bacteria 8656184
224 2812360966 2811994879 Bacteria 9313447
225 2812482805 2811994917 Bacteria 7761064
226 2844851993 2844849076 Bacteria 4091819
227 2852639327 2852635781 Bacteria 8251373
228 2862282565 2862281513 Bacteria 9621493
229 2862386191 2862382967 Bacteria 10317375
230 2862513796 2862507626 Bacteria 9425308
231 2863408114 2863404153 Bacteria 9672205
232 2873157993 2873151551 Bacteria 8625867
233 2887445675 2887443736 Bacteria 4426037
234 2912723214 2912715099 Bacteria 9460473
235 2912726676 2912723979 Bacteria 8557534
236 2946064902 2946064051 Bacteria 8957905
237 2947232526 2947224130 Bacteria 9938529
238 2954008335 2954002825 Bacteria 9173742
239 3006393594 3006393351 Bacteria 6615579
240 8008560565 8008558824 Bacteria 10610750
241 8008581222 8008574985 Bacteria 7815457
242 8023625746 8023623736 Bacteria 8593882
243 8025416016 8025413630 Bacteria 7014048
244 8033686634 8033684223 Bacteria 6906479
245 8056832832 8056829672 Bacteria 9045328
246 Ga0070685_10203520
247 JGI24740J21852_10012068
248 JGI24739J22299_10006179
249 JGI24737J22298_10001196
250 JGI24738J21930_10014761
251 rootL2_10005200
252 Ga0070668_100383249
253 Ga0070659_100988647
254 Ga0070667_100947843
255 Ga0070665_100001162
256 Ga0068854_101317922
257 Ga0068856_100351351
258 Ga0068856_101161690
259 Ga0068852_100639162
260 Ga0068852_101155794
261 Ga0068860_100306313
262 Ga0068860_100407477
263 Ga0081538_10100407
264 Ga0081539_10048396
265 Ga0105240_10739758
266 Ga0105245_11220835
267 Ga0105247_10688790
268 Ga0105241_10098204
269 Ga0105242_11234911
270 Ga0105248_12501782
271 Ga0105238_10685212
272 Ga0105249_10031910
273 Ga0105246_10000335
274 Ga0105246_10027116
275 Ga0105246_10153362
276 Ga0157369_10077013
277 Ga0157374_10516152
278 Ga0157372_10046064
279 Ga0157372_10678110
280 Ga0157380_11429834
281 Ga0157377_10161995
282 Ga0157379_10643493
283 Ga0157376_10378043
284 Ga0209758_1003913
285 Ga0209051_1024656
286 Ga0207647_10008224
287 Ga0207647_10077528
288 Ga0207654_10377662
289 Ga0207690_11617063
290 Ga0207658_10277775
291 Ga0207677_11194651
292 Ga0207702_10154888
293 Ga0207702_10887101
294 Ga0207698_10250753
295 Ga0268266_10000395
296 Ga0268265_10727243
297 Ga0268264_10433027
298 Ga0307515_10000189
299 Ga0307515_10380225
300 Ga0307511_10040295
301 Ga0307508_10219723
302 Ga0307413_12000002
303 Ga0307518_10339936
304 Ga0307510_10124698
305 Ga0395899_0664509
306 Ga0395898_0001399
307 Ga0395898_0337643
308 Ga0395905_0605754
309 Ga0395901_0212931
310 Ga0439436_0009604
311 Ga0439439_0032121
312 Ga0451800_1399361
313 Ga0451802_1312634
314 Ga0451807_1681026
315 Ga0451843_0332501
316 Ga0451853_1799609
317 Ga0451853_1883376
318 Ga0439433_0001574
319 Ga0439442_032629
320 Ga0439457_000777
321 Ga0450920_045464
322 Ga0450906_024649
323 Ga0439458_0018747
324 Ga0466969_0189017
325 Ga0466969_0328846
326 Ga0466972_0002566
327 Ga0466972_0005877
328 Ga0466972_0022744
329 Ga0466965_0001168
330 Ga0466965_0042120
331 Ga0466966_0004765
332 Ga0466966_0006920
333 Ga0466966_0196051
334 Ga0466966_0303025
335 Ga0466961_0001614
336 Ga0466961_0049545
337 Ga0466963_0000047
338 Ga0466964_0150503
339 Ga0466964_0273414
340 Ga0466971_0000079
341 Ga0466970_0000378
342 Ga0466957_0000062
343 Ga0466960_0008326
344 Ga0466959_0000800
345 Ga0466959_0059079
346 Ga0466958_0000122
347 Ga0466967_0000547
348 Ga0495617_161361
349 Ga0495627_030069
350 Ga0495627_044771
351 Ga0495627_093156
352 Ga0495592_0025464
353 Ga0495603_0117756
354 Ga0495629_0000788
355 Ga0495629_0088243
356 Ga0495638_0036250
357 Ga0495638_0222937
358 Ga0495651_0018956
359 Ga0495580_0048055
360 Ga0495605_0028306
361 Ga0495605_0148729
362 Ga0495662_0211740
363 Ga0495596_0018351
364 Ga0495607_0044884
365 Ga0495583_0011753
366 Ga0495583_0088547
367 Ga0495606_0008498
368 Ga0495608_0161165
369 Ga0495616_0015944
370 Ga0495618_0142022
371 Ga0495620_0007049
372 Ga0495620_0017191
373 Ga0495620_0100794
374 Ga0495628_0147288
375 Ga0495632_0103623
376 Ga0495637_0096621
377 Ga0495643_0001005
378 Ga0495648_0043157
379 Ga0495648_0243143
380 Ga0495666_0253423
381 Ga0495652_0080282
382 Ga0495586_0085521
383 Ga0495597_0007331
384 Ga0495622_0110812
385 Ga0495633_0012401
386 Ga0495668_0088232
387 Ga0495634_0086149
388 Ga0495625_0038154
389 Ga0495625_0123677
390 Ga0495625_0468234
391 Ga0495635_0185892
392 Ga0495588_0121196
393 Ga0495657_0048700
394 Ga0495599_0175457
395 Ga0495613_0051217
396 Ga0495613_0072100
397 Ga0495613_0492112
398 Ga0495624_0016748
399 Ga0495624_0175099
400 Ga0495624_0389871
401 Ga0495649_0039910
402 Ga0495649_0311888
403 Ga0495589_0001582
404 Ga0495589_0007872
405 Ga0495589_0010549
406 Ga0495600_0272221
407 Ga0495660_0023883
408 Ga0495660_0115519
409 Ga0495581_0031494
410 Ga0495604_0090991
411 Ga0495636_0012732
412 Ga0495636_0037228
413 Ga0495636_0135523
414 Ga0495674_0309386
415 Ga0495676_0107926
416 Ga0495676_0374348
417 Ga0495680_0475527
418 Ga0495687_011249
419 Ga0495687_016223
420 Ga0495687_020947
421 Ga0495675_0029976
422 Ga0495685_003220
423 Ga0495685_003674
424 Ga0495685_144344
425 Ga0495681_0002925
426 Ga0495681_0073157
427 Ga0495593_0031808
428 Ga0495602_0107996
429 Ga0495614_0008568
430 Ga0495614_0081321
431 Ga0495626_0020611
432 Ga0496104_1566088
433 Ga0496105_1153711
434 Ga0496110_1509330
435 Ga0495678_151605
436 Ga0501033_0004448
437 Ga0501034_0054138
438 Ga0501034_1631095
439 Ga0501036_0001638
440 Ga0501038_0025384
441 Ga0501039_0050177
442 Ga0501043_0002899
443 Ga0501043_0484160
444 Ga0501047_0190217
445 Ga0501068_0077608
446 Ga0501069_0198863
447 Ga0501070_0000617
448 Ga0501074_0043162
449 Ga0501035_0042302
450 Ga0501035_0254550
451 Ga0501044_0016583
452 Ga0501044_0027132
453 Ga0501044_0094145
454 nmdc:mga03n38_244990_c1
455 Ga0495619_1018292
456 Ga0500560_004518
457 Ga0466962_0001292
458 Ga0466962_0084003
459 2547408712
460 2552110913
461 2585315347
462 2616693414
463 2644015627
464 2644177356
465 2784586264
466 2804849363
467 2808847064
468 2809229759
469 2812360966
470 2812482805
471 2844851993
472 2852639327
473 2862282565
474 2862386191
475 2862513796
476 2863408114
477 2873157993
478 2887445675
479 2912723214
480 2912726676
481 2946064902
482 2947232526
483 2954008335
484 3006393594
485 8008560565
486 8008581222
487 8023625746
488 8025416016
489 8033686634
490 8056832832

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

19

146

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7u-assembly1.cif.gz_B crystal structure of ap4a hydrolase (aq_158) from aquifex aeolicus vf5 0.8838 20 146
5ggc-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with phosphate and magnesium ions (excess magnesium, i) 0.8576 19 144
5mzf-assembly4.cif.gz_D crystal structure of dog mth1 protein 0.8468 21 132
4zbp-assembly1.cif.gz_B crystal structure of the ampcpr-bound atnudt7 0.8407 19 129
3ef5-assembly1.cif.gz_B structure of the rna pyrophosphohydrolase bdrpph in complex with dgtp 0.8398 19 126
ID Description Score Start End Superfamily
2pbtB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8921 23 146 3.90.79.10
af_Q58549_37_166_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8559 17 144 3.90.79.10
2pbtB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.852 23 146 3.90.79.10
af_P9WIX7_56_205_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8484 14 145 3.90.79.10
af_Q9VXR9_162_296_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8325 23 146 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A0K2RU61-F1-model_v4 Sugar phosphatase YfbT 0.9761 51 157 GO:0050308
AF-A0A828UGZ4-F1-model_v4 deleted 0.968 36 157
AF-A0A239WYI6-F1-model_v4 NADH pyrophosphatase 0.9657 51 155
AF-A0A0S1UE45-F1-model_v4 deleted 0.9591 19 155
AF-A0A1R4IHP4-F1-model_v4 MutT/NUDIX-family protein 0.9589 23 157

Map