F357117

General Info

Members Datasets Scaffolds Average Seq Length
245 192 490 334

Family's Representative Sequence

Representative Sequence 3300005364|Ga0070673_100003362|Ga0070673_1000033625
Length 361
Sequence MTTLVTGATGFLGSHLTRLLADRGHRVRVLVRPTSRLDAIAGVPCEIVQGDVRDRASLASAVRGVDRVFHAAADYRLSARDPREIYETNVTGTRNLLDACRGAELDRFVYTSSVATIKAHSKGYSTSGAGPGGGPLPNESDSASLDDMVGHYKRSKLLAEQEVLAAADDIPIVVVNPTAPVGPGDWKPTPTGRIIVDFMRGRMLAYVKTGLNLVPVEDVAAGHLLAAERGATGQKYILGGVNMQLKEIFDALAAITGRPAPSVRIPHSLAIAVAHVSEIIARAGGRDPMVPLEGARMASLTMFVDTSKARRELGFEAGSVPAALERAVRWYSLQSAGSAFPGLSECDGRRTNPANAGSHGA

Samples

Sample ID Description Type Environment
1 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
51 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
68 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
72 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
73 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
74 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
75 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
76 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
77 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
87 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
88 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
89 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
90 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
97 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
98 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
101 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
126 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
127 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
128 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
137 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
138 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
139 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
140 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
141 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
142 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
143 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
144 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
145 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
146 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
147 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
148 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
152 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
153 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
154 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
155 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
156 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
157 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
158 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
159 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
160 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
161 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
162 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
163 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
164 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
165 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
166 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
167 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
168 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
169 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
170 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
171 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
172 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
173 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
174 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
177 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
178 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
179 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
180 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
181 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
182 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
183 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
184 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
185 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
186 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
187 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
188 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.33
Metatranscriptomes 3.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.41
Rhizosphere 99.59
Stem 0
Stem Tuber 0
Unclassified 10.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070673_100003362 3300005364 Bacteria 9949
2 Ga0070690_100000188 3300005330 Bacteria 31774
3 Ga0070682_100178332 3300005337 Bacteria 1482
4 Ga0070689_100000090 3300005340 Bacteria 52338
5 Ga0070691_10068877 3300005341 Bacteria 1714
6 Ga0070688_100000734 3300005365 Bacteria 16186
7 Ga0070714_100212220 3300005435 Bacteria 1775
8 Ga0070713_100001367 3300005436 Bacteria 15599
9 Ga0070701_10000032 3300005438 Bacteria 35331
10 Ga0070711_100275154 3300005439 Unclassified 1330
11 Ga0070700_100001376 3300005441 Bacteria 12076
12 Ga0070708_100079397 3300005445 Bacteria 2968
13 Ga0070708_100147142 3300005445 Bacteria 2189
14 Ga0068867_100003098 3300005459 Bacteria 11716
15 Ga0070685_10000145 3300005466 Bacteria 46090
16 Ga0070706_100000840 3300005467 Bacteria 33952
17 Ga0070706_100045518 3300005467 Bacteria 4053
18 Ga0070706_100086979 3300005467 Bacteria 2896
19 Ga0070707_100000182 3300005468 Bacteria 61765
20 Ga0070707_100009355 3300005468 Bacteria 9095
21 Ga0070707_100018674 3300005468 Bacteria 6525
22 Ga0070698_100003944 3300005471 Bacteria 16317
23 Ga0070698_100056578 3300005471 Bacteria 3974
24 Ga0070699_100004037 3300005518 Bacteria 12971
25 Ga0070679_100005650 3300005530 Bacteria 11592
26 Ga0070697_100022107 3300005536 Bacteria 5047
27 Ga0070697_100125078 3300005536 Bacteria 2154
28 Ga0070697_100356206 3300005536 Bacteria 1264
29 Ga0070686_100000283 3300005544 Bacteria 34170
30 Ga0070695_100043140 3300005545 Bacteria 2867
31 Ga0068857_100104437 3300005577 Bacteria 2544
32 Ga0068859_100019003 3300005617 Bacteria 6901
33 Ga0068859_100498150 3300005617 Bacteria 1313
34 Ga0068866_10183635 3300005718 Bacteria 1237
35 Ga0068861_100061309 3300005719 Bacteria 2886
36 Ga0068860_100205396 3300005843 Bacteria 1910
37 Ga0081455_10002050 3300005937 Bacteria 24086
38 Ga0075428_100200999 3300006844 Unclassified 2154
39 Ga0075433_10044001 3300006852 Bacteria 3878
40 Ga0075434_100016349 3300006871 Bacteria 7132
41 Ga0097620_100019002 3300006931 Bacteria 6901
42 Ga0097620_100498184 3300006931 Bacteria 1313
43 Ga0075435_100150354 3300007076 Bacteria 1957
44 Ga0099794_10002251 3300007265 Bacteria 7070
45 Ga0105240_10016743 3300009093 Bacteria 9915
46 Ga0105240_10079440 3300009093 Unclassified 4036
47 Ga0105245_10068878 3300009098 Bacteria 3207
48 Ga0114129_10000412 3300009147 Bacteria 50533
49 Ga0114129_10006573 3300009147 Bacteria 16502
50 Ga0114129_10120860 3300009147 Unclassified 3606
51 Ga0105242_10068492 3300009176 Bacteria 2936
52 Ga0105248_10000232 3300009177 Bacteria 63931
53 Ga0105248_10067919 3300009177 Bacteria 4003
54 Ga0099796_10000805 3300010159 Bacteria 5688
55 Ga0157374_10002206 3300013296 Bacteria 16417
56 Ga0157378_10001485 3300013297 Bacteria 21174
57 Ga0157372_10048582 3300013307 Bacteria 4717
58 Ga0157380_10066949 3300014326 Bacteria 2891
59 Ga0197907_10620837 3300020069 Unclassified 3327
60 Ga0206356_10219116 3300020070 Bacteria 2638
61 Ga0206356_11828471 3300020070 Unclassified 2015
62 Ga0206351_10335038 3300020077 Bacteria 2246
63 Ga0206350_10611688 3300020080 Bacteria 1857
64 Ga0224712_10001426 3300022467 Bacteria 5496
65 Ga0228598_1001069 3300024227 Bacteria 6024
66 Ga0207642_10173319 3300025899 Bacteria 1169
67 Ga0207684_10002951 3300025910 Bacteria 16855
68 Ga0207684_10003442 3300025910 Bacteria 15450
69 Ga0207695_10076860 3300025913 Unclassified 3393
70 Ga0207663_10104529 3300025916 Unclassified 1909
71 Ga0207662_10021008 3300025918 Bacteria 3726
72 Ga0207646_10000015 3300025922 Bacteria 337243
73 Ga0207646_10000016 3300025922 Bacteria 337048
74 Ga0207646_10002815 3300025922 Bacteria 20246
75 Ga0207646_10003247 3300025922 Bacteria 18529
76 Ga0207681_10030224 3300025923 Unclassified 3529
77 Ga0207687_10050031 3300025927 Bacteria 2908
78 Ga0207686_10004285 3300025934 Bacteria 7650
79 Ga0207670_10000032 3300025936 Bacteria 112426
80 Ga0207711_10014979 3300025941 Bacteria 6441
81 Ga0207711_10050207 3300025941 Bacteria 3571
82 Ga0207708_10000552 3300026075 Bacteria 28939
83 Ga0207648_10002180 3300026089 Bacteria 21241
84 Ga0207674_10016815 3300026116 Bacteria 7995
85 Ga0207675_100089240 3300026118 Bacteria 2897
86 Ga0209588_1029750 3300027671 Bacteria 1743
87 Ga0265319_1000256 3300028563 Bacteria 40127
88 Ga0265318_10000240 3300028577 Bacteria 47828
89 Ga0265338_10129854 3300028800 Bacteria 1992
90 Ga0265760_10000044 3300031090 Bacteria 38220
91 Ga0265760_10007635 3300031090 Bacteria 3089
92 Ga0265760_10040168 3300031090 Unclassified 1393
93 Ga0265328_10027323 3300031239 Unclassified 2140
94 Ga0265320_10000124 3300031240 Bacteria 67180
95 Ga0265325_10017128 3300031241 Bacteria 4032
96 Ga0265325_10034089 3300031241 Bacteria 2712
97 Ga0265325_10094203 3300031241 Unclassified 1473
98 Ga0265329_10001399 3300031242 Bacteria 11692
99 Ga0265340_10000460 3300031247 Bacteria 22056
100 Ga0265339_10000628 3300031249 Bacteria 27303
101 Ga0265331_10000232 3300031250 Bacteria 67206
102 Ga0265331_10002245 3300031250 Bacteria 13222
103 Ga0265316_10001230 3300031344 Bacteria 27548
104 Ga0265316_10094191 3300031344 Bacteria 2282
105 Ga0265316_10222247 3300031344 Bacteria 1393
106 Ga0307408_100018216 3300031548 Bacteria 4713
107 Ga0265313_10001694 3300031595 Bacteria 20336
108 Ga0265313_10073967 3300031595 Unclassified 1563
109 Ga0265314_10033836 3300031711 Unclassified 3740
110 Ga0265314_10113642 3300031711 Bacteria 1716
111 Ga0265342_10000198 3300031712 Bacteria 67185
112 Ga0265342_10041719 3300031712 Bacteria 2776
113 Ga0307407_10026637 3300031903 Bacteria 3064
114 Ga0307412_10092890 3300031911 Bacteria 2115
115 Ga0307415_100015660 3300032126 Bacteria 4498
116 Ga0373926_0016997 3300035083 Bacteria 2493
117 Ga0373934_0070037 3300035086 Bacteria 1402
118 Ga0373954_0012010 3300035118 Bacteria 3848
119 Ga0373954_0055382 3300035118 Unclassified 1866
120 Ga0373955_0003700 3300035172 Bacteria 6732
121 Ga0373955_0113116 3300035172 Bacteria 1571
122 Ga0373924_0014646 3300035410 Bacteria 2966
123 Ga0373935_0004978 3300035692 Bacteria 7817
124 Ga0373933_0000219 3300035724 Bacteria 37927
125 Ga0373947_0005483 3300035725 Bacteria 7403
126 Ga0373937_0000275 3300036401 Bacteria 49353
127 Ga0373937_0191408 3300036401 Bacteria 1922
128 Ga0373937_0237638 3300036401 Unclassified 1716
129 Ga0373925_0052608 3300037068 Bacteria 3043
130 Ga0436360_0439498 3300039438 Unclassified 1755
131 Ga0436360_0484082 3300039438 Unclassified 1161
132 Ga0436360_0553004 3300039438 Bacteria 1822
133 Ga0436360_1243027 3300039438 Bacteria 2903
134 Ga0436361_0574027 3300039447 Unclassified 1543
135 Ga0436362_0616718 3300039453 Unclassified 1010
136 Ga0436362_0730041 3300039453 Bacteria 4355
137 Ga0451577_0055237 3300042876 Bacteria 3544
138 Ga0451577_0092241 3300042876 Bacteria 2704
139 Ga0466969_0000318 3300044656 Bacteria 26640
140 Ga0453683_0006995 3300044673 Bacteria 7691
141 Ga0466966_0002976 3300044684 Bacteria 11156
142 Ga0466964_0000084 3300044706 Bacteria 21702
143 Ga0453684_0041809 3300044712 Bacteria 6190
144 Ga0466968_0001656 3300044735 Bacteria 8044
145 Ga0466970_0000581 3300044765 Bacteria 17880
146 Ga0466959_0012159 3300045049 Bacteria 6211
147 Ga0451576_0679088 3300045051 Bacteria 1082
148 Ga0495592_0021431 3300046454 Bacteria 4915
149 Ga0495651_0000483 3300046462 Bacteria 30682
150 Ga0495651_0002447 3300046462 Bacteria 14338
151 Ga0495651_0140372 3300046462 Bacteria 1752
152 Ga0495653_0021412 3300046463 Unclassified 5238
153 Ga0495580_0006403 3300046472 Bacteria 9595
154 Ga0495580_0070111 3300046472 Bacteria 2449
155 Ga0495662_0083739 3300046476 Bacteria 1552
156 Ga0495664_0071574 3300046477 Unclassified 2071
157 Ga0495608_0007605 3300046511 Bacteria 7638
158 Ga0495630_0008072 3300046517 Bacteria 7567
159 Ga0495666_0012818 3300046526 Unclassified 4180
160 Ga0495652_0020330 3300046529 Bacteria 5903
161 Ga0495652_0079867 3300046529 Bacteria 2703
162 Ga0495586_0001069 3300046535 Bacteria 15463
163 Ga0495587_0000378 3300046536 Bacteria 31680
164 Ga0495587_0042028 3300046536 Bacteria 2727
165 Ga0495645_0007132 3300046543 Bacteria 7781
166 Ga0495645_0133921 3300046543 Bacteria 1734
167 Ga0495667_0008218 3300046559 Bacteria 7082
168 Ga0495656_0047437 3300046615 Bacteria 1822
169 Ga0495635_0010896 3300046663 Bacteria 6373
170 Ga0495623_0012289 3300046679 Bacteria 5544
171 Ga0495623_0062805 3300046679 Bacteria 2327
172 Ga0495646_0003168 3300046680 Bacteria 10213
173 Ga0495658_0016332 3300046683 Bacteria 3821
174 Ga0495613_0020038 3300046689 Bacteria 4983
175 Ga0495604_0010908 3300047317 Bacteria 7213
176 Ga0495604_0052274 3300047317 Unclassified 3165
177 Ga0495674_0038759 3300047319 Unclassified 4275
178 Ga0495680_0000269 3300047322 Bacteria 57801
179 Ga0495593_0006392 3300047673 Bacteria 6911
180 Ga0495602_0000190 3300048088 Bacteria 58100
181 Ga0495602_0020778 3300048088 Bacteria 6479
182 Ga0495602_0200543 3300048088 Bacteria 1523
183 Ga0495614_0006332 3300048089 Bacteria 5319
184 Ga0496115_0000278 3300048918 Bacteria 44969
185 Ga0501290_000724 3300049513 Bacteria 4896
186 Ga0501291_000140 3300049514 Bacteria 8917
187 Ga0501292_001111 3300049515 Bacteria 3292
188 Ga0501294_000186 3300049517 Bacteria 7636
189 Ga0501295_000071 3300049518 Bacteria 10217
190 Ga0501296_000234 3300049519 Bacteria 5736
191 Ga0501297_000087 3300049520 Bacteria 9547
192 Ga0501298_000920 3300049521 Bacteria 4166
193 Ga0501299_001841 3300049522 Bacteria 2838
194 Ga0501300_001041 3300049523 Bacteria 4222
195 Ga0501301_000100 3300049524 Bacteria 4318
196 Ga0501302_000550 3300049525 Bacteria 1997
197 Ga0501303_000255 3300049526 Bacteria 4447
198 Ga0501040_0171047 3300049576 Bacteria 1538
199 Ga0501042_0195662 3300049578 Bacteria 1458
200 Ga0501198_000353 3300049649 Bacteria 5790
201 Ga0501201_000310 3300049651 Bacteria 4469
202 Ga0501202_001224 3300049652 Bacteria 4053
203 Ga0501206_001007 3300049653 Bacteria 3512
204 Ga0501209_000462 3300049656 Bacteria 4988
205 Ga0501211_000696 3300049658 Bacteria 3407
206 Ga0501223_004971 3300049663 Bacteria 2813
207 Ga0501228_000251 3300049666 Bacteria 3245
208 Ga0501230_000284 3300049667 Bacteria 4692
209 Ga0501233_000983 3300049668 Bacteria 4844
210 Ga0501235_000459 3300049669 Bacteria 7994
211 Ga0501236_000537 3300049670 Bacteria 4236
212 Ga0501239_000872 3300049672 Bacteria 2448
213 Ga0501248_001777 3300049678 Bacteria 1409
214 Ga0501249_002359 3300049679 Bacteria 3813
215 Ga0501251_002341 3300049681 Bacteria 1832
216 Ga0501257_010989 3300049686 Bacteria 2060
217 Ga0501260_000078 3300049689 Bacteria 6585
218 Ga0501261_000238 3300049690 Bacteria 7617
219 Ga0501221_000906 3300049704 Bacteria 4857
220 Ga0501225_0002886 3300049705 Bacteria 5279
221 Ga0501229_000496 3300049706 Bacteria 4441
222 Ga0501234_001684 3300049707 Bacteria 3467
223 Ga0501245_000911 3300049708 Bacteria 3756
224 Ga0501081_0416932 3300049743 Bacteria 995
225 Ga0501264_000716 3300049761 Bacteria 4504
226 Ga0501265_000223 3300049762 Bacteria 5699
227 Ga0501269_001421 3300049766 Bacteria 3128
228 Ga0501270_000193 3300049767 Bacteria 5090
229 Ga0501271_000052 3300049768 Bacteria 8573
230 Ga0501274_000164 3300049771 Bacteria 4157
231 Ga0501275_000542 3300049772 Bacteria 4237
232 Ga0501276_001062 3300049773 Bacteria 1800
233 Ga0501279_000204 3300049775 Bacteria 8220
234 Ga0501280_000223 3300049776 Bacteria 14298
235 Ga0501281_00761 3300049777 Bacteria 2780
236 Ga0501283_000009 3300049779 Bacteria 25835
237 Ga0501226_000895 3300049853 Bacteria 3978
238 nmdc:mga05p37_11342_c1 3300050507 Bacteria 10600
239 nmdc:mga05p37_144007_c1 3300050507 Bacteria 2919
240 nmdc:mga05p37_2616_c1 3300050507 Bacteria 20950
241 nmdc:mga05p37_37536_c1 3300050507 Bacteria 5941
242 nmdc:mga0n895_13572_c1 3300050512 Bacteria 7359
243 nmdc:mga0rr50_122324_c1 3300050513 Bacteria 2073
244 nmdc:mga0a205_20372_c1 3300050515 Bacteria 6256
245 nmdc:mga0a205_38404_c1 3300050515 Bacteria 4606
246 Ga0070673_100003362
247 Ga0070690_100000188
248 Ga0070682_100178332
249 Ga0070689_100000090
250 Ga0070691_10068877
251 Ga0070688_100000734
252 Ga0070714_100212220
253 Ga0070713_100001367
254 Ga0070701_10000032
255 Ga0070711_100275154
256 Ga0070700_100001376
257 Ga0070708_100079397
258 Ga0070708_100147142
259 Ga0068867_100003098
260 Ga0070685_10000145
261 Ga0070706_100000840
262 Ga0070706_100045518
263 Ga0070706_100086979
264 Ga0070707_100000182
265 Ga0070707_100009355
266 Ga0070707_100018674
267 Ga0070698_100003944
268 Ga0070698_100056578
269 Ga0070699_100004037
270 Ga0070679_100005650
271 Ga0070697_100022107
272 Ga0070697_100125078
273 Ga0070697_100356206
274 Ga0070686_100000283
275 Ga0070695_100043140
276 Ga0068857_100104437
277 Ga0068859_100019003
278 Ga0068859_100498150
279 Ga0068866_10183635
280 Ga0068861_100061309
281 Ga0068860_100205396
282 Ga0081455_10002050
283 Ga0075428_100200999
284 Ga0075433_10044001
285 Ga0075434_100016349
286 Ga0097620_100019002
287 Ga0097620_100498184
288 Ga0075435_100150354
289 Ga0099794_10002251
290 Ga0105240_10016743
291 Ga0105240_10079440
292 Ga0105245_10068878
293 Ga0114129_10000412
294 Ga0114129_10006573
295 Ga0114129_10120860
296 Ga0105242_10068492
297 Ga0105248_10000232
298 Ga0105248_10067919
299 Ga0099796_10000805
300 Ga0157374_10002206
301 Ga0157378_10001485
302 Ga0157372_10048582
303 Ga0157380_10066949
304 Ga0197907_10620837
305 Ga0206356_10219116
306 Ga0206356_11828471
307 Ga0206351_10335038
308 Ga0206350_10611688
309 Ga0224712_10001426
310 Ga0228598_1001069
311 Ga0207642_10173319
312 Ga0207684_10002951
313 Ga0207684_10003442
314 Ga0207695_10076860
315 Ga0207663_10104529
316 Ga0207662_10021008
317 Ga0207646_10000015
318 Ga0207646_10000016
319 Ga0207646_10002815
320 Ga0207646_10003247
321 Ga0207681_10030224
322 Ga0207687_10050031
323 Ga0207686_10004285
324 Ga0207670_10000032
325 Ga0207711_10014979
326 Ga0207711_10050207
327 Ga0207708_10000552
328 Ga0207648_10002180
329 Ga0207674_10016815
330 Ga0207675_100089240
331 Ga0209588_1029750
332 Ga0265319_1000256
333 Ga0265318_10000240
334 Ga0265338_10129854
335 Ga0265760_10000044
336 Ga0265760_10007635
337 Ga0265760_10040168
338 Ga0265328_10027323
339 Ga0265320_10000124
340 Ga0265325_10017128
341 Ga0265325_10034089
342 Ga0265325_10094203
343 Ga0265329_10001399
344 Ga0265340_10000460
345 Ga0265339_10000628
346 Ga0265331_10000232
347 Ga0265331_10002245
348 Ga0265316_10001230
349 Ga0265316_10094191
350 Ga0265316_10222247
351 Ga0307408_100018216
352 Ga0265313_10001694
353 Ga0265313_10073967
354 Ga0265314_10033836
355 Ga0265314_10113642
356 Ga0265342_10000198
357 Ga0265342_10041719
358 Ga0307407_10026637
359 Ga0307412_10092890
360 Ga0307415_100015660
361 Ga0373926_0016997
362 Ga0373934_0070037
363 Ga0373954_0012010
364 Ga0373954_0055382
365 Ga0373955_0003700
366 Ga0373955_0113116
367 Ga0373924_0014646
368 Ga0373935_0004978
369 Ga0373933_0000219
370 Ga0373947_0005483
371 Ga0373937_0000275
372 Ga0373937_0191408
373 Ga0373937_0237638
374 Ga0373925_0052608
375 Ga0436360_0439498
376 Ga0436360_0484082
377 Ga0436360_0553004
378 Ga0436360_1243027
379 Ga0436361_0574027
380 Ga0436362_0616718
381 Ga0436362_0730041
382 Ga0451577_0055237
383 Ga0451577_0092241
384 Ga0466969_0000318
385 Ga0453683_0006995
386 Ga0466966_0002976
387 Ga0466964_0000084
388 Ga0453684_0041809
389 Ga0466968_0001656
390 Ga0466970_0000581
391 Ga0466959_0012159
392 Ga0451576_0679088
393 Ga0495592_0021431
394 Ga0495651_0000483
395 Ga0495651_0002447
396 Ga0495651_0140372
397 Ga0495653_0021412
398 Ga0495580_0006403
399 Ga0495580_0070111
400 Ga0495662_0083739
401 Ga0495664_0071574
402 Ga0495608_0007605
403 Ga0495630_0008072
404 Ga0495666_0012818
405 Ga0495652_0020330
406 Ga0495652_0079867
407 Ga0495586_0001069
408 Ga0495587_0000378
409 Ga0495587_0042028
410 Ga0495645_0007132
411 Ga0495645_0133921
412 Ga0495667_0008218
413 Ga0495656_0047437
414 Ga0495635_0010896
415 Ga0495623_0012289
416 Ga0495623_0062805
417 Ga0495646_0003168
418 Ga0495658_0016332
419 Ga0495613_0020038
420 Ga0495604_0010908
421 Ga0495604_0052274
422 Ga0495674_0038759
423 Ga0495680_0000269
424 Ga0495593_0006392
425 Ga0495602_0000190
426 Ga0495602_0020778
427 Ga0495602_0200543
428 Ga0495614_0006332
429 Ga0496115_0000278
430 Ga0501290_000724
431 Ga0501291_000140
432 Ga0501292_001111
433 Ga0501294_000186
434 Ga0501295_000071
435 Ga0501296_000234
436 Ga0501297_000087
437 Ga0501298_000920
438 Ga0501299_001841
439 Ga0501300_001041
440 Ga0501301_000100
441 Ga0501302_000550
442 Ga0501303_000255
443 Ga0501040_0171047
444 Ga0501042_0195662
445 Ga0501198_000353
446 Ga0501201_000310
447 Ga0501202_001224
448 Ga0501206_001007
449 Ga0501209_000462
450 Ga0501211_000696
451 Ga0501223_004971
452 Ga0501228_000251
453 Ga0501230_000284
454 Ga0501233_000983
455 Ga0501235_000459
456 Ga0501236_000537
457 Ga0501239_000872
458 Ga0501248_001777
459 Ga0501249_002359
460 Ga0501251_002341
461 Ga0501257_010989
462 Ga0501260_000078
463 Ga0501261_000238
464 Ga0501221_000906
465 Ga0501225_0002886
466 Ga0501229_000496
467 Ga0501234_001684
468 Ga0501245_000911
469 Ga0501081_0416932
470 Ga0501264_000716
471 Ga0501265_000223
472 Ga0501269_001421
473 Ga0501270_000193
474 Ga0501271_000052
475 Ga0501274_000164
476 Ga0501275_000542
477 Ga0501276_001062
478 Ga0501279_000204
479 Ga0501280_000223
480 Ga0501281_00761
481 Ga0501283_000009
482 Ga0501226_000895
483 nmdc:mga05p37_11342_c1
484 nmdc:mga05p37_144007_c1
485 nmdc:mga05p37_2616_c1
486 nmdc:mga05p37_37536_c1
487 nmdc:mga0n895_13572_c1
488 nmdc:mga0rr50_122324_c1
489 nmdc:mga0a205_20372_c1
490 nmdc:mga0a205_38404_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

4

116

0.91

PF05368

NmrA

NmrA-like family

3

126

0.9

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

3

124

0.87

PF08659

KR

KR domain

1

130

0.86

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

3

239

0.85

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

4

235

0.81

PF07993

NAD_binding_4

Male sterility protein

47

221

0.8

PF04321

RmlD_sub_bind

RmlD substrate binding domain

1

176

0.79

PF13460

NAD_binding_10

NAD(P)H-binding

7

180

0.77

PF07993

NAD_binding_4

Male sterility protein

5

64

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x4g-assembly1.cif.gz_A-2 crystal structure of pa4631, a nucleoside-diphosphate-sugar epimerase from pseudomonas aeruginosa 0.9134 1 326
3wj7-assembly1.cif.gz_C crystal structure of gox2253 0.9009 3 327
2x4g-assembly1.cif.gz_A-2 crystal structure of pa4631, a nucleoside-diphosphate-sugar epimerase from pseudomonas aeruginosa 0.8992 1 326
3wj7-assembly1.cif.gz_C crystal structure of gox2253 0.8929 3 327
3m2p-assembly1.cif.gz_B the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8731 1 322
ID Description Score Start End Superfamily
af_Q94HG6_1_340_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9296 1 327 3.40.50.720
af_Q94HG6_1_340_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9268 1 327 3.40.50.720
af_P96816_2_332_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9202 2 325 3.40.50.720
2x4gA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9134 1 326 3.40.50.720
af_P96816_2_332_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9095 2 325 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7V3H4J9-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9903 1 326 GO:0004029
GO:0005737
AF-A0A2N7QN71-F1-model_v4 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase 0.9855 1 324 GO:0004029
GO:0005737
GO:0016853
AF-A0A662ETU0-F1-model_v4 NAD-dependent dehydratase 0.9848 1 216 GO:0004029
GO:0005737
AF-A0A7V3H4J9-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9843 1 326 GO:0004029
GO:0005737
AF-A0A849S643-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9836 1 194 GO:0004029
GO:0005737

Map