F356686

General Info

Members Datasets Scaffolds Average Seq Length
244 163 488 273

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0825801|Ga0436364_0825801_163_1047
Length 294
Sequence MNGTWRRVDDATLIGEIEIMADPLVLCEIDEKVGIVTLNRPDKLNAISHELQHALTEAFGRADADPATSVVLLRAEGRSFCAGYDIGGRTPDTDDWRSDPVKAHAHLQPQLEFEMIPWLMRKPVIASVQGHVLGGGCELVMLCDLTIAADNATFGEPEVRFSSVGPAIVMPMIIGYKKARELLYFGDQIDARTALELGMINRIVPVAELRQASLRYAKRLSLISPEALYATKRAVNRVVDAGGFRAALYAGLDVVGPLYATTTEAGARFREIARTEGVPAAVRWRSAQFGAPDQ

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
54 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
83 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
92 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
93 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
94 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
95 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
98 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
99 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
109 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
110 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
111 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
118 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
142 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
143 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
146 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
147 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
151 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
152 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
153 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
154 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
155 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
156 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
160 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
161 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
162 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
163 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.13
Metatranscriptomes 1.23
Isolates 1.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.28
Nodule 0
Rhizoplane 1.64
Rhizosphere 82.79
Stem 0
Stem Tuber 0
Unclassified 3.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0825801 3300037853 Bacteria 1845
2 Ga0006562J51391_1024635 3300003578 Bacteria 8410
3 Ga0006562J51391_1024637 3300003578 Bacteria 5240
4 JGI25405J52794_10024964 3300003911 Bacteria 1223
5 Ga0070670_100370735 3300005331 Bacteria 1260
6 Ga0070661_100145934 3300005344 Bacteria 1786
7 Ga0070668_100279820 3300005347 Bacteria 1393
8 Ga0070675_100629681 3300005354 Bacteria 974
9 Ga0070671_100304069 3300005355 Bacteria 1358
10 Ga0070671_100592996 3300005355 Bacteria 957
11 Ga0070709_10028630 3300005434 Bacteria 3324
12 Ga0070709_10041434 3300005434 Bacteria 2837
13 Ga0070713_100028562 3300005436 Bacteria 4405
14 Ga0070713_100119930 3300005436 Bacteria 2305
15 Ga0070713_100311974 3300005436 Bacteria 1451
16 Ga0070713_100528136 3300005436 Bacteria 1116
17 Ga0070713_100618930 3300005436 Bacteria 1030
18 Ga0070710_10003059 3300005437 Bacteria 7953
19 Ga0070710_10043644 3300005437 Bacteria 2484
20 Ga0070710_10181015 3300005437 Bacteria 1319
21 Ga0070711_100037986 3300005439 Bacteria 3233
22 Ga0070700_100284624 3300005441 Bacteria 1200
23 Ga0070694_100044540 3300005444 Unclassified 2970
24 Ga0070708_100186842 3300005445 Bacteria 1938
25 Ga0070681_10348555 3300005458 Bacteria 1391
26 Ga0070706_100405443 3300005467 Bacteria 1269
27 Ga0070707_100013088 3300005468 Bacteria 7753
28 Ga0070698_100045572 3300005471 Unclassified 4488
29 Ga0070699_100007308 3300005518 Bacteria 9615
30 Ga0070684_100151247 3300005535 Bacteria 2103
31 Ga0070697_100003057 3300005536 Bacteria 12829
32 Ga0070697_100333809 3300005536 Unclassified 1307
33 Ga0068853_100500370 3300005539 Bacteria 1147
34 Ga0070686_100314187 3300005544 Bacteria 1166
35 Ga0070665_100497577 3300005548 Bacteria 1230
36 Ga0068855_100248650 3300005563 Bacteria 1984
37 Ga0070664_100114794 3300005564 Bacteria 2353
38 Ga0068857_100214486 3300005577 Bacteria 1757
39 Ga0068856_100124037 3300005614 Bacteria 2585
40 Ga0068860_100288727 3300005843 Bacteria 1604
41 Ga0068862_100167336 3300005844 Bacteria 1966
42 Ga0081455_10006633 3300005937 Bacteria 12376
43 Ga0081455_10124541 3300005937 Bacteria 2025
44 Ga0081538_10091428 3300005981 Bacteria 1571
45 Ga0081539_10026349 3300005985 Bacteria 3711
46 Ga0070717_10069226 3300006028 Unclassified 2938
47 Ga0070717_10183224 3300006028 Bacteria 1826
48 Ga0070717_10270215 3300006028 Bacteria 1506
49 Ga0070717_10311619 3300006028 Bacteria 1401
50 Ga0075363_100228884 3300006048 Bacteria 1067
51 Ga0070716_100006972 3300006173 Bacteria 5540
52 Ga0070716_100258216 3300006173 Bacteria 1191
53 Ga0070716_100472906 3300006173 Bacteria 919
54 Ga0070712_100020124 3300006175 Bacteria 4363
55 Ga0070712_100034285 3300006175 Bacteria 3439
56 Ga0070712_100046383 3300006175 Bacteria 3004
57 Ga0070712_100088040 3300006175 Bacteria 2268
58 Ga0075362_10016793 3300006177 Bacteria 3004
59 Ga0075367_10023270 3300006178 Bacteria 3484
60 Ga0075369_10000205 3300006186 Bacteria 17311
61 Ga0075436_100013634 3300006914 Bacteria 5568
62 Ga0099795_10001642 3300007788 Bacteria 4947
63 Ga0099795_10115219 3300007788 Bacteria 1069
64 Ga0111539_10213559 3300009094 Bacteria 2248
65 Ga0105245_10124047 3300009098 Bacteria 2415
66 Ga0105241_10522023 3300009174 Bacteria 1062
67 Ga0105248_10717211 3300009177 Bacteria 1128
68 Ga0105239_10804662 3300010375 Bacteria 1077
69 Ga0105246_10225329 3300011119 Bacteria 1472
70 Ga0105246_10296723 3300011119 Bacteria 1303
71 Ga0105246_10504502 3300011119 Bacteria 1028
72 Ga0157369_10448104 3300013105 Bacteria 1337
73 Ga0163163_10029206 3300014325 Bacteria 5303
74 Ga0163163_10069540 3300014325 Bacteria 3505
75 Ga0182008_10030066 3300014497 Bacteria 2740
76 Ga0213873_10002665 3300021358 Bacteria 3115
77 Ga0213874_10059951 3300021377 Bacteria 1190
78 Ga0213874_10083403 3300021377 Unclassified 1039
79 Ga0213876_10001244 3300021384 Bacteria 16091
80 Ga0213876_10004945 3300021384 Bacteria 7372
81 Ga0213875_10005733 3300021388 Bacteria 6618
82 Ga0213875_10009055 3300021388 Bacteria 5062
83 Ga0213875_10075533 3300021388 Bacteria 1572
84 Ga0213875_10082739 3300021388 Bacteria 1498
85 Ga0207692_10141220 3300025898 Bacteria 1370
86 Ga0207692_10219222 3300025898 Bacteria 1127
87 Ga0207692_10262227 3300025898 Bacteria 1039
88 Ga0207688_10061048 3300025901 Bacteria 2124
89 Ga0207699_10015462 3300025906 Bacteria 3965
90 Ga0207699_10128867 3300025906 Bacteria 1647
91 Ga0207699_10296878 3300025906 Bacteria 1127
92 Ga0207684_10198775 3300025910 Bacteria 1729
93 Ga0207695_10208547 3300025913 Bacteria 1866
94 Ga0207693_10005035 3300025915 Bacteria 11093
95 Ga0207693_10031502 3300025915 Bacteria 4189
96 Ga0207693_10033448 3300025915 Bacteria 4057
97 Ga0207693_10100856 3300025915 Bacteria 2264
98 Ga0207663_10084279 3300025916 Bacteria 2090
99 Ga0207663_10202659 3300025916 Bacteria 1432
100 Ga0207649_10098369 3300025920 Bacteria 1931
101 Ga0207646_10006099 3300025922 Bacteria 12553
102 Ga0207700_10061288 3300025928 Bacteria 2853
103 Ga0207700_10082573 3300025928 Bacteria 2513
104 Ga0207700_10227824 3300025928 Bacteria 1583
105 Ga0207664_10020759 3300025929 Bacteria 4875
106 Ga0207664_10068327 3300025929 Bacteria 2854
107 Ga0207664_10183955 3300025929 Bacteria 1795
108 Ga0207664_10203277 3300025929 Bacteria 1711
109 Ga0207644_10547694 3300025931 Bacteria 957
110 Ga0207706_10337064 3300025933 Bacteria 1312
111 Ga0207665_10433268 3300025939 Bacteria 1006
112 Ga0207679_10149788 3300025945 Bacteria 1897
113 Ga0207679_10156399 3300025945 Bacteria 1862
114 Ga0207677_10505898 3300026023 Bacteria 1045
115 Ga0207703_10257483 3300026035 Bacteria 1576
116 Ga0207702_10045626 3300026078 Bacteria 3687
117 Ga0207676_10425300 3300026095 Bacteria 1247
118 Ga0268266_10323046 3300028379 Bacteria 1445
119 Ga0268266_10447370 3300028379 Bacteria 1228
120 Ga0268265_10219439 3300028380 Bacteria 1663
121 Ga0268264_10330432 3300028381 Bacteria 1444
122 Ga0265338_10076956 3300028800 Bacteria 2822
123 Ga0265320_10154575 3300031240 Unclassified 1035
124 Ga0265325_10029642 3300031241 Bacteria 2939
125 Ga0265339_10000205 3300031249 Bacteria 48438
126 Ga0265313_10000353 3300031595 Bacteria 50100
127 Ga0265342_10038378 3300031712 Bacteria 2917
128 Ga0307405_10246814 3300031731 Bacteria 1326
129 Ga0307406_10043854 3300031901 Bacteria 2800
130 Ga0307407_10089507 3300031903 Bacteria 1883
131 Ga0307409_100151087 3300031995 Bacteria 2016
132 Ga0307416_100002163 3300032002 Bacteria 11129
133 Ga0307416_100525512 3300032002 Bacteria 1252
134 Ga0307415_100345096 3300032126 Bacteria 1251
135 Ga0373926_0009245 3300035083 Bacteria 3291
136 Ga0373926_0075653 3300035083 Bacteria 1241
137 Ga0373934_0148389 3300035086 Bacteria 960
138 Ga0373953_0129619 3300035117 Bacteria 1075
139 Ga0373956_0037754 3300035119 Bacteria 2136
140 Ga0373956_0069005 3300035119 Bacteria 1611
141 Ga0373957_0017586 3300035120 Bacteria 2493
142 Ga0373957_0024111 3300035120 Bacteria 2182
143 Ga0373943_0129383 3300035170 Bacteria 1350
144 Ga0373946_0081027 3300035171 Bacteria 1421
145 Ga0373961_0017711 3300035241 Bacteria 1853
146 Ga0373931_0098524 3300035691 Bacteria 1641
147 Ga0373935_0059962 3300035692 Bacteria 2434
148 Ga0373927_0387186 3300035695 Bacteria 922
149 Ga0373933_0014206 3300035724 Bacteria 4423
150 Ga0373933_0016298 3300035724 Bacteria 4152
151 Ga0373947_0238807 3300035725 Bacteria 1199
152 Ga0373947_0379065 3300035725 Bacteria 952
153 Ga0373937_0061490 3300036401 Bacteria 3452
154 Ga0395900_0249921 3300037418 Bacteria 1775
155 Ga0395898_0008659 3300037466 Bacteria 10734
156 Ga0436364_0229343 3300037853 Bacteria 2069
157 Ga0436364_0369960 3300037853 Bacteria 9508
158 Ga0436364_0574692 3300037853 Bacteria 1229
159 Ga0436364_0769876 3300037853 Unclassified 2439
160 Ga0436364_0769988 3300037853 Bacteria 3891
161 Ga0436364_1149423 3300037853 Bacteria 148108
162 Ga0436364_1323807 3300037853 Bacteria 32431
163 Ga0436365_0067138 3300039437 Bacteria 1361
164 Ga0436365_0619646 3300039437 Bacteria 30514
165 Ga0436365_0629889 3300039437 Bacteria 11786
166 Ga0436365_0761686 3300039437 Bacteria 12666
167 Ga0436360_0464928 3300039438 Bacteria 1942
168 Ga0436360_0965622 3300039438 Bacteria 2524
169 Ga0436361_0449051 3300039447 Bacteria 2889
170 Ga0436361_0510857 3300039447 Bacteria 3729
171 Ga0436361_1191293 3300039447 Bacteria 1473
172 Ga0436363_0541965 3300039450 Bacteria 1029
173 Ga0436363_0580929 3300039450 Bacteria 5791
174 Ga0436363_0816669 3300039450 Bacteria 2024
175 Ga0436363_1485802 3300039450 Bacteria 2865
176 Ga0436363_1515326 3300039450 Bacteria 952
177 Ga0436362_0113055 3300039453 Bacteria 1293
178 Ga0436362_0236665 3300039453 Bacteria 2186
179 Ga0436362_0360988 3300039453 Bacteria 2675
180 Ga0436362_0664719 3300039453 Unclassified 1063
181 Ga0436362_0692985 3300039453 Bacteria 1658
182 Ga0436362_0974509 3300039453 Bacteria 4492
183 Ga0436362_1091657 3300039453 Bacteria 7827
184 Ga0466959_0257795 3300045049 Bacteria 1201
185 Ga0495592_0048119 3300046454 Bacteria 3173
186 Ga0495580_0200384 3300046472 Bacteria 1375
187 Ga0495662_0078226 3300046476 Bacteria 1607
188 Ga0495664_0017170 3300046477 Bacteria 4135
189 Ga0495594_0029925 3300046499 Bacteria 2944
190 Ga0495618_0195787 3300046514 Bacteria 1280
191 Ga0495618_0257804 3300046514 Bacteria 1092
192 Ga0495640_0182362 3300046533 Bacteria 1337
193 Ga0495587_0058067 3300046536 Bacteria 2274
194 Ga0495645_0141119 3300046543 Bacteria 1680
195 Ga0495667_0022264 3300046559 Bacteria 4271
196 Ga0495667_0167901 3300046559 Bacteria 1410
197 Ga0495634_0035862 3300046642 Bacteria 3394
198 Ga0495635_0130088 3300046663 Bacteria 1716
199 Ga0495657_0088854 3300046675 Bacteria 1986
200 Ga0495599_0356438 3300046678 Bacteria 876
201 Ga0495658_0278442 3300046683 Bacteria 1055
202 Ga0495600_0137366 3300046809 Bacteria 1587
203 Ga0495604_0133627 3300047317 Bacteria 1780
204 Ga0495680_0033523 3300047322 Bacteria 4156
205 Ga0495675_0038639 3300047444 Bacteria 3039
206 Ga0495602_0078603 3300048088 Bacteria 2786
207 Ga0496104_0368665 3300048907 Bacteria 1349
208 Ga0496108_0284669 3300048911 Bacteria 1439
209 Ga0496111_0220280 3300048914 Bacteria 1410
210 Ga0496112_0174998 3300048915 Bacteria 2111
211 Ga0501036_0328906 3300049572 Bacteria 1277
212 Ga0501041_0216374 3300049577 Bacteria 1202
213 Ga0501048_0186208 3300049582 Bacteria 1471
214 Ga0501072_0019671 3300049588 Bacteria 5223
215 Ga0501075_0275176 3300049591 Bacteria 1283
216 Ga0501076_0043864 3300049592 Bacteria 3526
217 Ga0501076_0635048 3300049592 Bacteria 881
218 Ga0501077_0006216 3300049593 Bacteria 7298
219 Ga0501079_0016890 3300049741 Bacteria 5574
220 Ga0501081_0007243 3300049743 Bacteria 7210
221 Ga0501081_0123916 3300049743 Bacteria 1843
222 nmdc:mga03683_13338_c1 3300050489 Bacteria 3022
223 nmdc:mga07m45_2469_c2 3300050496 Bacteria 2540
224 nmdc:mga09592_3837_c1 3300050508 Bacteria 12102
225 nmdc:mga08y16_152559_c1 3300050511 Bacteria 2401
226 nmdc:mga08y16_447545_c1 3300050511 Bacteria 1317
227 nmdc:mga08x19_35572_c1 3300050514 Bacteria 3152
228 nmdc:mga0sz30_1265_c1 3300050516 Bacteria 9023
229 Ga0495601_0004868 3300053077 Bacteria 7792
230 Ga0495612_0002082 3300053078 Bacteria 8226
231 Ga0495595_0061687 3300053084 Bacteria 1756
232 Ga0495619_0015582 3300053085 Bacteria 4811
233 Ga0495619_0046368 3300053085 Bacteria 2857
234 Ga0495619_0070270 3300053085 Bacteria 2341
235 Ga0500651_0069774 3300053093 Bacteria 2188
236 Ga0501084_0002290 3300054114 Bacteria 15379
237 Ga0501084_0380957 3300054114 Bacteria 1192
238 Ga0587083_0020141 3300059505 Bacteria 1226
239 Ga0530510_0000561 3300061734 Bacteria 23933
240 Ga0530510_0502406 3300061734 Bacteria 919
241 2644437131 2643221678 Bacteria 9540101
242 2808842027 2808606359 Bacteria 9866990
243 2808920544 2808606375 Bacteria 9466072
244 2918505684 2918501144 Bacteria 8668083
245 Ga0436364_0825801
246 Ga0006562J51391_1024635
247 Ga0006562J51391_1024637
248 JGI25405J52794_10024964
249 Ga0070670_100370735
250 Ga0070661_100145934
251 Ga0070668_100279820
252 Ga0070675_100629681
253 Ga0070671_100304069
254 Ga0070671_100592996
255 Ga0070709_10028630
256 Ga0070709_10041434
257 Ga0070713_100028562
258 Ga0070713_100119930
259 Ga0070713_100311974
260 Ga0070713_100528136
261 Ga0070713_100618930
262 Ga0070710_10003059
263 Ga0070710_10043644
264 Ga0070710_10181015
265 Ga0070711_100037986
266 Ga0070700_100284624
267 Ga0070694_100044540
268 Ga0070708_100186842
269 Ga0070681_10348555
270 Ga0070706_100405443
271 Ga0070707_100013088
272 Ga0070698_100045572
273 Ga0070699_100007308
274 Ga0070684_100151247
275 Ga0070697_100003057
276 Ga0070697_100333809
277 Ga0068853_100500370
278 Ga0070686_100314187
279 Ga0070665_100497577
280 Ga0068855_100248650
281 Ga0070664_100114794
282 Ga0068857_100214486
283 Ga0068856_100124037
284 Ga0068860_100288727
285 Ga0068862_100167336
286 Ga0081455_10006633
287 Ga0081455_10124541
288 Ga0081538_10091428
289 Ga0081539_10026349
290 Ga0070717_10069226
291 Ga0070717_10183224
292 Ga0070717_10270215
293 Ga0070717_10311619
294 Ga0075363_100228884
295 Ga0070716_100006972
296 Ga0070716_100258216
297 Ga0070716_100472906
298 Ga0070712_100020124
299 Ga0070712_100034285
300 Ga0070712_100046383
301 Ga0070712_100088040
302 Ga0075362_10016793
303 Ga0075367_10023270
304 Ga0075369_10000205
305 Ga0075436_100013634
306 Ga0099795_10001642
307 Ga0099795_10115219
308 Ga0111539_10213559
309 Ga0105245_10124047
310 Ga0105241_10522023
311 Ga0105248_10717211
312 Ga0105239_10804662
313 Ga0105246_10225329
314 Ga0105246_10296723
315 Ga0105246_10504502
316 Ga0157369_10448104
317 Ga0163163_10029206
318 Ga0163163_10069540
319 Ga0182008_10030066
320 Ga0213873_10002665
321 Ga0213874_10059951
322 Ga0213874_10083403
323 Ga0213876_10001244
324 Ga0213876_10004945
325 Ga0213875_10005733
326 Ga0213875_10009055
327 Ga0213875_10075533
328 Ga0213875_10082739
329 Ga0207692_10141220
330 Ga0207692_10219222
331 Ga0207692_10262227
332 Ga0207688_10061048
333 Ga0207699_10015462
334 Ga0207699_10128867
335 Ga0207699_10296878
336 Ga0207684_10198775
337 Ga0207695_10208547
338 Ga0207693_10005035
339 Ga0207693_10031502
340 Ga0207693_10033448
341 Ga0207693_10100856
342 Ga0207663_10084279
343 Ga0207663_10202659
344 Ga0207649_10098369
345 Ga0207646_10006099
346 Ga0207700_10061288
347 Ga0207700_10082573
348 Ga0207700_10227824
349 Ga0207664_10020759
350 Ga0207664_10068327
351 Ga0207664_10183955
352 Ga0207664_10203277
353 Ga0207644_10547694
354 Ga0207706_10337064
355 Ga0207665_10433268
356 Ga0207679_10149788
357 Ga0207679_10156399
358 Ga0207677_10505898
359 Ga0207703_10257483
360 Ga0207702_10045626
361 Ga0207676_10425300
362 Ga0268266_10323046
363 Ga0268266_10447370
364 Ga0268265_10219439
365 Ga0268264_10330432
366 Ga0265338_10076956
367 Ga0265320_10154575
368 Ga0265325_10029642
369 Ga0265339_10000205
370 Ga0265313_10000353
371 Ga0265342_10038378
372 Ga0307405_10246814
373 Ga0307406_10043854
374 Ga0307407_10089507
375 Ga0307409_100151087
376 Ga0307416_100002163
377 Ga0307416_100525512
378 Ga0307415_100345096
379 Ga0373926_0009245
380 Ga0373926_0075653
381 Ga0373934_0148389
382 Ga0373953_0129619
383 Ga0373956_0037754
384 Ga0373956_0069005
385 Ga0373957_0017586
386 Ga0373957_0024111
387 Ga0373943_0129383
388 Ga0373946_0081027
389 Ga0373961_0017711
390 Ga0373931_0098524
391 Ga0373935_0059962
392 Ga0373927_0387186
393 Ga0373933_0014206
394 Ga0373933_0016298
395 Ga0373947_0238807
396 Ga0373947_0379065
397 Ga0373937_0061490
398 Ga0395900_0249921
399 Ga0395898_0008659
400 Ga0436364_0229343
401 Ga0436364_0369960
402 Ga0436364_0574692
403 Ga0436364_0769876
404 Ga0436364_0769988
405 Ga0436364_1149423
406 Ga0436364_1323807
407 Ga0436365_0067138
408 Ga0436365_0619646
409 Ga0436365_0629889
410 Ga0436365_0761686
411 Ga0436360_0464928
412 Ga0436360_0965622
413 Ga0436361_0449051
414 Ga0436361_0510857
415 Ga0436361_1191293
416 Ga0436363_0541965
417 Ga0436363_0580929
418 Ga0436363_0816669
419 Ga0436363_1485802
420 Ga0436363_1515326
421 Ga0436362_0113055
422 Ga0436362_0236665
423 Ga0436362_0360988
424 Ga0436362_0664719
425 Ga0436362_0692985
426 Ga0436362_0974509
427 Ga0436362_1091657
428 Ga0466959_0257795
429 Ga0495592_0048119
430 Ga0495580_0200384
431 Ga0495662_0078226
432 Ga0495664_0017170
433 Ga0495594_0029925
434 Ga0495618_0195787
435 Ga0495618_0257804
436 Ga0495640_0182362
437 Ga0495587_0058067
438 Ga0495645_0141119
439 Ga0495667_0022264
440 Ga0495667_0167901
441 Ga0495634_0035862
442 Ga0495635_0130088
443 Ga0495657_0088854
444 Ga0495599_0356438
445 Ga0495658_0278442
446 Ga0495600_0137366
447 Ga0495604_0133627
448 Ga0495680_0033523
449 Ga0495675_0038639
450 Ga0495602_0078603
451 Ga0496104_0368665
452 Ga0496108_0284669
453 Ga0496111_0220280
454 Ga0496112_0174998
455 Ga0501036_0328906
456 Ga0501041_0216374
457 Ga0501048_0186208
458 Ga0501072_0019671
459 Ga0501075_0275176
460 Ga0501076_0043864
461 Ga0501076_0635048
462 Ga0501077_0006216
463 Ga0501079_0016890
464 Ga0501081_0007243
465 Ga0501081_0123916
466 nmdc:mga03683_13338_c1
467 nmdc:mga07m45_2469_c2
468 nmdc:mga09592_3837_c1
469 nmdc:mga08y16_152559_c1
470 nmdc:mga08y16_447545_c1
471 nmdc:mga08x19_35572_c1
472 nmdc:mga0sz30_1265_c1
473 Ga0495601_0004868
474 Ga0495612_0002082
475 Ga0495595_0061687
476 Ga0495619_0015582
477 Ga0495619_0046368
478 Ga0495619_0070270
479 Ga0500651_0069774
480 Ga0501084_0002290
481 Ga0501084_0380957
482 Ga0587083_0020141
483 Ga0530510_0000561
484 Ga0530510_0502406
485 2644437131
486 2808842027
487 2808920544
488 2918505684

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

33

264

0.89

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

28

271

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7eum-assembly1.cif.gz_E crystal structure of apo nmar_1308 protein at cryogenic temperature 0.8788 10 241
7eum-assembly1.cif.gz_F crystal structure of apo nmar_1308 protein at cryogenic temperature 0.8784 10 241
5e0n-assembly1.cif.gz_X crystal structure of msmeg_3139, a monofunctional enoyl coa isomerase from m.smegmatis 0.8777 9 227
3l3s-assembly1.cif.gz_B crystal structure of an enoyl-coa hydrotase/isomerase family protein from silicibacter pomeroyi 0.8773 10 234
7eum-assembly1.cif.gz_A crystal structure of apo nmar_1308 protein at cryogenic temperature 0.8727 10 241
ID Description Score Start End Superfamily
3rsiC01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9169 9 62 3.30.300.220
5e0nX00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8777 9 227 3.90.226.10
af_A0A368UJF6_4_227_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8753 6 236 3.90.226.10
3hrxF01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.873 10 209 3.90.226.10
af_Q3MIE0_45_243_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8705 9 209 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A558GLN6-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.8947 9 213 GO:0016853
AF-A0A843A205-F1-model_v4 deleted 0.8931 9 238
AF-A0A2V7TCJ6-F1-model_v4 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase 0.8821 4 241 GO:0003824
AF-A0A520IHK3-F1-model_v4 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 4.2.1.17) 0.8817 9 241 GO:0004300
GO:0016853
AF-A0A2E7G675-F1-model_v4 deleted 0.8776 9 226

Map