F356648

General Info

Members Datasets Scaffolds Average Seq Length
244 160 460 186

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10335830|Ga0307406_103358301
Length 190
Sequence MSTKVEATIEDLYKVEGKAELVNGEIILMSPTGGLAGYAGDKIFSSLLEYSERRKFGCPVGDNKAFVVNLPHRRSFSPDAAFYLGAVTMDFFEGAPVFAVEVRSKGDYGPTAELKMAKKRADYFAAGTLVVWDVDLTSEDVVRVYRSSDAERPTIYRRGEIAEAEPAVPGWTMAVDDLFRENTHRQTYEH

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
101 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
102 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
107 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
108 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
114 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
115 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
116 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
117 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
118 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
121 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
122 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
123 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
124 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
125 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
126 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
127 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
128 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
129 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
130 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
131 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
132 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
133 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
134 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
135 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
136 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
137 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
138 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
139 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
140 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
141 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
142 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
143 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
144 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
145 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
146 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
147 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
148 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
149 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
150 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
151 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
152 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
153 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
160 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 2.05
Rhizosphere 96.72
Stem 0
Stem Tuber 0
Unclassified 34.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_10335830 3300031901 Unclassified 1175
2 JGI25406J46586_10033788 3300003203 Unclassified 1884
3 Ga0065715_10142414 3300005293 Bacteria 1833
4 Ga0070670_100072244 3300005331 Bacteria 2963
5 Ga0070670_100590020 3300005331 Bacteria 994
6 Ga0070677_10026194 3300005333 Bacteria 2184
7 Ga0070682_100011788 3300005337 Bacteria 5001
8 Ga0070682_100025908 3300005337 Bacteria 3504
9 Ga0070689_100003649 3300005340 Bacteria 10271
10 Ga0070689_100322628 3300005340 Bacteria 1290
11 Ga0070687_100064115 3300005343 Bacteria 1951
12 Ga0070687_100270473 3300005343 Bacteria 1065
13 Ga0070692_10041514 3300005345 Unclassified 2357
14 Ga0070692_10044736 3300005345 Unclassified 2282
15 Ga0070669_100341968 3300005353 Bacteria 1213
16 Ga0070671_100340245 3300005355 Unclassified 1280
17 Ga0070671_100799799 3300005355 Unclassified 821
18 Ga0070674_100577782 3300005356 Bacteria 946
19 Ga0070673_100870123 3300005364 Unclassified 835
20 Ga0070701_10542670 3300005438 Bacteria 761
21 Ga0070705_100018681 3300005440 Unclassified 3638
22 Ga0070705_100344997 3300005440 Bacteria 1084
23 Ga0070705_100550445 3300005440 Bacteria 884
24 Ga0070700_100308537 3300005441 Bacteria 1158
25 Ga0070694_100015661 3300005444 Bacteria 4766
26 Ga0070694_100502641 3300005444 Bacteria 965
27 Ga0070678_100821970 3300005456 Unclassified 845
28 Ga0070685_10014556 3300005466 Bacteria 4169
29 Ga0070698_100369105 3300005471 Bacteria 1367
30 Ga0070698_100412966 3300005471 Bacteria 1284
31 Ga0068853_100135194 3300005539 Viruses 2209
32 Ga0068853_100447398 3300005539 Bacteria 1215
33 Ga0070672_100058148 3300005543 Bacteria 3038
34 Ga0070695_100001930 3300005545 Bacteria 11744
35 Ga0070695_100044540 3300005545 Unclassified 2826
36 Ga0070693_100001199 3300005547 Bacteria 11666
37 Ga0070693_100129061 3300005547 Unclassified 1578
38 Ga0070693_100283994 3300005547 Bacteria 1109
39 Ga0070704_100021193 3300005549 Unclassified 4208
40 Ga0068855_100807128 3300005563 Unclassified 997
41 Ga0070664_100697504 3300005564 Unclassified 946
42 Ga0068857_100485899 3300005577 Unclassified 1157
43 Ga0068857_101059744 3300005577 Unclassified 782
44 Ga0070702_100047805 3300005615 Unclassified 2432
45 Ga0070702_100052793 3300005615 Unclassified 2332
46 Ga0070702_100066387 3300005615 Bacteria 2115
47 Ga0068852_100089085 3300005616 Unclassified 2757
48 Ga0068852_100365271 3300005616 Bacteria 1413
49 Ga0068859_100107461 3300005617 Bacteria 2850
50 Ga0068859_100255572 3300005617 Bacteria 1843
51 Ga0068859_100299342 3300005617 Bacteria 1702
52 Ga0068864_100013788 3300005618 Bacteria 6700
53 Ga0068864_100021137 3300005618 Bacteria 5449
54 Ga0068864_100115781 3300005618 Bacteria 2391
55 Ga0068861_100246954 3300005719 Bacteria 1521
56 Ga0068861_100444353 3300005719 Unclassified 1160
57 Ga0068851_10002438 3300005834 Bacteria 8163
58 Ga0068870_10054922 3300005840 Unclassified 2120
59 Ga0068863_100018388 3300005841 Bacteria 6689
60 Ga0068863_100170641 3300005841 Bacteria 2086
61 Ga0068863_100446033 3300005841 Unclassified 1270
62 Ga0068858_100080245 3300005842 Unclassified 3032
63 Ga0068858_100160015 3300005842 Bacteria 2120
64 Ga0068860_100071987 3300005843 Bacteria 3285
65 Ga0068860_100087372 3300005843 Viruses 2968
66 Ga0068860_100774928 3300005843 Unclassified 972
67 Ga0068862_100332777 3300005844 Bacteria 1405
68 Ga0068862_100409142 3300005844 Bacteria 1270
69 Ga0081539_10002156 3300005985 Bacteria 29018
70 Ga0081539_10056313 3300005985 Bacteria 2182
71 Ga0097621_100024763 3300006237 Unclassified 4690
72 Ga0097621_100217534 3300006237 Bacteria 1663
73 Ga0068871_100013691 3300006358 Bacteria 6028
74 Ga0068871_100047356 3300006358 Unclassified 3467
75 Ga0075428_100048375 3300006844 Bacteria 4667
76 Ga0075428_100190279 3300006844 Bacteria 2220
77 Ga0075430_100135508 3300006846 Unclassified 2052
78 Ga0075430_100259391 3300006846 Unclassified 1440
79 Ga0075431_100040602 3300006847 Bacteria 4797
80 Ga0075431_100123151 3300006847 Bacteria 2675
81 Ga0075433_10040072 3300006852 Bacteria 4053
82 Ga0075429_100038042 3300006880 Bacteria 4188
83 Ga0097620_100107462 3300006931 Bacteria 2850
84 Ga0097620_100255562 3300006931 Bacteria 1843
85 Ga0097620_100299356 3300006931 Bacteria 1702
86 Ga0105251_10283526 3300009011 Unclassified 749
87 Ga0105240_10101179 3300009093 Bacteria 3506
88 Ga0111539_10735703 3300009094 Bacteria 1148
89 Ga0105245_10962238 3300009098 Unclassified 897
90 Ga0114129_10382280 3300009147 Unclassified 1859
91 Ga0105241_11097671 3300009174 Unclassified 749
92 Ga0105248_10172418 3300009177 Bacteria 2439
93 Ga0105237_10003426 3300009545 Bacteria 18844
94 Ga0105238_10009901 3300009551 Bacteria 9556
95 Ga0105238_10046462 3300009551 Bacteria 4382
96 Ga0105249_10002707 3300009553 Bacteria 15316
97 Ga0105246_10147913 3300011119 Unclassified 1775
98 Ga0105246_10508943 3300011119 Unclassified 1024
99 Ga0157325_1008724 3300012485 Unclassified 710
100 Ga0157378_10023348 3300013297 Bacteria 5443
101 Ga0157375_11705145 3300013308 Unclassified 746
102 Ga0163163_11717611 3300014325 Unclassified 688
103 Ga0163163_11854732 3300014325 Unclassified 663
104 Ga0163161_10371645 3300017792 Bacteria 1141
105 Ga0207656_10004389 3300025321 Unclassified 4924
106 Ga0207647_10000502 3300025904 Bacteria 31375
107 Ga0207645_10153985 3300025907 Bacteria 1501
108 Ga0207643_10009901 3300025908 Bacteria 5122
109 Ga0207671_10002224 3300025914 Bacteria 21048
110 Ga0207662_10065907 3300025918 Bacteria 2181
111 Ga0207662_10498539 3300025918 Unclassified 838
112 Ga0207649_10141867 3300025920 Bacteria 1645
113 Ga0207694_10005857 3300025924 Bacteria 9421
114 Ga0207694_10025906 3300025924 Unclassified 4458
115 Ga0207650_10222561 3300025925 Bacteria 1519
116 Ga0207650_10335857 3300025925 Bacteria 1240
117 Ga0207659_10516102 3300025926 Bacteria 1013
118 Ga0207644_10946373 3300025931 Unclassified 722
119 Ga0207670_10000293 3300025936 Bacteria 30293
120 Ga0207669_11009316 3300025937 Unclassified 699
121 Ga0207691_10003527 3300025940 Bacteria 15215
122 Ga0207711_10842547 3300025941 Unclassified 853
123 Ga0207703_10051479 3300026035 Viruses 3337
124 Ga0207703_10111514 3300026035 Bacteria 2335
125 Ga0207639_10013949 3300026041 Bacteria 5639
126 Ga0207639_10508625 3300026041 Unclassified 1102
127 Ga0207708_10152610 3300026075 Unclassified 1820
128 Ga0207641_10150709 3300026088 Bacteria 2106
129 Ga0207641_10548385 3300026088 Unclassified 1127
130 Ga0207676_10013106 3300026095 Bacteria 5951
131 Ga0207676_10410012 3300026095 Unclassified 1268
132 Ga0207676_10587956 3300026095 Unclassified 1068
133 Ga0207675_100136331 3300026118 Bacteria 2329
134 Ga0207675_100488397 3300026118 Unclassified 1225
135 Ga0207698_10301942 3300026142 Unclassified 1491
136 Ga0268265_10249611 3300028380 Unclassified 1571
137 Ga0268264_10534097 3300028381 Bacteria 1148
138 Ga0268264_10569271 3300028381 Bacteria 1113
139 Ga0307515_10153344 3300028794 Bacteria 2395
140 Ga0307408_100004342 3300031548 Bacteria 9628
141 Ga0307405_10002830 3300031731 Bacteria 7791
142 Ga0307413_10020798 3300031824 Bacteria 3499
143 Ga0307410_10004356 3300031852 Bacteria 7305
144 Ga0307406_10000578 3300031901 Bacteria 21116
145 Ga0307407_10105485 3300031903 Unclassified 1758
146 Ga0307412_10003529 3300031911 Bacteria 8685
147 Ga0307416_100007823 3300032002 Bacteria 6833
148 Ga0307414_10003917 3300032004 Bacteria 8022
149 Ga0307414_10160687 3300032004 Bacteria 1784
150 Ga0307411_10014691 3300032005 Bacteria 4367
151 Ga0307415_100002403 3300032126 Bacteria 9337
152 Ga0373940_0006278 3300035088 Unclassified 2629
153 Ga0373951_0000545 3300035091 Bacteria 10604
154 Ga0373941_0144014 3300035115 Unclassified 869
155 Ga0373931_0094480 3300035691 Unclassified 1672
156 Ga0395905_0010371 3300037471 Bacteria 9071
157 Ga0395905_0076002 3300037471 Bacteria 3147
158 Ga0436365_0840558 3300039437 Bacteria 1106
159 Ga0436362_0413922 3300039453 Unclassified 906
160 Ga0439455_0012392 3300042012 Bacteria 1914
161 Ga0439458_0004965 3300042157 Bacteria 3013
162 Ga0453683_0432502 3300044673 Bacteria 850
163 Ga0496108_0000011 3300048911 Bacteria 263294
164 Ga0496110_0021143 3300048913 Bacteria 5501
165 Ga0496112_0439346 3300048915 Bacteria 1243
166 Ga0496113_0027142 3300048916 Bacteria 4101
167 Ga0496113_0321656 3300048916 Unclassified 1240
168 Ga0501291_001195 3300049514 Bacteria 3000
169 Ga0501292_011740 3300049515 Bacteria 1329
170 Ga0501292_019472 3300049515 Unclassified 1086
171 Ga0501294_028786 3300049517 Unclassified 638
172 Ga0501298_003654 3300049521 Bacteria 2394
173 Ga0501299_005791 3300049522 Bacteria 1914
174 Ga0501038_0001016 3300049574 Bacteria 25252
175 Ga0501076_0170670 3300049592 Unclassified 1773
176 Ga0501198_032086 3300049649 Unclassified 881
177 Ga0501202_002477 3300049652 Unclassified 3098
178 Ga0501207_003347 3300049654 Bacteria 2130
179 Ga0501207_074816 3300049654 Unclassified 642
180 Ga0501208_001754 3300049655 Bacteria 2134
181 Ga0501209_009059 3300049656 Unclassified 1992
182 Ga0501214_002747 3300049659 Unclassified 1507
183 Ga0501216_002290 3300049660 Bacteria 2700
184 Ga0501216_011291 3300049660 Bacteria 1449
185 Ga0501217_000160 3300049661 Bacteria 9490
186 Ga0501217_006222 3300049661 Bacteria 2528
187 Ga0501217_050047 3300049661 Bacteria 1089
188 Ga0501223_004038 3300049663 Unclassified 3160
189 Ga0501224_000605 3300049664 Unclassified 4418
190 Ga0501227_003540 3300049665 Unclassified 3384
191 Ga0501227_020770 3300049665 Bacteria 1509
192 Ga0501233_000394 3300049668 Bacteria 6890
193 Ga0501235_000627 3300049669 Bacteria 7109
194 Ga0501235_005234 3300049669 Unclassified 2821
195 Ga0501235_006370 3300049669 Bacteria 2570
196 Ga0501236_004658 3300049670 Bacteria 1635
197 Ga0501243_005199 3300049675 Bacteria 1957
198 Ga0501247_045031 3300049677 Unclassified 640
199 Ga0501249_008282 3300049679 Bacteria 2157
200 Ga0501249_060318 3300049679 Unclassified 878
201 Ga0501249_062120 3300049679 Bacteria 866
202 Ga0501253_084981 3300049683 Unclassified 719
203 Ga0501253_114140 3300049683 Unclassified 647
204 Ga0501256_002353 3300049685 Bacteria 1495
205 Ga0501259_003770 3300049688 Bacteria 2410
206 Ga0501261_002338 3300049690 Bacteria 2329
207 Ga0501221_014136 3300049704 Unclassified 1479
208 Ga0501225_0001537 3300049705 Bacteria 7245
209 Ga0501225_0012131 3300049705 Bacteria 2420
210 Ga0501229_018236 3300049706 Unclassified 919
211 Ga0501229_025695 3300049706 Bacteria 793
212 Ga0501234_004900 3300049707 Bacteria 2102
213 Ga0501234_017802 3300049707 Unclassified 1124
214 Ga0501266_003490 3300049763 Bacteria 1950
215 Ga0501272_011382 3300049769 Bacteria 1001
216 Ga0501273_008586 3300049770 Unclassified 1226
217 Ga0501276_004720 3300049773 Bacteria 1030
218 Ga0501279_014183 3300049775 Unclassified 1096
219 Ga0501283_010700 3300049779 Bacteria 1353
220 Ga0501212_018463 3300049851 Unclassified 1062
221 Ga0501226_000714 3300049853 Unclassified 4502
222 nmdc:mga05p37_24683_c1 3300050507 Bacteria 7307
223 nmdc:mga09592_51385_c1 3300050508 Bacteria 3478
224 nmdc:mga0qj67_404767_c1 3300050509 Bacteria 1101
225 nmdc:mga0qj67_434038_c1 3300050509 Bacteria 1059
226 nmdc:mga0qj67_560558_c1 3300050509 Bacteria 916
227 nmdc:mga06r32_47164_c1 3300050510 Bacteria 4114
228 nmdc:mga0a205_1845_c1 3300050515 Bacteria 16567
229 Ga0500616_0001488 3300053153 Bacteria 22216
230 Ga0590071_113984 3300059421 Unclassified 687
231 Ga0307406_10335830
232 JGI25406J46586_10033788
233 Ga0065715_10142414
234 Ga0070670_100072244
235 Ga0070670_100590020
236 Ga0070677_10026194
237 Ga0070682_100011788
238 Ga0070682_100025908
239 Ga0070689_100003649
240 Ga0070689_100322628
241 Ga0070687_100064115
242 Ga0070687_100270473
243 Ga0070692_10041514
244 Ga0070692_10044736
245 Ga0070669_100341968
246 Ga0070671_100340245
247 Ga0070671_100799799
248 Ga0070674_100577782
249 Ga0070673_100870123
250 Ga0070701_10542670
251 Ga0070705_100018681
252 Ga0070705_100344997
253 Ga0070705_100550445
254 Ga0070700_100308537
255 Ga0070694_100015661
256 Ga0070694_100502641
257 Ga0070678_100821970
258 Ga0070685_10014556
259 Ga0070698_100369105
260 Ga0070698_100412966
261 Ga0068853_100135194
262 Ga0068853_100447398
263 Ga0070672_100058148
264 Ga0070695_100001930
265 Ga0070695_100044540
266 Ga0070693_100001199
267 Ga0070693_100129061
268 Ga0070693_100283994
269 Ga0070704_100021193
270 Ga0068855_100807128
271 Ga0070664_100697504
272 Ga0068857_100485899
273 Ga0068857_101059744
274 Ga0070702_100047805
275 Ga0070702_100052793
276 Ga0070702_100066387
277 Ga0068852_100089085
278 Ga0068852_100365271
279 Ga0068859_100107461
280 Ga0068859_100255572
281 Ga0068859_100299342
282 Ga0068864_100013788
283 Ga0068864_100021137
284 Ga0068864_100115781
285 Ga0068861_100246954
286 Ga0068861_100444353
287 Ga0068851_10002438
288 Ga0068870_10054922
289 Ga0068863_100018388
290 Ga0068863_100170641
291 Ga0068863_100446033
292 Ga0068858_100080245
293 Ga0068858_100160015
294 Ga0068860_100071987
295 Ga0068860_100087372
296 Ga0068860_100774928
297 Ga0068862_100332777
298 Ga0068862_100409142
299 Ga0081539_10002156
300 Ga0081539_10056313
301 Ga0097621_100024763
302 Ga0097621_100217534
303 Ga0068871_100013691
304 Ga0068871_100047356
305 Ga0075428_100048375
306 Ga0075428_100190279
307 Ga0075430_100135508
308 Ga0075430_100259391
309 Ga0075431_100040602
310 Ga0075431_100123151
311 Ga0075433_10040072
312 Ga0075429_100038042
313 Ga0097620_100107462
314 Ga0097620_100255562
315 Ga0097620_100299356
316 Ga0105251_10283526
317 Ga0105240_10101179
318 Ga0111539_10735703
319 Ga0105245_10962238
320 Ga0114129_10382280
321 Ga0105241_11097671
322 Ga0105248_10172418
323 Ga0105237_10003426
324 Ga0105238_10009901
325 Ga0105238_10046462
326 Ga0105249_10002707
327 Ga0105246_10147913
328 Ga0105246_10508943
329 Ga0157325_1008724
330 Ga0157378_10023348
331 Ga0157375_11705145
332 Ga0163163_11717611
333 Ga0163163_11854732
334 Ga0163161_10371645
335 Ga0207656_10004389
336 Ga0207647_10000502
337 Ga0207645_10153985
338 Ga0207643_10009901
339 Ga0207671_10002224
340 Ga0207662_10065907
341 Ga0207662_10498539
342 Ga0207649_10141867
343 Ga0207694_10005857
344 Ga0207694_10025906
345 Ga0207650_10222561
346 Ga0207650_10335857
347 Ga0207659_10516102
348 Ga0207644_10946373
349 Ga0207670_10000293
350 Ga0207669_11009316
351 Ga0207691_10003527
352 Ga0207711_10842547
353 Ga0207703_10051479
354 Ga0207703_10111514
355 Ga0207639_10013949
356 Ga0207639_10508625
357 Ga0207708_10152610
358 Ga0207641_10150709
359 Ga0207641_10548385
360 Ga0207676_10013106
361 Ga0207676_10410012
362 Ga0207676_10587956
363 Ga0207675_100136331
364 Ga0207675_100488397
365 Ga0207698_10301942
366 Ga0268265_10249611
367 Ga0268264_10534097
368 Ga0268264_10569271
369 Ga0307515_10153344
370 Ga0307408_100004342
371 Ga0307405_10002830
372 Ga0307413_10020798
373 Ga0307410_10004356
374 Ga0307406_10000578
375 Ga0307407_10105485
376 Ga0307412_10003529
377 Ga0307416_100007823
378 Ga0307414_10003917
379 Ga0307414_10160687
380 Ga0307411_10014691
381 Ga0307415_100002403
382 Ga0373940_0006278
383 Ga0373951_0000545
384 Ga0373941_0144014
385 Ga0373931_0094480
386 Ga0395905_0010371
387 Ga0395905_0076002
388 Ga0436365_0840558
389 Ga0436362_0413922
390 Ga0439455_0012392
391 Ga0439458_0004965
392 Ga0453683_0432502
393 Ga0496108_0000011
394 Ga0496110_0021143
395 Ga0496112_0439346
396 Ga0496113_0027142
397 Ga0496113_0321656
398 Ga0501291_001195
399 Ga0501292_011740
400 Ga0501292_019472
401 Ga0501294_028786
402 Ga0501298_003654
403 Ga0501299_005791
404 Ga0501038_0001016
405 Ga0501076_0170670
406 Ga0501198_032086
407 Ga0501202_002477
408 Ga0501207_003347
409 Ga0501207_074816
410 Ga0501208_001754
411 Ga0501209_009059
412 Ga0501214_002747
413 Ga0501216_002290
414 Ga0501216_011291
415 Ga0501217_000160
416 Ga0501217_006222
417 Ga0501217_050047
418 Ga0501223_004038
419 Ga0501224_000605
420 Ga0501227_003540
421 Ga0501227_020770
422 Ga0501233_000394
423 Ga0501235_000627
424 Ga0501235_005234
425 Ga0501235_006370
426 Ga0501236_004658
427 Ga0501243_005199
428 Ga0501247_045031
429 Ga0501249_008282
430 Ga0501249_060318
431 Ga0501249_062120
432 Ga0501253_084981
433 Ga0501253_114140
434 Ga0501256_002353
435 Ga0501259_003770
436 Ga0501261_002338
437 Ga0501221_014136
438 Ga0501225_0001537
439 Ga0501225_0012131
440 Ga0501229_018236
441 Ga0501229_025695
442 Ga0501234_004900
443 Ga0501234_017802
444 Ga0501266_003490
445 Ga0501272_011382
446 Ga0501273_008586
447 Ga0501276_004720
448 Ga0501279_014183
449 Ga0501283_010700
450 Ga0501212_018463
451 Ga0501226_000714
452 nmdc:mga05p37_24683_c1
453 nmdc:mga09592_51385_c1
454 nmdc:mga0qj67_404767_c1
455 nmdc:mga0qj67_434038_c1
456 nmdc:mga0qj67_560558_c1
457 nmdc:mga06r32_47164_c1
458 nmdc:mga0a205_1845_c1
459 Ga0500616_0001488
460 Ga0590071_113984

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05685

Uma2

Putative restriction endonuclease

7

176

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6okh-assembly1.cif.gz_B structure of an uncharacterized protein from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.8134 17 192
1wdj-assembly1.cif.gz_B crystal structure of tt1808 from thermus thermophilus hb8 0.805 37 189
6okh-assembly1.cif.gz_B structure of an uncharacterized protein from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.8007 17 192
1wdj-assembly1.cif.gz_C crystal structure of tt1808 from thermus thermophilus hb8 0.7969 19 189
1wdj-assembly1.cif.gz_B crystal structure of tt1808 from thermus thermophilus hb8 0.7954 37 189
ID Description Score Start End Superfamily
1wdjB00 Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A 0.805 37 189 3.90.1570.10
1wdjC00 Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A 0.7969 19 189 3.90.1570.10
1wdjB00 Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A 0.7954 37 189 3.90.1570.10
3ot2B00 Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A 0.769 18 189 3.90.1570.10
af_Q9VII8_348_612_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7679 152 168 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A7W0MJU0-F1-model_v4 Uma2 family endonuclease 0.9951 13 191 GO:0004519
AF-A0A534XIK7-F1-model_v4 Uma2 family endonuclease 0.994 13 192 GO:0004519
AF-A0A2V9LY67-F1-model_v4 Uma2 family endonuclease 0.9908 39 189 GO:0004519
AF-A0A7C4ZLQ9-F1-model_v4 Uma2 family endonuclease 0.99 12 191 GO:0004519
AF-A0A1Q7Y3X0-F1-model_v4 Putative restriction endonuclease domain-containing protein 0.9889 67 189

Map