F356625

General Info

Members Datasets Scaffolds Average Seq Length
244 169 217 384

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10038723|Ga0307515_100387236
Length 344
Sequence MPEMPPFLPYGRQTIEDDDVAAVTAALRADFLTTGPTVEAFETAFKRKVGAEHAIAVANGTATLHGDVCIAPSVTFLATANCARYVGAEVAFADVDPDSGLMTPETLAEALRRVGDRRVKAVLPVHLRGDICDLPGLKALADGVGAVLVEDAPHALGSVATFDGAAHPVGRARSLRGHGMVRPAGAAPWVYEMPELGFNYRIPDVLCALGISQLSKLDRFVARRRTLAALYADKLVPLAPHVTLATSPAWSDPALHLLTVLIDFEALGTTRLAVVEALKAQGVGSQVHYIPVHTQPYYQARYGALDLPGSDAWYARCLTLPLYPTMADGDVERVVGALAGVIGR

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221583 Caulobacter sp. Root655 Isolate Unclassified
9 2643221584 Caulobacter sp. Root656 Isolate Unclassified
10 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
11 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
12 2643221640 Caulobacter sp. Root342 Isolate Unclassified
13 2643221642 Caulobacter sp. Root343 Isolate Unclassified
14 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
15 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
16 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
17 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
18 2818991435 Caulobacter henricii 536 Isolate Unclassified
19 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
20 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
21 2849560528 Caulobacter zeae 410 Isolate Unclassified
22 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
23 2851153111 Caulobacter radicis 736 Isolate Unclassified
24 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
25 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
26 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
27 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
28 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
29 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
30 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
68 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
111 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
112 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
119 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
120 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
123 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
124 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
125 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
126 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
131 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
132 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
135 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
136 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
147 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
154 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
155 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
156 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
157 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
158 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
159 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
160 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
161 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
162 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
163 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
164 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
165 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
166 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
167 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
168 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
169 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.93
Metatranscriptomes 0
Isolates 11.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.31
Nodule 0
Rhizoplane 3.69
Rhizosphere 60.66
Stem 0
Stem Tuber 0
Unclassified 14.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055537_1001125 3300003773 Bacteria 11521
2 Ga0055536_1000922 3300003781 Bacteria 18976
3 Ga0055536_1001003 3300003781 Bacteria 17938
4 Ga0055528_1013966 3300003790 Bacteria 3006
5 Ga0055530_10000987 3300003791 Bacteria 22808
6 Ga0055530_10001846 3300003791 Bacteria 14564
7 Ga0055530_10010208 3300003791 Bacteria 3500
8 Ga0055531_10000820 3300003794 Bacteria 25755
9 Ga0055531_10002442 3300003794 Bacteria 12439
10 Ga0055531_10006941 3300003794 Bacteria 6307
11 Ga0065165_1000583 3300005262 Bacteria 53842
12 Ga0065165_1001140 3300005262 Bacteria 31153
13 Ga0065165_1020743 3300005262 Bacteria 2302
14 Ga0070658_10057033 3300005327 Bacteria 3176
15 Ga0070670_100039847 3300005331 Bacteria 4040
16 Ga0070670_100103590 3300005331 Bacteria 2451
17 Ga0068869_100041862 3300005334 Bacteria 3281
18 Ga0070680_100044905 3300005336 Bacteria 3591
19 Ga0070660_100025454 3300005339 Bacteria 4398
20 Ga0070668_100014331 3300005347 Bacteria 5924
21 Ga0070669_100129997 3300005353 Bacteria 1931
22 Ga0070671_100035261 3300005355 Bacteria 4144
23 Ga0070659_100000364 3300005366 Bacteria 34480
24 Ga0070659_100036584 3300005366 Bacteria 3827
25 Ga0070667_100016200 3300005367 Bacteria 6167
26 Ga0070681_10018926 3300005458 Bacteria 6891
27 Ga0070665_100000455 3300005548 Bacteria 59653
28 Ga0070665_100062187 3300005548 Bacteria 3744
29 Ga0068859_100039306 3300005617 Bacteria 4745
30 Ga0068864_100127634 3300005618 Bacteria 2280
31 Ga0068864_100148297 3300005618 Bacteria 2123
32 Ga0068861_100144210 3300005719 Bacteria 1947
33 Ga0068863_100060962 3300005841 Bacteria 3567
34 Ga0068860_100003199 3300005843 Bacteria 16907
35 Ga0068860_100015840 3300005843 Bacteria 7360
36 Ga0068862_100045290 3300005844 Bacteria 3753
37 Ga0068862_100051687 3300005844 Bacteria 3515
38 Ga0075369_10016301 3300006186 Bacteria 2996
39 Ga0075370_10133447 3300006353 Bacteria 1449
40 Ga0068865_100000097 3300006881 Bacteria 45492
41 Ga0097620_100039309 3300006931 Bacteria 4745
42 Ga0105240_10003020 3300009093 Bacteria 26469
43 Ga0105240_10011820 3300009093 Bacteria 12123
44 Ga0105240_10012645 3300009093 Bacteria 11637
45 Ga0105245_10191208 3300009098 Bacteria 1960
46 Ga0105248_10022216 3300009177 Bacteria 7034
47 Ga0105238_10059347 3300009551 Bacteria 3832
48 Ga0105238_10168124 3300009551 Bacteria 2169
49 Ga0105249_10046495 3300009553 Bacteria 3950
50 Ga0157370_10141742 3300013104 Bacteria 2239
51 Ga0157374_10182528 3300013296 Bacteria 2050
52 Ga0163162_10037196 3300013306 Bacteria 4855
53 Ga0163163_10052514 3300014325 Bacteria 4021
54 Ga0163163_10291468 3300014325 Bacteria 1684
55 Ga0213876_10000772 3300021384 Bacteria 21985
56 Ga0213875_10065128 3300021388 Bacteria 1703
57 Ga0209026_1004799 3300025250 Bacteria 3862
58 Ga0209565_1000505 3300025263 Bacteria 28359
59 Ga0209676_1000319 3300025292 Bacteria 93542
60 Ga0209676_1000401 3300025292 Bacteria 78968
61 Ga0209564_1009226 3300025295 Bacteria 4730
62 Ga0209758_1001446 3300025297 Bacteria 27968
63 Ga0209758_1003628 3300025297 Bacteria 13801
64 Ga0209758_1003766 3300025297 Bacteria 13400
65 Ga0209050_1000053 3300025298 Bacteria 349521
66 Ga0209050_1000584 3300025298 Bacteria 59071
67 Ga0209050_1001426 3300025298 Bacteria 25794
68 Ga0209256_1001196 3300025299 Bacteria 29062
69 Ga0209256_1010762 3300025299 Bacteria 3772
70 Ga0209051_1001183 3300025303 Bacteria 23584
71 Ga0209257_1000247 3300025304 Bacteria 125419
72 Ga0209257_1000705 3300025304 Bacteria 51728
73 Ga0209257_1001595 3300025304 Bacteria 25963
74 Ga0209257_1001993 3300025304 Bacteria 21934
75 Ga0207680_10092629 3300025903 Bacteria 1926
76 Ga0207705_10024051 3300025909 Bacteria 4346
77 Ga0207695_10000269 3300025913 Bacteria 130183
78 Ga0207695_10002803 3300025913 Bacteria 25351
79 Ga0207695_10038989 3300025913 Bacteria 5109
80 Ga0207695_10045699 3300025913 Bacteria 4647
81 Ga0207660_10011632 3300025917 Bacteria 5738
82 Ga0207657_10013587 3300025919 Bacteria 7985
83 Ga0207657_10035561 3300025919 Bacteria 4465
84 Ga0207694_10020522 3300025924 Bacteria 5000
85 Ga0207694_10110605 3300025924 Bacteria 2185
86 Ga0207650_10025349 3300025925 Bacteria 4224
87 Ga0207644_10019017 3300025931 Bacteria 4657
88 Ga0207644_10045595 3300025931 Bacteria 3119
89 Ga0207644_10257457 3300025931 Bacteria 1394
90 Ga0207690_10000031 3300025932 Bacteria 154724
91 Ga0207706_10044051 3300025933 Bacteria 3955
92 Ga0207704_10002266 3300025938 Bacteria 8642
93 Ga0207711_10001545 3300025941 Bacteria 21298
94 Ga0207711_10203393 3300025941 Bacteria 1808
95 Ga0207679_10070022 3300025945 Bacteria 2642
96 Ga0207658_10034473 3300025986 Bacteria 3618
97 Ga0207675_100027608 3300026118 Bacteria 5287
98 Ga0209981_1001286 3300027378 Bacteria 3186
99 Ga0268266_10000003 3300028379 Bacteria 1701703
100 Ga0268266_10021460 3300028379 Bacteria 5501
101 Ga0268265_10001167 3300028380 Bacteria 23017
102 Ga0268265_10007484 3300028380 Bacteria 7373
103 Ga0268265_10153657 3300028380 Bacteria 1944
104 Ga0268265_10182708 3300028380 Bacteria 1803
105 Ga0268264_10000091 3300028381 Bacteria 233338
106 Ga0307517_10003229 3300028786 Bacteria 25559
107 Ga0307515_10038723 3300028794 Bacteria 7614
108 Ga0307515_10094378 3300028794 Bacteria 3696
109 Ga0307515_10116493 3300028794 Bacteria 3067
110 Ga0307511_10002678 3300030521 Bacteria 18563
111 Ga0265327_10000331 3300031251 Bacteria 89636
112 Ga0307513_10000100 3300031456 Bacteria 125183
113 Ga0307513_10003819 3300031456 Bacteria 20311
114 Ga0307513_10004517 3300031456 Bacteria 18553
115 Ga0307516_10001321 3300031730 Bacteria 34374
116 Ga0373943_0019415 3300035170 Bacteria 3126
117 Ga0373946_0040668 3300035171 Bacteria 1903
118 Ga0373925_0000653 3300037068 Bacteria 32591
119 Ga0395900_0000002 3300037418 Bacteria 671103
120 Ga0395898_0061696 3300037466 Bacteria 3642
121 Ga0395905_0031316 3300037471 Bacteria 5007
122 Ga0395905_0177893 3300037471 Bacteria 1997
123 Ga0436364_0612592 3300037853 Bacteria 4044
124 Ga0395901_0000013 3300038443 Bacteria 375733
125 Ga0436365_0126277 3300039437 Bacteria 68453
126 Ga0439435_0001209 3300042436 Bacteria 4665
127 Ga0495627_000513 3300046453 Bacteria 32122
128 Ga0495590_0000309 3300046457 Bacteria 25577
129 Ga0495638_0000230 3300046460 Bacteria 76565
130 Ga0495638_0000782 3300046460 Bacteria 33588
131 Ga0495638_0002728 3300046460 Bacteria 14196
132 Ga0495638_0006940 3300046460 Bacteria 8172
133 Ga0495638_0009872 3300046460 Bacteria 6663
134 Ga0495638_0094214 3300046460 Bacteria 1800
135 Ga0495650_0000207 3300046471 Bacteria 127568
136 Ga0495650_0055225 3300046471 Bacteria 1617
137 Ga0495585_0017763 3300046492 Bacteria 4107
138 Ga0495583_0000399 3300046506 Bacteria 66020
139 Ga0495606_0029548 3300046507 Bacteria 3844
140 Ga0495610_0001275 3300046512 Bacteria 22573
141 Ga0495610_0003520 3300046512 Bacteria 12142
142 Ga0495610_0017428 3300046512 Bacteria 4094
143 Ga0495616_0001022 3300046513 Bacteria 20016
144 Ga0495620_0026635 3300046515 Bacteria 2716
145 Ga0495628_0043982 3300046516 Bacteria 3555
146 Ga0495632_0004626 3300046519 Bacteria 9316
147 Ga0495632_0021398 3300046519 Bacteria 3486
148 Ga0495632_0037244 3300046519 Bacteria 2469
149 Ga0495637_0017031 3300046520 Bacteria 3393
150 Ga0495648_0001057 3300046524 Bacteria 27927
151 Ga0495648_0076366 3300046524 Bacteria 1924
152 Ga0495648_0119941 3300046524 Bacteria 1416
153 Ga0495642_0004842 3300046528 Bacteria 5203
154 Ga0495642_0063252 3300046528 Bacteria 1538
155 Ga0495654_0000016 3300046530 Bacteria 306416
156 Ga0495645_0021738 3300046543 Bacteria 4638
157 Ga0495668_0000221 3300046616 Bacteria 82680
158 Ga0495668_0007614 3300046616 Bacteria 6901
159 Ga0495668_0029263 3300046616 Bacteria 3113
160 Ga0495625_0002766 3300046660 Bacteria 18524
161 Ga0495625_0005971 3300046660 Bacteria 10945
162 Ga0495625_0009865 3300046660 Bacteria 7942
163 Ga0495625_0024694 3300046660 Bacteria 4569
164 Ga0495625_0071686 3300046660 Bacteria 2431
165 Ga0495669_0000006 3300046684 Bacteria 190838
166 Ga0495669_0000277 3300046684 Bacteria 29304
167 Ga0495669_0009737 3300046684 Bacteria 4057
168 Ga0495669_0077186 3300046684 Bacteria 1525
169 Ga0495671_0034846 3300046692 Bacteria 2558
170 Ga0495660_0004627 3300046810 Bacteria 8298
171 Ga0495672_0013421 3300047320 Bacteria 5653
172 Ga0495677_0007253 3300047445 Bacteria 4147
173 Ga0495677_0045848 3300047445 Bacteria 1604
174 Ga0495679_041384 3300047446 Bacteria 1427
175 Ga0495673_0000223 3300047469 Bacteria 84150
176 Ga0495673_0000289 3300047469 Bacteria 67437
177 Ga0495673_0006148 3300047469 Bacteria 7111
178 Ga0495686_0001197 3300047472 Bacteria 29986
179 Ga0495686_0009790 3300047472 Bacteria 6878
180 Ga0496106_0092899 3300048909 Bacteria 2331
181 Ga0496108_0020443 3300048911 Bacteria 5443
182 Ga0496109_0021876 3300048912 Bacteria 5660
183 Ga0496110_0116937 3300048913 Bacteria 2401
184 Ga0496112_0082415 3300048915 Bacteria 3181
185 Ga0496113_0078185 3300048916 Bacteria 2531
186 Ga0496115_0003076 3300048918 Bacteria 11983
187 Ga0496115_0188062 3300048918 Bacteria 1706
188 Ga0496115_0209027 3300048918 Bacteria 1612
189 Ga0496121_0242196 3300048924 Bacteria 1256
190 Ga0496124_0024093 3300048927 Bacteria 5541
191 Ga0496125_0018047 3300048928 Bacteria 6707
192 Ga0496126_0156996 3300048929 Bacteria 1946
193 Ga0495678_000773 3300049459 Bacteria 28865
194 Ga0501033_0018835 3300049570 Bacteria 5220
195 Ga0501047_0006476 3300049581 Bacteria 11017
196 Ga0501047_0058066 3300049581 Bacteria 3739
197 Ga0501044_0144686 3300049823 Bacteria 2364
198 nmdc:mga07m45_65959_c1 3300050496 Bacteria 2056
199 nmdc:mga0sz30_2664_c1 3300050516 Bacteria 6365
200 Ga0500578_0001117 3300053086 Bacteria 28820
201 Ga0500643_019620 3300053087 Bacteria 2222
202 Ga0500644_0000074 3300053088 Bacteria 60285
203 Ga0500644_0011118 3300053088 Bacteria 2453
204 Ga0500641_0026121 3300053096 Bacteria 2265
205 Ga0500556_0000954 3300053104 Bacteria 15555
206 Ga0500562_000715 3300053108 Bacteria 8067
207 Ga0500594_0000093 3300053118 Bacteria 27296
208 Ga0500595_054173 3300053119 Bacteria 1232
209 Ga0500608_000188 3300053122 Bacteria 24796
210 Ga0500618_000152 3300053125 Bacteria 57055
211 Ga0500658_0005461 3300053134 Bacteria 4728
212 Ga0500559_0000054 3300053136 Bacteria 90695
213 Ga0500559_0002850 3300053136 Bacteria 8735
214 Ga0500564_000094 3300053138 Bacteria 22644
215 Ga0500577_0001695 3300053142 Bacteria 5632
216 Ga0500645_017142 3300053730 Bacteria 2273
217 Ga0500645_022181 3300053730 Bacteria 1955

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048924 Ga0496121_0242196 Ga0496121_0242196_252_1232 321
2 3300028794 Ga0307515_10038723 Ga0307515_100387236 343
3 3300046513 Ga0495616_0001022 Ga0495616_0001022_5516_6700 355
4 3300046520 Ga0495637_0017031 Ga0495637_0017031_1210_2379 361
5 3300046460 Ga0495638_0009872 Ga0495638_0009872_4163_5341 362
6 3300042436 Ga0439435_0001209 Ga0439435_0001209_3322_4488 366
7 3300046460 Ga0495638_0006940 Ga0495638_0006940_5354_6538 366
8 3300046519 Ga0495632_0004626 Ga0495632_0004626_3997_5163 366
9 3300046519 Ga0495632_0021398 Ga0495632_0021398_1591_2760 367
10 3300053142 Ga0500577_0001695 Ga0500577_0001695_280_1446 367
11 3300005334 Ga0068869_100041862 Ga0068869_1000418622 370
12 3300003794 Ga0055531_10002442 Ga0055531_100024422 371
13 3300025304 Ga0209257_1000247 Ga0209257_1000247101 371
14 3300053086 Ga0500578_0001117 Ga0500578_0001117_8653_9819 371
15 3300005262 Ga0065165_1020743 Ga0065165_10207432 372
16 3300047469 Ga0495673_0006148 Ga0495673_0006148_3793_4965 372
17 3300046519 Ga0495632_0037244 Ga0495632_0037244_275_1459 373
18 3300046660 Ga0495625_0009865 Ga0495625_0009865_2802_3971 373
19 3300046692 Ga0495671_0034846 Ga0495671_0034846_751_1917 373
20 3300046460 Ga0495638_0002728 Ga0495638_0002728_10180_11349 374
21 3300046471 Ga0495650_0000207 Ga0495650_0000207_111470_112639 374
22 3300046512 Ga0495610_0001275 Ga0495610_0001275_18554_19723 374
23 3300046515 Ga0495620_0026635 Ga0495620_0026635_108_1274 374
24 3300046524 Ga0495648_0119941 Ga0495648_0119941_39_1205 374
25 3300046530 Ga0495654_0000016 Ga0495654_0000016_195515_196681 374
26 3300046660 Ga0495625_0071686 Ga0495625_0071686_1197_2366 374
27 3300047320 Ga0495672_0013421 Ga0495672_0013421_4133_5302 374
28 3300047472 Ga0495686_0009790 Ga0495686_0009790_132_1307 374
29 3300053134 Ga0500658_0005461 Ga0500658_0005461_3476_4645 374
30 3300053730 Ga0500645_022181 Ga0500645_022181_401_1570 374
31 3300009093 Ga0105240_10003020 Ga0105240_1000302022 376
32 3300009551 Ga0105238_10059347 Ga0105238_100593476 376
33 3300025913 Ga0207695_10002803 Ga0207695_1000280322 376
34 3300028794 Ga0307515_10116493 Ga0307515_101164932 376
35 3300046457 Ga0495590_0000309 Ga0495590_0000309_5237_6403 376
36 3300046512 Ga0495610_0003520 Ga0495610_0003520_5110_6273 376
37 3300047472 Ga0495686_0001197 Ga0495686_0001197_9089_10255 376
38 3300053088 Ga0500644_0011118 Ga0500644_0011118_597_1763 376
39 3300053108 Ga0500562_000715 Ga0500562_000715_2672_3838 376
40 3300028794 Ga0307515_10094378 Ga0307515_100943783 377
41 3300046616 Ga0495668_0007614 Ga0495668_0007614_3121_4302 377
42 3300046660 Ga0495625_0002766 Ga0495625_0002766_2805_3974 377
43 3300047446 Ga0495679_041384 Ga0495679_041384_21_1190 377
44 3300049459 Ga0495678_000773 Ga0495678_000773_18907_20073 377
45 3300053118 Ga0500594_0000093 Ga0500594_0000093_14754_15920 377
46 3300053125 Ga0500618_000152 Ga0500618_000152_43611_44780 377
47 3300046453 Ga0495627_000513 Ga0495627_000513_11060_12229 378
48 3300046460 Ga0495638_0000782 Ga0495638_0000782_20262_21443 378
49 3300046507 Ga0495606_0029548 Ga0495606_0029548_1968_3137 378
50 3300046660 Ga0495625_0005971 Ga0495625_0005971_3839_5008 378
51 3300047469 Ga0495673_0000223 Ga0495673_0000223_55976_57148 378
52 3300053136 Ga0500559_0000054 Ga0500559_0000054_61379_62545 378
53 3300053136 Ga0500559_0002850 Ga0500559_0002850_6525_7691 378
54 3300025304 Ga0209257_1001993 Ga0209257_10019933 379
55 iso_pu_bacteria 2643221614 2644087733 379
56 iso_pu_bacteria 2643221661 2644344224 379
57 iso_pu_bacteria 2643221666 2644367091 379
58 iso_pu_bacteria 2857504554 2857508419 381
59 iso_pu_bacteria 2928531327 2928534558 381
60 3300046512 Ga0495610_0017428 Ga0495610_0017428_524_1717 382
61 iso_pu_bacteria 2582581279 2585148269 382
62 iso_pu_bacteria 2585428106 2587919177 382
63 iso_pu_bacteria 2643221598 2644001036 382
64 iso_pu_bacteria 2643221640 2644227416 382
65 iso_pu_bacteria 2643221642 2644237065 382
66 iso_pu_bacteria 2791355048 2792461271 382
67 iso_pu_bacteria 2843744320 2843745341 382
68 iso_pu_bacteria 2849560528 2849564619 382
69 iso_pu_bacteria 2849573788 2849577727 382
70 iso_pu_bacteria 2851153111 2851155646 382
71 iso_pu_bacteria 2898329390 2898331053 382
72 3300003791 Ga0055530_10000987 Ga0055530_100009878 383
73 3300003794 Ga0055531_10006941 Ga0055531_100069416 383
74 3300005262 Ga0065165_1000583 Ga0065165_100058336 383
75 3300009093 Ga0105240_10011820 Ga0105240_100118205 383
76 3300025297 Ga0209758_1003766 Ga0209758_100376610 383
77 3300025298 Ga0209050_1000053 Ga0209050_100005320 383
78 3300025299 Ga0209256_1001196 Ga0209256_100119621 383
79 3300025304 Ga0209257_1000705 Ga0209257_100070528 383
80 3300025913 Ga0207695_10038989 Ga0207695_100389895 383
81 3300049570 Ga0501033_0018835 Ga0501033_0018835_3216_4367 383
82 3300046492 Ga0495585_0017763 Ga0495585_0017763_1389_2546 384
83 3300049581 Ga0501047_0006476 Ga0501047_0006476_5475_6629 384
84 3300053096 Ga0500641_0026121 Ga0500641_0026121_410_1564 384
85 iso_pu_bacteria 2582581293 2585196381 384
86 3300003781 Ga0055536_1000922 Ga0055536_10009227 385
87 3300003781 Ga0055536_1001003 Ga0055536_10010036 385
88 3300003791 Ga0055530_10001846 Ga0055530_1000184612 385
89 3300003791 Ga0055530_10010208 Ga0055530_100102084 385
90 3300003794 Ga0055531_10000820 Ga0055531_100008206 385
91 3300005331 Ga0070670_100039847 Ga0070670_1000398472 385
92 3300005355 Ga0070671_100035261 Ga0070671_1000352615 385
93 3300005548 Ga0070665_100062187 Ga0070665_1000621874 385
94 3300005618 Ga0068864_100127634 Ga0068864_1001276342 385
95 3300006186 Ga0075369_10016301 Ga0075369_100163012 385
96 3300006353 Ga0075370_10133447 Ga0075370_101334472 385
97 3300013296 Ga0157374_10182528 Ga0157374_101825282 385
98 3300013306 Ga0163162_10037196 Ga0163162_100371964 385
99 3300025292 Ga0209676_1000319 Ga0209676_100031916 385
100 3300025292 Ga0209676_1000401 Ga0209676_100040167 385
101 3300025298 Ga0209050_1000584 Ga0209050_10005847 385
102 3300025298 Ga0209050_1001426 Ga0209050_100142624 385
103 3300025303 Ga0209051_1001183 Ga0209051_100118323 385
104 3300025304 Ga0209257_1001595 Ga0209257_10015956 385
105 3300025903 Ga0207680_10092629 Ga0207680_100926292 385
106 3300025924 Ga0207694_10020522 Ga0207694_100205227 385
107 3300025931 Ga0207644_10019017 Ga0207644_100190172 385
108 3300025931 Ga0207644_10045595 Ga0207644_100455952 385
109 3300025931 Ga0207644_10257457 Ga0207644_102574571 385
110 3300025933 Ga0207706_10044051 Ga0207706_100440513 385
111 3300025941 Ga0207711_10203393 Ga0207711_102033932 385
112 3300025945 Ga0207679_10070022 Ga0207679_100700222 385
113 3300028379 Ga0268266_10021460 Ga0268266_100214602 385
114 3300031456 Ga0307513_10003819 Ga0307513_1000381916 385
115 3300046524 Ga0495648_0001057 Ga0495648_0001057_1682_2839 385
116 3300046528 Ga0495642_0004842 Ga0495642_0004842_2226_3383 385
117 3300046528 Ga0495642_0063252 Ga0495642_0063252_37_1194 385
118 3300046616 Ga0495668_0000221 Ga0495668_0000221_60841_61998 385
119 3300046616 Ga0495668_0029263 Ga0495668_0029263_1656_2813 385
120 3300046660 Ga0495625_0024694 Ga0495625_0024694_3089_4246 385
121 3300046684 Ga0495669_0009737 Ga0495669_0009737_1449_2606 385
122 3300046684 Ga0495669_0077186 Ga0495669_0077186_322_1479 385
123 3300047445 Ga0495677_0045848 Ga0495677_0045848_258_1415 385
124 3300047469 Ga0495673_0000289 Ga0495673_0000289_4106_5263 385
125 3300048909 Ga0496106_0092899 Ga0496106_0092899_882_2039 385
126 3300048911 Ga0496108_0020443 Ga0496108_0020443_1233_2390 385
127 3300048912 Ga0496109_0021876 Ga0496109_0021876_90_1247 385
128 3300048913 Ga0496110_0116937 Ga0496110_0116937_204_1361 385
129 3300048915 Ga0496112_0082415 Ga0496112_0082415_1460_2617 385
130 3300048916 Ga0496113_0078185 Ga0496113_0078185_1286_2443 385
131 3300048927 Ga0496124_0024093 Ga0496124_0024093_3400_4557 385
132 3300050496 nmdc:mga07m45_65959_c1 nmdc:mga07m45_65959_c1_843_2000 385
133 3300050516 nmdc:mga0sz30_2664_c1 nmdc:mga0sz30_2664_c1_1528_2685 385
134 3300053088 Ga0500644_0000074 Ga0500644_0000074_4026_5183 385
135 3300053122 Ga0500608_000188 Ga0500608_000188_12094_13251 385
136 3300053138 Ga0500564_000094 Ga0500564_000094_8878_10035 385
137 iso_pu_bacteria 2510917020 2511121907 385
138 iso_pu_bacteria 2582581280 2585150958 385
139 iso_pu_bacteria 2643221583 2643926972 385
140 iso_pu_bacteria 2818991435 2819538105 385
141 iso_pu_bacteria 2818991454 2819647325 385
142 3300028380 Ga0268265_10153657 Ga0268265_101536572 386
143 3300028786 Ga0307517_10003229 Ga0307517_100032294 386
144 3300031251 Ga0265327_10000331 Ga0265327_1000033111 386
145 3300031456 Ga0307513_10004517 Ga0307513_1000451711 386
146 3300046460 Ga0495638_0094214 Ga0495638_0094214_268_1428 386
147 3300046524 Ga0495648_0076366 Ga0495648_0076366_141_1316 386
148 3300048928 Ga0496125_0018047 Ga0496125_0018047_815_1975 386
149 3300048929 Ga0496126_0156996 Ga0496126_0156996_63_1223 386
150 iso_pu_bacteria 2884960567 2884961221 386
151 3300005327 Ga0070658_10057033 Ga0070658_100570331 387
152 3300005331 Ga0070670_100103590 Ga0070670_1001035903 387
153 3300005336 Ga0070680_100044905 Ga0070680_1000449052 387
154 3300005339 Ga0070660_100025454 Ga0070660_1000254543 387
155 3300005347 Ga0070668_100014331 Ga0070668_1000143312 387
156 3300005353 Ga0070669_100129997 Ga0070669_1001299972 387
157 3300005366 Ga0070659_100000364 Ga0070659_10000036422 387
158 3300005366 Ga0070659_100036584 Ga0070659_1000365844 387
159 3300005367 Ga0070667_100016200 Ga0070667_1000162003 387
160 3300005458 Ga0070681_10018926 Ga0070681_100189265 387
161 3300005548 Ga0070665_100000455 Ga0070665_10000045522 387
162 3300005617 Ga0068859_100039306 Ga0068859_1000393062 387
163 3300005618 Ga0068864_100148297 Ga0068864_1001482972 387
164 3300005719 Ga0068861_100144210 Ga0068861_1001442102 387
165 3300005841 Ga0068863_100060962 Ga0068863_1000609622 387
166 3300005843 Ga0068860_100003199 Ga0068860_1000031997 387
167 3300005843 Ga0068860_100015840 Ga0068860_1000158406 387
168 3300005844 Ga0068862_100045290 Ga0068862_1000452904 387
169 3300005844 Ga0068862_100051687 Ga0068862_1000516873 387
170 3300006881 Ga0068865_100000097 Ga0068865_10000009732 387
171 3300006931 Ga0097620_100039309 Ga0097620_1000393094 387
172 3300009093 Ga0105240_10012645 Ga0105240_1001264513 387
173 3300009098 Ga0105245_10191208 Ga0105245_101912082 387
174 3300009177 Ga0105248_10022216 Ga0105248_100222169 387
175 3300009551 Ga0105238_10168124 Ga0105238_101681242 387
176 3300009553 Ga0105249_10046495 Ga0105249_100464952 387
177 3300013104 Ga0157370_10141742 Ga0157370_101417422 387
178 3300014325 Ga0163163_10052514 Ga0163163_100525142 387
179 3300014325 Ga0163163_10291468 Ga0163163_102914682 387
180 3300025250 Ga0209026_1004799 Ga0209026_10047993 387
181 3300025297 Ga0209758_1001446 Ga0209758_100144632 387
182 3300025299 Ga0209256_1010762 Ga0209256_10107623 387
183 3300025909 Ga0207705_10024051 Ga0207705_100240512 387
184 3300025913 Ga0207695_10000269 Ga0207695_1000026933 387
185 3300025913 Ga0207695_10045699 Ga0207695_100456993 387
186 3300025917 Ga0207660_10011632 Ga0207660_100116326 387
187 3300025919 Ga0207657_10013587 Ga0207657_100135874 387
188 3300025919 Ga0207657_10035561 Ga0207657_100355613 387
189 3300025924 Ga0207694_10110605 Ga0207694_101106052 387
190 3300025925 Ga0207650_10025349 Ga0207650_100253496 387
191 3300025932 Ga0207690_10000031 Ga0207690_1000003146 387
192 3300025938 Ga0207704_10002266 Ga0207704_1000226610 387
193 3300025941 Ga0207711_10001545 Ga0207711_1000154520 387
194 3300025986 Ga0207658_10034473 Ga0207658_100344732 387
195 3300026118 Ga0207675_100027608 Ga0207675_1000276082 387
196 3300027378 Ga0209981_1001286 Ga0209981_10012862 387
197 3300028379 Ga0268266_10000003 Ga0268266_100000031505 387
198 3300028380 Ga0268265_10001167 Ga0268265_100011673 387
199 3300028380 Ga0268265_10007484 Ga0268265_100074847 387
200 3300028380 Ga0268265_10182708 Ga0268265_101827082 387
201 3300028381 Ga0268264_10000091 Ga0268264_1000009134 387
202 3300030521 Ga0307511_10002678 Ga0307511_1000267814 387
203 3300031456 Ga0307513_10000100 Ga0307513_1000010029 387
204 3300031730 Ga0307516_10001321 Ga0307516_1000132119 387
205 3300037418 Ga0395900_0000002 Ga0395900_0000002_375686_376849 387
206 3300037466 Ga0395898_0061696 Ga0395898_0061696_221_1384 387
207 3300037471 Ga0395905_0031316 Ga0395905_0031316_3609_4772 387
208 3300037471 Ga0395905_0177893 Ga0395905_0177893_418_1581 387
209 3300038443 Ga0395901_0000013 Ga0395901_0000013_326936_328099 387
210 3300046471 Ga0495650_0055225 Ga0495650_0055225_166_1329 387
211 3300046684 Ga0495669_0000006 Ga0495669_0000006_102720_103883 387
212 3300046684 Ga0495669_0000277 Ga0495669_0000277_18632_19807 387
213 3300046810 Ga0495660_0004627 Ga0495660_0004627_163_1332 387
214 3300047445 Ga0495677_0007253 Ga0495677_0007253_2929_4092 387
215 3300048918 Ga0496115_0003076 Ga0496115_0003076_1618_2781 387
216 3300048918 Ga0496115_0209027 Ga0496115_0209027_239_1402 387
217 3300053119 Ga0500595_054173 Ga0500595_054173_46_1209 387
218 iso_pu_bacteria 2643221552 2643780496 387
219 iso_pu_bacteria 2643221584 2643932134 387
220 3300005262 Ga0065165_1001140 Ga0065165_100114013 388
221 3300021384 Ga0213876_10000772 Ga0213876_100007725 388
222 3300021388 Ga0213875_10065128 Ga0213875_100651282 388
223 3300025295 Ga0209564_1009226 Ga0209564_10092263 388
224 3300035170 Ga0373943_0019415 Ga0373943_0019415_1939_3111 388
225 3300035171 Ga0373946_0040668 Ga0373946_0040668_535_1707 388
226 3300037068 Ga0373925_0000653 Ga0373925_0000653_27551_28723 388
227 3300037853 Ga0436364_0612592 Ga0436364_0612592_1717_2886 388
228 3300039437 Ga0436365_0126277 Ga0436365_0126277_54263_55432 388
229 3300046516 Ga0495628_0043982 Ga0495628_0043982_2295_3473 388
230 3300046543 Ga0495645_0021738 Ga0495645_0021738_1863_3041 388
231 3300049581 Ga0501047_0058066 Ga0501047_0058066_792_1961 388
232 3300049823 Ga0501044_0144686 Ga0501044_0144686_796_1965 388
233 3300053087 Ga0500643_019620 Ga0500643_019620_320_1489 388
234 3300053104 Ga0500556_0000954 Ga0500556_0000954_1616_2803 388
235 3300053730 Ga0500645_017142 Ga0500645_017142_667_1854 388
236 iso_pu_bacteria 2643221545 2643750349 388
237 iso_pu_bacteria 2643221691 2644507238 388
238 3300003773 Ga0055537_1001125 Ga0055537_10011259 393
239 3300003790 Ga0055528_1013966 Ga0055528_10139664 393
240 3300025263 Ga0209565_1000505 Ga0209565_10005059 393
241 3300025297 Ga0209758_1003628 Ga0209758_100362815 393
242 3300046460 Ga0495638_0000230 Ga0495638_0000230_18586_19779 393
243 3300046506 Ga0495583_0000399 Ga0495583_0000399_8890_10077 393
244 3300048918 Ga0496115_0188062 Ga0496115_0188062_181_1368 393

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

159

339

0.93

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

13

172

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dr4-assembly1.cif.gz_A gdp-perosamine synthase k186a mutant from caulobacter crescentus with bound sugar ligand 0.9561 10 389
8snj-assembly1.cif.gz_A crystal structure of arnb transferase from klebsiella aerogenes (lattice translocation disorder, p1 form) 0.9544 6 389
8su6-assembly1.cif.gz_B crystal structure of arnb transferase from klebsiella aerogenes (lattice translocation disorder, p1 form2) 0.9518 6 389
1mdx-assembly1.cif.gz_A crystal structure of arnb transferase with pyridoxal 5' phosphate 0.9515 6 389
1mdo-assembly1.cif.gz_A crystal structure of arnb aminotransferase with pyridomine 5' phosphate 0.9503 6 391
ID Description Score Start End Superfamily
1mdxA01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9366 6 265 3.40.640.10
1mdxA01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9291 6 265 3.40.640.10
3bn1A02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9284 267 389 3.90.1150.10
4lc3B01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9225 5 264 3.40.640.10
af_Q58466_2_255_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9205 6 265 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A522D633-F1-model_v4 UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase (EC 2.6.1.92) 0.9903 6 393 GO:0000271
GO:0008483
GO:0030170
AF-A0A522D633-F1-model_v4 UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase (EC 2.6.1.92) 0.9878 6 393 GO:0000271
GO:0008483
GO:0030170
AF-A0A2D8LZ36-F1-model_v4 UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase 0.9801 6 391 GO:0000271
GO:0008483
GO:0030170
AF-A0A2D8LZ36-F1-model_v4 UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase 0.975 6 391 GO:0000271
GO:0008483
GO:0030170
AF-A0A258AQM4-F1-model_v4 UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase 0.966 248 393 GO:0000271
GO:0008483
GO:0030170

Feature Viewer

pLDDT pTM Quality
92.78 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map