F356622

General Info

Members Datasets Scaffolds Average Seq Length
244 164 488 221

Family's Representative Sequence

Representative Sequence 3300028577|Ga0265318_10010395|Ga0265318_100103952
Length 251
Sequence MASQTKMNVVTNVNGPKDVNKLDMNDKRDRAEVRAAVELVGLVPVVRAPSAALAVRAVDALLAGGVSVFEITMTVPGAVGVIEQLVSRFGDRVVVGAGTVLSVADARACIRAGASFIVSPGLDLAVVDEVKSHGVCVMPGALTPTEVIAAWKAGADLVKIFPCSALGGPRYLKALRGPLPDVRFLPTGGVTAATAGDYIAAGASALGVGSELVDIAALEAGQDAFVTARTRELVAAVEIARAALRSVRPRA

Samples

Sample ID Description Type Environment
1 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
93 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
94 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
97 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
98 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
99 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
100 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
103 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
109 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
110 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
111 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
114 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
115 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
118 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
119 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0
Rhizoplane 4.92
Rhizosphere 88.93
Stem 0
Stem Tuber 0
Unclassified 9.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265318_10010395 3300028577 Bacteria 4056
2 rootH2_10297567 3300003320 Bacteria 1569
3 rootH1_10107783 3300003323 Bacteria 1740
4 Ga0070676_10014289 3300005328 Bacteria 4362
5 Ga0070683_100000861 3300005329 Bacteria 22440
6 Ga0070690_100003396 3300005330 Bacteria 8701
7 Ga0070690_100019680 3300005330 Bacteria 4102
8 Ga0070680_100070702 3300005336 Bacteria 2866
9 Ga0070682_100281695 3300005337 Bacteria 1212
10 Ga0070682_100666749 3300005337 Bacteria 830
11 Ga0068868_100004918 3300005338 Bacteria 9385
12 Ga0068868_100362556 3300005338 Bacteria 1244
13 Ga0070687_100076531 3300005343 Bacteria 1813
14 Ga0070669_100035804 3300005353 Bacteria 3596
15 Ga0070675_100443084 3300005354 Bacteria 1164
16 Ga0070674_100004015 3300005356 Bacteria 8341
17 Ga0070674_101086398 3300005356 Bacteria 706
18 Ga0070673_100082962 3300005364 Bacteria 2603
19 Ga0070673_100313820 3300005364 Bacteria 1383
20 Ga0070688_100050515 3300005365 Bacteria 2591
21 Ga0070709_10078347 3300005434 Unclassified 2150
22 Ga0070713_100664963 3300005436 Bacteria 993
23 Ga0070710_10285688 3300005437 Bacteria 1072
24 Ga0070705_100924143 3300005440 Unclassified 703
25 Ga0070700_100020176 3300005441 Bacteria 3856
26 Ga0070694_100096661 3300005444 Bacteria 2082
27 Ga0068867_100208680 3300005459 Bacteria 1568
28 Ga0068867_101149172 3300005459 Unclassified 711
29 Ga0070698_100443639 3300005471 Unclassified 1233
30 Ga0070679_100001770 3300005530 Bacteria 19452
31 Ga0070684_100022682 3300005535 Bacteria 5239
32 Ga0070684_100266010 3300005535 Bacteria 1569
33 Ga0068853_100024372 3300005539 Bacteria 5072
34 Ga0070672_100065502 3300005543 Bacteria 2874
35 Ga0070672_100211583 3300005543 Bacteria 1624
36 Ga0070686_100041824 3300005544 Bacteria 2867
37 Ga0070695_100562614 3300005545 Bacteria 890
38 Ga0070696_100003850 3300005546 Bacteria 10021
39 Ga0070696_100549031 3300005546 Unclassified 925
40 Ga0068855_100001558 3300005563 Bacteria 28811
41 Ga0068856_100006228 3300005614 Bacteria 11707
42 Ga0068856_100016089 3300005614 Bacteria 7231
43 Ga0068856_100558640 3300005614 Bacteria 1166
44 Ga0070702_100031914 3300005615 Bacteria 2886
45 Ga0068852_100091307 3300005616 Bacteria 2725
46 Ga0068859_100195712 3300005617 Bacteria 2106
47 Ga0068864_100478272 3300005618 Bacteria 1195
48 Ga0068866_10360376 3300005718 Bacteria 927
49 Ga0068863_100258405 3300005841 Bacteria 1683
50 Ga0068858_100038471 3300005842 Bacteria 4437
51 Ga0068858_100192873 3300005842 Bacteria 1925
52 Ga0068862_100195092 3300005844 Bacteria 1824
53 Ga0070717_10075679 3300006028 Bacteria 2816
54 Ga0075370_10156783 3300006353 Unclassified 1335
55 Ga0075428_100113582 3300006844 Bacteria 2951
56 Ga0075428_100181328 3300006844 Bacteria 2279
57 Ga0075428_100238898 3300006844 Bacteria 1960
58 Ga0075433_10017545 3300006852 Bacteria 5933
59 Ga0075433_10373632 3300006852 Bacteria 1259
60 Ga0075434_100102103 3300006871 Bacteria 2875
61 Ga0075434_100720829 3300006871 Bacteria 1014
62 Ga0068865_100023990 3300006881 Bacteria 3999
63 Ga0075436_100023109 3300006914 Bacteria 4270
64 Ga0097620_100195726 3300006931 Bacteria 2106
65 Ga0099795_10008167 3300007788 Bacteria 2968
66 Ga0105240_10155852 3300009093 Bacteria 2716
67 Ga0105240_10272107 3300009093 Bacteria 1949
68 Ga0105240_11168936 3300009093 Unclassified 816
69 Ga0111539_10009583 3300009094 Bacteria 12222
70 Ga0111539_10045379 3300009094 Bacteria 5261
71 Ga0111539_10472387 3300009094 Bacteria 1460
72 Ga0114129_10003544 3300009147 Bacteria 21968
73 Ga0114129_10591267 3300009147 Bacteria 1439
74 Ga0105243_10198108 3300009148 Bacteria 1759
75 Ga0105249_10247556 3300009553 Bacteria 1765
76 Ga0099796_10015767 3300010159 Unclassified 2216
77 Ga0157378_11250461 3300013297 Bacteria 783
78 Ga0157377_10253168 3300014745 Bacteria 1142
79 Ga0157376_10355584 3300014969 Bacteria 1403
80 Ga0213876_10237654 3300021384 Bacteria 968
81 Ga0207692_10063488 3300025898 Bacteria 1920
82 Ga0207680_10050613 3300025903 Bacteria 2480
83 Ga0207647_10017522 3300025904 Unclassified 4868
84 Ga0207645_10002118 3300025907 Bacteria 15885
85 Ga0207684_10411806 3300025910 Bacteria 1162
86 Ga0207707_10358593 3300025912 Unclassified 1255
87 Ga0207660_10055688 3300025917 Bacteria 2827
88 Ga0207662_10027145 3300025918 Bacteria 3305
89 Ga0207652_10052187 3300025921 Bacteria 3508
90 Ga0207652_10485189 3300025921 Bacteria 1113
91 Ga0207681_10007574 3300025923 Bacteria 6651
92 Ga0207700_10403214 3300025928 Bacteria 1199
93 Ga0207690_10111968 3300025932 Bacteria 1968
94 Ga0207669_10008437 3300025937 Bacteria 4838
95 Ga0207704_10007641 3300025938 Bacteria 5120
96 Ga0207691_10072826 3300025940 Bacteria 3099
97 Ga0207691_10256606 3300025940 Bacteria 1508
98 Ga0207661_10002020 3300025944 Bacteria 13988
99 Ga0207667_10000567 3300025949 Bacteria 48248
100 Ga0207667_10012785 3300025949 Bacteria 9641
101 Ga0207667_10060780 3300025949 Bacteria 3955
102 Ga0207651_10043347 3300025960 Bacteria 3002
103 Ga0207712_10014400 3300025961 Bacteria 5088
104 Ga0207668_10208483 3300025972 Bacteria 1561
105 Ga0207640_10256313 3300025981 Bacteria 1361
106 Ga0207677_10086713 3300026023 Bacteria 2264
107 Ga0207677_10285170 3300026023 Bacteria 1357
108 Ga0207677_10410255 3300026023 Unclassified 1151
109 Ga0207703_10451944 3300026035 Bacteria 1200
110 Ga0207703_11027193 3300026035 Bacteria 791
111 Ga0207639_10063805 3300026041 Bacteria 2854
112 Ga0207641_10129893 3300026088 Bacteria 2261
113 Ga0207641_10347999 3300026088 Bacteria 1412
114 Ga0207648_10037812 3300026089 Bacteria 4250
115 Ga0207648_10909170 3300026089 Unclassified 822
116 Ga0207674_10503176 3300026116 Bacteria 1170
117 Ga0207698_10602007 3300026142 Unclassified 1084
118 Ga0209179_1004460 3300027512 Bacteria 2114
119 Ga0207428_10009827 3300027907 Bacteria 8572
120 Ga0207428_10086984 3300027907 Bacteria 2432
121 Ga0268265_10151352 3300028380 Bacteria 1957
122 Ga0268265_10371736 3300028380 Bacteria 1312
123 Ga0268264_10200976 3300028381 Bacteria 1823
124 Ga0265326_10014200 3300028558 Bacteria 2320
125 Ga0265326_10034196 3300028558 Bacteria 1446
126 Ga0265326_10077470 3300028558 Bacteria 940
127 Ga0265318_10000068 3300028577 Bacteria 101168
128 Ga0265318_10069598 3300028577 Bacteria 1305
129 Ga0265318_10205797 3300028577 Bacteria 719
130 Ga0265323_10001839 3300028653 Bacteria 10065
131 Ga0265323_10001913 3300028653 Bacteria 9816
132 Ga0265323_10004976 3300028653 Bacteria 5672
133 Ga0265322_10083461 3300028654 Bacteria 907
134 Ga0265338_10140846 3300028800 Bacteria 1889
135 Ga0265338_10223618 3300028800 Bacteria 1404
136 Ga0265324_10000981 3300029957 Bacteria 17653
137 Ga0265330_10000031 3300031235 Bacteria 132487
138 Ga0265330_10008380 3300031235 Bacteria 4978
139 Ga0265330_10034074 3300031235 Bacteria 2275
140 Ga0265330_10054091 3300031235 Bacteria 1755
141 Ga0265330_10056537 3300031235 Bacteria 1712
142 Ga0265332_10000135 3300031238 Bacteria 60723
143 Ga0265332_10003860 3300031238 Bacteria 7155
144 Ga0265328_10002156 3300031239 Bacteria 8885
145 Ga0265320_10000028 3300031240 Bacteria 160699
146 Ga0265325_10050311 3300031241 Bacteria 2146
147 Ga0265329_10000477 3300031242 Bacteria 20870
148 Ga0265329_10002166 3300031242 Bacteria 9090
149 Ga0265329_10024081 3300031242 Bacteria 2022
150 Ga0265340_10000655 3300031247 Bacteria 19483
151 Ga0265339_10000008 3300031249 Bacteria 239647
152 Ga0265339_10017678 3300031249 Bacteria 4218
153 Ga0265339_10090659 3300031249 Bacteria 1603
154 Ga0265339_10223126 3300031249 Unclassified 921
155 Ga0265331_10000023 3300031250 Bacteria 236483
156 Ga0265316_10000197 3300031344 Bacteria 69929
157 Ga0265316_10000476 3300031344 Bacteria 45632
158 Ga0265316_10003533 3300031344 Bacteria 15776
159 Ga0265316_10003573 3300031344 Bacteria 15683
160 Ga0265316_10004247 3300031344 Bacteria 14315
161 Ga0265316_10035747 3300031344 Bacteria 4022
162 Ga0265316_10041320 3300031344 Bacteria 3691
163 Ga0265316_10092058 3300031344 Bacteria 2312
164 Ga0265316_10413847 3300031344 Unclassified 970
165 Ga0307513_10237472 3300031456 Bacteria 1631
166 Ga0307513_10522356 3300031456 Bacteria 902
167 Ga0307509_10232538 3300031507 Bacteria 1645
168 Ga0265313_10000126 3300031595 Bacteria 76903
169 Ga0265313_10033541 3300031595 Bacteria 2607
170 Ga0265313_10077367 3300031595 Bacteria 1519
171 Ga0307508_10051215 3300031616 Bacteria 3671
172 Ga0307514_10089713 3300031649 Unclassified 2245
173 Ga0265314_10000176 3300031711 Bacteria 94482
174 Ga0265342_10002390 3300031712 Bacteria 16259
175 Ga0265342_10003904 3300031712 Bacteria 11974
176 Ga0265342_10007646 3300031712 Bacteria 7875
177 Ga0265342_10011297 3300031712 Bacteria 6121
178 Ga0265342_10319496 3300031712 Unclassified 814
179 Ga0316576_10008422 3300031727 Bacteria 6576
180 Ga0316578_10085188 3300031728 Bacteria 1884
181 Ga0307412_10028045 3300031911 Bacteria 3519
182 Ga0307507_10059088 3300033179 Bacteria 3594
183 Ga0373949_0000066 3300035090 Bacteria 38535
184 Ga0373923_0218929 3300035111 Unclassified 884
185 Ga0373943_0068186 3300035170 Bacteria 1795
186 Ga0373943_0080610 3300035170 Bacteria 1668
187 Ga0373946_0113019 3300035171 Unclassified 1231
188 Ga0316574_0022413 3300035398 Bacteria 3759
189 Ga0373924_0013560 3300035410 Bacteria 3064
190 Ga0373935_0028017 3300035692 Bacteria 3481
191 Ga0373927_0001271 3300035695 Bacteria 19092
192 Ga0373947_0001278 3300035725 Bacteria 15512
193 Ga0373947_0107414 3300035725 Bacteria 1760
194 Ga0316584_0081924 3300036712 Bacteria 2417
195 Ga0373925_0039933 3300037068 Bacteria 3473
196 Ga0373925_0166561 3300037068 Bacteria 1738
197 Ga0373925_0359408 3300037068 Unclassified 1183
198 Ga0436365_0663890 3300039437 Bacteria 2928
199 Ga0436365_0998402 3300039437 Bacteria 1920
200 Ga0436365_1498140 3300039437 Bacteria 2181
201 Ga0436363_1547171 3300039450 Bacteria 792
202 Ga0451577_0165802 3300042876 Bacteria 1990
203 Ga0453684_0138711 3300044712 Bacteria 2907
204 Ga0451576_0082343 3300045051 Bacteria 3347
205 Ga0451576_0303595 3300045051 Bacteria 1670
206 Ga0495580_0179029 3300046472 Bacteria 1464
207 Ga0495639_0114353 3300046475 Unclassified 1283
208 Ga0495618_0076978 3300046514 Bacteria 2126
209 Ga0495630_0017501 3300046517 Bacteria 5252
210 Ga0495630_0134157 3300046517 Unclassified 1881
211 Ga0495586_0014149 3300046535 Bacteria 4239
212 Ga0495634_0005650 3300046642 Bacteria 9581
213 Ga0495674_0002762 3300047319 Bacteria 17034
214 Ga0496100_0017796 3300048903 Bacteria 4203
215 Ga0496102_0285200 3300048905 Unclassified 1556
216 Ga0496103_0210936 3300048906 Bacteria 1249
217 Ga0496104_0075859 3300048907 Bacteria 3202
218 Ga0496104_0273692 3300048907 Bacteria 1601
219 Ga0496105_0128346 3300048908 Bacteria 2091
220 Ga0496108_0180584 3300048911 Bacteria 1827
221 Ga0496109_0059371 3300048912 Bacteria 3494
222 Ga0496109_0420600 3300048912 Bacteria 1262
223 Ga0496113_0582083 3300048916 Bacteria 897
224 Ga0496114_0003668 3300048917 Bacteria 11811
225 Ga0496115_0021356 3300048918 Bacteria 5001
226 Ga0501033_0210554 3300049570 Bacteria 1386
227 Ga0501034_0126643 3300049571 Bacteria 2539
228 Ga0501041_0054658 3300049577 Bacteria 2436
229 Ga0501067_0000551 3300049583 Bacteria 20297
230 Ga0501067_0138296 3300049583 Bacteria 1356
231 Ga0501073_0036946 3300049589 Bacteria 3469
232 Ga0501073_0481198 3300049589 Bacteria 858
233 Ga0501076_0587553 3300049592 Bacteria 919
234 Ga0501081_0018622 3300049743 Bacteria 4614
235 Ga0501035_0192187 3300049822 Bacteria 1755
236 nmdc:mga07m45_171952_c1 3300050496 Unclassified 1259
237 nmdc:mga05p37_781965_c1 3300050507 Bacteria 1047
238 nmdc:mga08y16_1033675_c1 3300050511 Bacteria 800
239 nmdc:mga08y16_2696_c1 3300050511 Bacteria 18221
240 nmdc:mga08y16_71105_c1 3300050511 Bacteria 3626
241 nmdc:mga08y16_87237_c1 3300050511 Bacteria 3251
242 Ga0501084_0790902 3300054114 Bacteria 799
243 Ga0501082_0914428 3300060353 Bacteria 767
244 Ga0530510_0207633 3300061734 Bacteria 1455
245 Ga0265318_10010395
246 rootH2_10297567
247 rootH1_10107783
248 Ga0070676_10014289
249 Ga0070683_100000861
250 Ga0070690_100003396
251 Ga0070690_100019680
252 Ga0070680_100070702
253 Ga0070682_100281695
254 Ga0070682_100666749
255 Ga0068868_100004918
256 Ga0068868_100362556
257 Ga0070687_100076531
258 Ga0070669_100035804
259 Ga0070675_100443084
260 Ga0070674_100004015
261 Ga0070674_101086398
262 Ga0070673_100082962
263 Ga0070673_100313820
264 Ga0070688_100050515
265 Ga0070709_10078347
266 Ga0070713_100664963
267 Ga0070710_10285688
268 Ga0070705_100924143
269 Ga0070700_100020176
270 Ga0070694_100096661
271 Ga0068867_100208680
272 Ga0068867_101149172
273 Ga0070698_100443639
274 Ga0070679_100001770
275 Ga0070684_100022682
276 Ga0070684_100266010
277 Ga0068853_100024372
278 Ga0070672_100065502
279 Ga0070672_100211583
280 Ga0070686_100041824
281 Ga0070695_100562614
282 Ga0070696_100003850
283 Ga0070696_100549031
284 Ga0068855_100001558
285 Ga0068856_100006228
286 Ga0068856_100016089
287 Ga0068856_100558640
288 Ga0070702_100031914
289 Ga0068852_100091307
290 Ga0068859_100195712
291 Ga0068864_100478272
292 Ga0068866_10360376
293 Ga0068863_100258405
294 Ga0068858_100038471
295 Ga0068858_100192873
296 Ga0068862_100195092
297 Ga0070717_10075679
298 Ga0075370_10156783
299 Ga0075428_100113582
300 Ga0075428_100181328
301 Ga0075428_100238898
302 Ga0075433_10017545
303 Ga0075433_10373632
304 Ga0075434_100102103
305 Ga0075434_100720829
306 Ga0068865_100023990
307 Ga0075436_100023109
308 Ga0097620_100195726
309 Ga0099795_10008167
310 Ga0105240_10155852
311 Ga0105240_10272107
312 Ga0105240_11168936
313 Ga0111539_10009583
314 Ga0111539_10045379
315 Ga0111539_10472387
316 Ga0114129_10003544
317 Ga0114129_10591267
318 Ga0105243_10198108
319 Ga0105249_10247556
320 Ga0099796_10015767
321 Ga0157378_11250461
322 Ga0157377_10253168
323 Ga0157376_10355584
324 Ga0213876_10237654
325 Ga0207692_10063488
326 Ga0207680_10050613
327 Ga0207647_10017522
328 Ga0207645_10002118
329 Ga0207684_10411806
330 Ga0207707_10358593
331 Ga0207660_10055688
332 Ga0207662_10027145
333 Ga0207652_10052187
334 Ga0207652_10485189
335 Ga0207681_10007574
336 Ga0207700_10403214
337 Ga0207690_10111968
338 Ga0207669_10008437
339 Ga0207704_10007641
340 Ga0207691_10072826
341 Ga0207691_10256606
342 Ga0207661_10002020
343 Ga0207667_10000567
344 Ga0207667_10012785
345 Ga0207667_10060780
346 Ga0207651_10043347
347 Ga0207712_10014400
348 Ga0207668_10208483
349 Ga0207640_10256313
350 Ga0207677_10086713
351 Ga0207677_10285170
352 Ga0207677_10410255
353 Ga0207703_10451944
354 Ga0207703_11027193
355 Ga0207639_10063805
356 Ga0207641_10129893
357 Ga0207641_10347999
358 Ga0207648_10037812
359 Ga0207648_10909170
360 Ga0207674_10503176
361 Ga0207698_10602007
362 Ga0209179_1004460
363 Ga0207428_10009827
364 Ga0207428_10086984
365 Ga0268265_10151352
366 Ga0268265_10371736
367 Ga0268264_10200976
368 Ga0265326_10014200
369 Ga0265326_10034196
370 Ga0265326_10077470
371 Ga0265318_10000068
372 Ga0265318_10069598
373 Ga0265318_10205797
374 Ga0265323_10001839
375 Ga0265323_10001913
376 Ga0265323_10004976
377 Ga0265322_10083461
378 Ga0265338_10140846
379 Ga0265338_10223618
380 Ga0265324_10000981
381 Ga0265330_10000031
382 Ga0265330_10008380
383 Ga0265330_10034074
384 Ga0265330_10054091
385 Ga0265330_10056537
386 Ga0265332_10000135
387 Ga0265332_10003860
388 Ga0265328_10002156
389 Ga0265320_10000028
390 Ga0265325_10050311
391 Ga0265329_10000477
392 Ga0265329_10002166
393 Ga0265329_10024081
394 Ga0265340_10000655
395 Ga0265339_10000008
396 Ga0265339_10017678
397 Ga0265339_10090659
398 Ga0265339_10223126
399 Ga0265331_10000023
400 Ga0265316_10000197
401 Ga0265316_10000476
402 Ga0265316_10003533
403 Ga0265316_10003573
404 Ga0265316_10004247
405 Ga0265316_10035747
406 Ga0265316_10041320
407 Ga0265316_10092058
408 Ga0265316_10413847
409 Ga0307513_10237472
410 Ga0307513_10522356
411 Ga0307509_10232538
412 Ga0265313_10000126
413 Ga0265313_10033541
414 Ga0265313_10077367
415 Ga0307508_10051215
416 Ga0307514_10089713
417 Ga0265314_10000176
418 Ga0265342_10002390
419 Ga0265342_10003904
420 Ga0265342_10007646
421 Ga0265342_10011297
422 Ga0265342_10319496
423 Ga0316576_10008422
424 Ga0316578_10085188
425 Ga0307412_10028045
426 Ga0307507_10059088
427 Ga0373949_0000066
428 Ga0373923_0218929
429 Ga0373943_0068186
430 Ga0373943_0080610
431 Ga0373946_0113019
432 Ga0316574_0022413
433 Ga0373924_0013560
434 Ga0373935_0028017
435 Ga0373927_0001271
436 Ga0373947_0001278
437 Ga0373947_0107414
438 Ga0316584_0081924
439 Ga0373925_0039933
440 Ga0373925_0166561
441 Ga0373925_0359408
442 Ga0436365_0663890
443 Ga0436365_0998402
444 Ga0436365_1498140
445 Ga0436363_1547171
446 Ga0451577_0165802
447 Ga0453684_0138711
448 Ga0451576_0082343
449 Ga0451576_0303595
450 Ga0495580_0179029
451 Ga0495639_0114353
452 Ga0495618_0076978
453 Ga0495630_0017501
454 Ga0495630_0134157
455 Ga0495586_0014149
456 Ga0495634_0005650
457 Ga0495674_0002762
458 Ga0496100_0017796
459 Ga0496102_0285200
460 Ga0496103_0210936
461 Ga0496104_0075859
462 Ga0496104_0273692
463 Ga0496105_0128346
464 Ga0496108_0180584
465 Ga0496109_0059371
466 Ga0496109_0420600
467 Ga0496113_0582083
468 Ga0496114_0003668
469 Ga0496115_0021356
470 Ga0501033_0210554
471 Ga0501034_0126643
472 Ga0501041_0054658
473 Ga0501067_0000551
474 Ga0501067_0138296
475 Ga0501073_0036946
476 Ga0501073_0481198
477 Ga0501076_0587553
478 Ga0501081_0018622
479 Ga0501035_0192187
480 nmdc:mga07m45_171952_c1
481 nmdc:mga05p37_781965_c1
482 nmdc:mga08y16_1033675_c1
483 nmdc:mga08y16_2696_c1
484 nmdc:mga08y16_71105_c1
485 nmdc:mga08y16_87237_c1
486 Ga0501084_0790902
487 Ga0501082_0914428
488 Ga0530510_0207633

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01081

Aldolase

KDPG and KHG aldolase

33

229

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e01-assembly1.cif.gz_A structure of engineered nano-cage fusion protein 0.9584 7 212
6p6f-assembly1.cif.gz_A bg505 sosip-i53-50np 0.9578 8 212
1wa3-assembly2.cif.gz_F mechanism of the class i kdpg aldolase 0.9568 8 212
7b3y-assembly1.cif.gz_B-9 structure of a nanoparticle for a covid-19 vaccine candidate 0.9566 6 212
8szz-assembly1.cif.gz_J cryoem structure of computationally designed nanocage o32-zl4 0.9553 8 212
ID Description Score Start End Superfamily
af_A0A1D6HW21_144_318_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9594 38 209 3.20.20.70
af_K7LFS0_36_255_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9527 4 216 3.20.20.70
1vlwB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9515 3 213 3.20.20.70
2v81A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9443 15 215 3.20.20.70
1vlwB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9338 3 213 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6L8HPM7-F1-model_v4 deleted 0.9972 1 215
AF-A0A7Y8I1Q4-F1-model_v4 Bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14, EC 4.1.3.16) 0.9957 1 217 GO:0008675
GO:0008700
AF-A0A2V8GAB8-F1-model_v4 2-dehydro-3-deoxyphosphogluconate aldolase 0.9942 1 216 GO:0016829
AF-A0A2V8S183-F1-model_v4 2-dehydro-3-deoxyphosphogluconate aldolase 0.9941 1 215 GO:0016829
AF-A0A3L6JGD4-F1-model_v4 2-dehydro-3-deoxyphosphogluconate aldolase 0.9941 2 214 GO:0016829

Map