F356469

General Info

Members Datasets Scaffolds Average Seq Length
244 149 488 394

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10016976|Ga0105241_100169761
Length 471
Sequence MVALTIACYLHGQPSGFFYLIVSNKMRARIPLILLLLVTADVYFYQAIETLTNNSFILSGYWLLDLFLMIGLIFAFTQRKSMPKLAPILMTTLLLTLVPKLFGMPVLALEDIARIFRGFPPRIPQVSELALIVAAIPFIGLLYGLTRGRHNYKIHKETLYFDDLPDAFDGFTITQLSDIHSGSFTSEKGVTKGINLVNQQNSDLILFTGDLVNNLASEMDRWIPFFSKLTAPYGKFSILGNHDYGDYVQWESAHHQQDNLNRLKNVHKEIGFNLLLNEAVPVKKKDESVALIGVENWGKGGFHKYGDLDKATRHVPDDAFKILMSHDPSHWDAVTLDHDQHIHLTLSGHTHGMQFGIELFGWKWSPIKYVYKQWAGLYNKSGKYLYVNRGFGFLGLKGRVGIWPEITVLTLKKSDCVKKRSTINEYGKICFVVIGTKYHIRTKRFAKAEDIIRVISHQSAINRHIAQQVKA

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
51 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
53 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
54 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
82 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
83 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
84 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
88 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
91 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
92 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
100 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
106 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
109 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
110 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
111 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
112 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
113 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
120 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
121 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
125 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
126 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
127 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
128 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
129 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
130 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
131 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
132 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
133 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
134 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
135 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
136 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
137 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
138 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
139 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
140 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
141 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
142 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
143 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
144 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
145 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
146 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
147 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
148 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
149 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.67
Metatranscriptomes 0
Isolates 5.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.15
Nodule 0
Rhizoplane 0.41
Rhizosphere 84.02
Stem 0
Stem Tuber 0
Unclassified 4.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10016976 3300009174 Bacteria 5342
2 JGI24737J22298_10016607 3300001990 Bacteria 2376
3 JGI25162J39368_1000022 3300002737 Bacteria 239510
4 JGI25162J39368_1000188 3300002737 Bacteria 64938
5 rootH1_10029913 3300003316 Bacteria 13017
6 rootH1_10195631 3300003316 Bacteria 1854
7 rootH2_10001800 3300003320 Bacteria 58739
8 rootL2_10057606 3300003322 Bacteria 18489
9 rootL2_10119215 3300003322 Bacteria 4319
10 rootH1_10000303 3300003323 Unclassified 3409
11 rootH1_10302568 3300003323 Bacteria 3728
12 Ga0070658_10000073 3300005327 Bacteria 96498
13 Ga0070658_10076710 3300005327 Unclassified 2741
14 Ga0070676_10017263 3300005328 Unclassified 3994
15 Ga0068869_100114196 3300005334 Bacteria 2058
16 Ga0070680_100004414 3300005336 Bacteria 10586
17 Ga0070671_100072354 3300005355 Bacteria 2879
18 Ga0070674_100061118 3300005356 Bacteria 2628
19 Ga0070673_100003195 3300005364 Bacteria 10150
20 Ga0070659_100015515 3300005366 Bacteria 5707
21 Ga0070667_100160650 3300005367 Bacteria 1979
22 Ga0070663_100017174 3300005455 Bacteria 4717
23 Ga0070678_100002250 3300005456 Bacteria 10500
24 Ga0070662_100000110 3300005457 Bacteria 45618
25 Ga0070662_100090738 3300005457 Bacteria 2294
26 Ga0070681_10007244 3300005458 Bacteria 10824
27 Ga0068867_100001166 3300005459 Bacteria 17965
28 Ga0070679_100198398 3300005530 Bacteria 1973
29 Ga0068853_100006701 3300005539 Bacteria 9177
30 Ga0068853_100012611 3300005539 Bacteria 6878
31 Ga0070665_100000063 3300005548 Bacteria 218300
32 Ga0070665_100000083 3300005548 Bacteria 181044
33 Ga0068855_100010585 3300005563 Bacteria 11118
34 Ga0068855_100045223 3300005563 Bacteria 5207
35 Ga0068855_100174366 3300005563 Bacteria 2434
36 Ga0068855_100341565 3300005563 Bacteria 1651
37 Ga0068854_100021827 3300005578 Bacteria 4351
38 Ga0068856_100042345 3300005614 Bacteria 4479
39 Ga0068856_100167300 3300005614 Bacteria 2210
40 Ga0068852_100007092 3300005616 Bacteria 8165
41 Ga0068866_10022429 3300005718 Bacteria 2922
42 Ga0068870_10009709 3300005840 Bacteria 4387
43 Ga0097621_100000041 3300006237 Bacteria 66329
44 Ga0068871_100000153 3300006358 Bacteria 45540
45 Ga0068865_100001648 3300006881 Bacteria 13085
46 Ga0105240_10000389 3300009093 Bacteria 82353
47 Ga0105240_10003052 3300009093 Bacteria 26340
48 Ga0105240_10006046 3300009093 Bacteria 17877
49 Ga0105240_10023255 3300009093 Bacteria 8203
50 Ga0105240_10024929 3300009093 Bacteria 7873
51 Ga0105240_10052200 3300009093 Bacteria 5141
52 Ga0105240_10068060 3300009093 Bacteria 4412
53 Ga0105240_10193842 3300009093 Bacteria 2387
54 Ga0105243_10000007 3300009148 Bacteria 445042
55 Ga0105243_10316724 3300009148 Bacteria 1420
56 Ga0105241_10027994 3300009174 Bacteria 4197
57 Ga0105241_10043151 3300009174 Bacteria 3415
58 Ga0105241_10131609 3300009174 Bacteria 2026
59 Ga0105237_10000963 3300009545 Bacteria 38740
60 Ga0105237_10001031 3300009545 Bacteria 37539
61 Ga0105237_10001790 3300009545 Bacteria 27800
62 Ga0105237_10005439 3300009545 Bacteria 14381
63 Ga0105237_10007564 3300009545 Bacteria 11875
64 Ga0105237_10011671 3300009545 Bacteria 9296
65 Ga0105237_10430585 3300009545 Bacteria 1325
66 Ga0105238_10012665 3300009551 Bacteria 8513
67 Ga0105238_10055152 3300009551 Bacteria 3990
68 Ga0105239_10000013 3300010375 Bacteria 327371
69 Ga0105239_10000094 3300010375 Bacteria 124925
70 Ga0105239_10000120 3300010375 Bacteria 110003
71 Ga0105239_10002410 3300010375 Bacteria 23819
72 Ga0105239_10008367 3300010375 Bacteria 11785
73 Ga0105239_10008855 3300010375 Bacteria 11392
74 Ga0105239_10013219 3300010375 Bacteria 9173
75 Ga0105239_10018146 3300010375 Bacteria 7778
76 Ga0105239_10021112 3300010375 Bacteria 7184
77 Ga0105239_10042631 3300010375 Bacteria 4972
78 Ga0105239_10070647 3300010375 Bacteria 3836
79 Ga0157373_10005043 3300013100 Bacteria 9918
80 Ga0157371_10000657 3300013102 Bacteria 40996
81 Ga0157371_10000760 3300013102 Bacteria 37271
82 Ga0157369_10455849 3300013105 Bacteria 1324
83 Ga0157374_10000129 3300013296 Bacteria 69468
84 Ga0157374_10001455 3300013296 Bacteria 20010
85 Ga0157378_10004989 3300013297 Bacteria 11641
86 Ga0157378_10023906 3300013297 Bacteria 5375
87 Ga0163162_10000068 3300013306 Bacteria 97068
88 Ga0163162_10005127 3300013306 Bacteria 12623
89 Ga0163162_10060644 3300013306 Bacteria 3819
90 Ga0163162_10094363 3300013306 Bacteria 3078
91 Ga0157372_10000001 3300013307 Bacteria 791349
92 Ga0157372_10000873 3300013307 Bacteria 32729
93 Ga0157372_10005508 3300013307 Bacteria 13458
94 Ga0157372_10144698 3300013307 Bacteria 2741
95 Ga0157375_10004903 3300013308 Bacteria 11633
96 Ga0157375_10048682 3300013308 Unclassified 4148
97 Ga0157375_10070803 3300013308 Bacteria 3499
98 Ga0163163_10036684 3300014325 Bacteria 4764
99 Ga0182005_1000357 3300015265 Bacteria 25732
100 Ga0163161_10051783 3300017792 Bacteria 2975
101 Ga0213872_10020870 3300021361 Bacteria 3017
102 Ga0209437_100024 3300025233 Bacteria 592878
103 Ga0209026_1001313 3300025250 Bacteria 11198
104 Ga0209233_1000758 3300025261 Bacteria 14596
105 Ga0209233_1020415 3300025261 Bacteria 1738
106 Ga0209257_1000001 3300025304 Bacteria 2274655
107 Ga0207680_10037810 3300025903 Bacteria 2789
108 Ga0207647_10000062 3300025904 Bacteria 83809
109 Ga0207647_10000076 3300025904 Bacteria 75824
110 Ga0207645_10000569 3300025907 Bacteria 30576
111 Ga0207705_10000225 3300025909 Bacteria 56142
112 Ga0207705_10146701 3300025909 Unclassified 1766
113 Ga0207654_10004784 3300025911 Bacteria 6859
114 Ga0207654_10015568 3300025911 Unclassified 3950
115 Ga0207654_10083149 3300025911 Bacteria 1932
116 Ga0207695_10000220 3300025913 Bacteria 152742
117 Ga0207695_10001067 3300025913 Bacteria 47991
118 Ga0207695_10004281 3300025913 Bacteria 19579
119 Ga0207695_10032354 3300025913 Bacteria 5724
120 Ga0207695_10051512 3300025913 Bacteria 4322
121 Ga0207695_10175751 3300025913 Bacteria 2064
122 Ga0207671_10002560 3300025914 Bacteria 19306
123 Ga0207671_10004762 3300025914 Bacteria 12810
124 Ga0207671_10007074 3300025914 Bacteria 9813
125 Ga0207671_10018223 3300025914 Bacteria 5393
126 Ga0207671_10054024 3300025914 Bacteria 2976
127 Ga0207660_10136665 3300025917 Bacteria 1871
128 Ga0207652_10073564 3300025921 Bacteria 2973
129 Ga0207694_10040358 3300025924 Unclassified 3593
130 Ga0207694_10090173 3300025924 Bacteria 2418
131 Ga0207644_10081689 3300025931 Bacteria 2389
132 Ga0207690_10017570 3300025932 Bacteria 4371
133 Ga0207706_10000306 3300025933 Bacteria 53202
134 Ga0207706_10146509 3300025933 Bacteria 2077
135 Ga0207709_10000033 3300025935 Bacteria 320483
136 Ga0207704_10000037 3300025938 Bacteria 93990
137 Ga0207667_10028130 3300025949 Bacteria 6107
138 Ga0207667_10034089 3300025949 Bacteria 5470
139 Ga0207667_10121555 3300025949 Bacteria 2691
140 Ga0207640_10018194 3300025981 Bacteria 4125
141 Ga0207677_10200077 3300026023 Unclassified 1587
142 Ga0207639_10008649 3300026041 Bacteria 6986
143 Ga0207639_10010855 3300026041 Bacteria 6315
144 Ga0207702_10000223 3300026078 Bacteria 66194
145 Ga0207702_10030124 3300026078 Bacteria 4521
146 Ga0207648_10000770 3300026089 Bacteria 36093
147 Ga0207674_10041580 3300026116 Bacteria 4752
148 Ga0207674_10287191 3300026116 Bacteria 1593
149 Ga0207683_10006466 3300026121 Bacteria 10030
150 Ga0207698_10006016 3300026142 Bacteria 7543
151 Ga0268266_10000057 3300028379 Bacteria 284777
152 Ga0268266_10000095 3300028379 Bacteria 186169
153 Ga0268264_10000143 3300028381 Bacteria 170031
154 Ga0265323_10004660 3300028653 Bacteria 5885
155 Ga0307517_10001235 3300028786 Bacteria 42948
156 Ga0307517_10007343 3300028786 Bacteria 16093
157 Ga0316183_1162426 3300030742 Bacteria 28989
158 Ga0316181_1286160 3300030744 Bacteria 2698
159 Ga0316181_1286272 3300030744 Bacteria 35110
160 Ga0265316_10001491 3300031344 Bacteria 25086
161 Ga0307408_100000958 3300031548 Bacteria 22408
162 Ga0307408_100001304 3300031548 Bacteria 18669
163 Ga0307408_100001471 3300031548 Bacteria 17472
164 Ga0316578_10025898 3300031728 Bacteria 3303
165 Ga0307516_10022211 3300031730 Bacteria 6521
166 Ga0307414_10003325 3300032004 Bacteria 8581
167 Ga0307414_10010924 3300032004 Bacteria 5300
168 Ga0307414_10032649 3300032004 Unclassified 3431
169 Ga0316585_10041003 3300032137 Bacteria 1475
170 Ga0307507_10000023 3300033179 Bacteria 212423
171 Ga0316582_0006326 3300036647 Bacteria 6209
172 Ga0395899_0000033 3300037312 Bacteria 306589
173 Ga0395899_0004136 3300037312 Bacteria 11408
174 Ga0395900_0000095 3300037418 Bacteria 164383
175 Ga0395900_0002401 3300037418 Bacteria 20660
176 Ga0395900_0009453 3300037418 Bacteria 9992
177 Ga0395898_0322227 3300037466 Bacteria 1474
178 Ga0395905_0000473 3300037471 Bacteria 55504
179 Ga0395905_0003296 3300037471 Bacteria 17333
180 Ga0395901_0000890 3300038443 Bacteria 32857
181 Ga0436361_0827796 3300039447 Bacteria 4940
182 Ga0439431_0001529 3300041997 Bacteria 5113
183 Ga0466972_0003246 3300044658 Bacteria 8062
184 Ga0466966_0005631 3300044684 Bacteria 8238
185 Ga0466961_0059198 3300044693 Bacteria 2436
186 Ga0451576_0001593 3300045051 Bacteria 38143
187 Ga0466958_0111231 3300045836 Bacteria 1710
188 Ga0495650_0000013 3300046471 Bacteria 611135
189 Ga0495585_0000299 3300046492 Bacteria 49739
190 Ga0495585_0034823 3300046492 Bacteria 2846
191 Ga0495606_0000010 3300046507 Bacteria 299893
192 Ga0495606_0011403 3300046507 Bacteria 7251
193 Ga0495606_0045516 3300046507 Bacteria 2907
194 Ga0495606_0056116 3300046507 Bacteria 2544
195 Ga0495610_0000370 3300046512 Bacteria 46662
196 Ga0495616_0002896 3300046513 Bacteria 11203
197 Ga0495648_0036445 3300046524 Bacteria 3173
198 Ga0495654_0065099 3300046530 Bacteria 1741
199 Ga0495609_0003718 3300046538 Bacteria 8619
200 Ga0495609_0023165 3300046538 Bacteria 2855
201 Ga0495633_0020334 3300046558 Unclassified 3340
202 Ga0495668_0000009 3300046616 Bacteria 492623
203 Ga0495611_0000047 3300046648 Bacteria 85473
204 Ga0495625_0000100 3300046660 Bacteria 139983
205 Ga0495625_0000477 3300046660 Bacteria 60324
206 Ga0495625_0022471 3300046660 Bacteria 4837
207 Ga0495661_0007850 3300046665 Bacteria 7425
208 Ga0495658_0045287 3300046683 Bacteria 2469
209 Ga0495649_0000002 3300046694 Bacteria 1093458
210 Ga0495660_0024912 3300046810 Bacteria 3403
211 Ga0495687_051191 3300047443 Bacteria 1754
212 Ga0495686_0000098 3300047472 Bacteria 183131
213 Ga0495686_0001772 3300047472 Bacteria 22013
214 Ga0495686_0019273 3300047472 Bacteria 4561
215 Ga0495686_0030176 3300047472 Bacteria 3523
216 Ga0495686_0061012 3300047472 Bacteria 2343
217 Ga0496115_0189371 3300048918 Bacteria 1700
218 Ga0496117_0002866 3300048920 Bacteria 20968
219 Ga0496121_0000008 3300048924 Bacteria 843593
220 Ga0496122_0025682 3300048925 Bacteria 5106
221 Ga0496123_0007457 3300048926 Bacteria 10293
222 Ga0495678_005711 3300049459 Bacteria 6768
223 nmdc:mga0k408_124840_c1 3300050493 Bacteria 1526
224 Ga0500635_0000697 3300053080 Bacteria 8506
225 Ga0500644_0007012 3300053088 Unclassified 2917
226 Ga0500562_000020 3300053108 Bacteria 113686
227 Ga0500608_004041 3300053122 Bacteria 5616
228 Ga0500616_0022837 3300053153 Bacteria 3492
229 Ga0500622_0000467 3300053156 Bacteria 38187
230 Ga0500622_0002540 3300053156 Bacteria 13096
231 Ga0500637_0076787 3300053178 Unclassified 1927
232 2819575500 2818991442 Bacteria 8318214
233 2821138049 2821136567 Bacteria 8080116
234 2896114140 2896109856 Bacteria 7140722
235 2904468844 2904467357 Bacteria 8057758
236 2904784280 2904780799 Bacteria 5840761
237 2919179096 2919177583 Bacteria 5641607
238 2929181248 2929177148 Bacteria 7883697
239 2929244579 2929239360 Bacteria 7745570
240 2945983651 2945977869 Bacteria 7777518
241 2946016961 2946013367 Bacteria 7766675
242 2977235515 2977232053 Bacteria 5485925
243 3003235306 3003233435 Bacteria 4458031
244 8036737179 8036736890 Bacteria 2944828
245 Ga0105241_10016976
246 JGI24737J22298_10016607
247 JGI25162J39368_1000022
248 JGI25162J39368_1000188
249 rootH1_10029913
250 rootH1_10195631
251 rootH2_10001800
252 rootL2_10057606
253 rootL2_10119215
254 rootH1_10000303
255 rootH1_10302568
256 Ga0070658_10000073
257 Ga0070658_10076710
258 Ga0070676_10017263
259 Ga0068869_100114196
260 Ga0070680_100004414
261 Ga0070671_100072354
262 Ga0070674_100061118
263 Ga0070673_100003195
264 Ga0070659_100015515
265 Ga0070667_100160650
266 Ga0070663_100017174
267 Ga0070678_100002250
268 Ga0070662_100000110
269 Ga0070662_100090738
270 Ga0070681_10007244
271 Ga0068867_100001166
272 Ga0070679_100198398
273 Ga0068853_100006701
274 Ga0068853_100012611
275 Ga0070665_100000063
276 Ga0070665_100000083
277 Ga0068855_100010585
278 Ga0068855_100045223
279 Ga0068855_100174366
280 Ga0068855_100341565
281 Ga0068854_100021827
282 Ga0068856_100042345
283 Ga0068856_100167300
284 Ga0068852_100007092
285 Ga0068866_10022429
286 Ga0068870_10009709
287 Ga0097621_100000041
288 Ga0068871_100000153
289 Ga0068865_100001648
290 Ga0105240_10000389
291 Ga0105240_10003052
292 Ga0105240_10006046
293 Ga0105240_10023255
294 Ga0105240_10024929
295 Ga0105240_10052200
296 Ga0105240_10068060
297 Ga0105240_10193842
298 Ga0105243_10000007
299 Ga0105243_10316724
300 Ga0105241_10027994
301 Ga0105241_10043151
302 Ga0105241_10131609
303 Ga0105237_10000963
304 Ga0105237_10001031
305 Ga0105237_10001790
306 Ga0105237_10005439
307 Ga0105237_10007564
308 Ga0105237_10011671
309 Ga0105237_10430585
310 Ga0105238_10012665
311 Ga0105238_10055152
312 Ga0105239_10000013
313 Ga0105239_10000094
314 Ga0105239_10000120
315 Ga0105239_10002410
316 Ga0105239_10008367
317 Ga0105239_10008855
318 Ga0105239_10013219
319 Ga0105239_10018146
320 Ga0105239_10021112
321 Ga0105239_10042631
322 Ga0105239_10070647
323 Ga0157373_10005043
324 Ga0157371_10000657
325 Ga0157371_10000760
326 Ga0157369_10455849
327 Ga0157374_10000129
328 Ga0157374_10001455
329 Ga0157378_10004989
330 Ga0157378_10023906
331 Ga0163162_10000068
332 Ga0163162_10005127
333 Ga0163162_10060644
334 Ga0163162_10094363
335 Ga0157372_10000001
336 Ga0157372_10000873
337 Ga0157372_10005508
338 Ga0157372_10144698
339 Ga0157375_10004903
340 Ga0157375_10048682
341 Ga0157375_10070803
342 Ga0163163_10036684
343 Ga0182005_1000357
344 Ga0163161_10051783
345 Ga0213872_10020870
346 Ga0209437_100024
347 Ga0209026_1001313
348 Ga0209233_1000758
349 Ga0209233_1020415
350 Ga0209257_1000001
351 Ga0207680_10037810
352 Ga0207647_10000062
353 Ga0207647_10000076
354 Ga0207645_10000569
355 Ga0207705_10000225
356 Ga0207705_10146701
357 Ga0207654_10004784
358 Ga0207654_10015568
359 Ga0207654_10083149
360 Ga0207695_10000220
361 Ga0207695_10001067
362 Ga0207695_10004281
363 Ga0207695_10032354
364 Ga0207695_10051512
365 Ga0207695_10175751
366 Ga0207671_10002560
367 Ga0207671_10004762
368 Ga0207671_10007074
369 Ga0207671_10018223
370 Ga0207671_10054024
371 Ga0207660_10136665
372 Ga0207652_10073564
373 Ga0207694_10040358
374 Ga0207694_10090173
375 Ga0207644_10081689
376 Ga0207690_10017570
377 Ga0207706_10000306
378 Ga0207706_10146509
379 Ga0207709_10000033
380 Ga0207704_10000037
381 Ga0207667_10028130
382 Ga0207667_10034089
383 Ga0207667_10121555
384 Ga0207640_10018194
385 Ga0207677_10200077
386 Ga0207639_10008649
387 Ga0207639_10010855
388 Ga0207702_10000223
389 Ga0207702_10030124
390 Ga0207648_10000770
391 Ga0207674_10041580
392 Ga0207674_10287191
393 Ga0207683_10006466
394 Ga0207698_10006016
395 Ga0268266_10000057
396 Ga0268266_10000095
397 Ga0268264_10000143
398 Ga0265323_10004660
399 Ga0307517_10001235
400 Ga0307517_10007343
401 Ga0316183_1162426
402 Ga0316181_1286160
403 Ga0316181_1286272
404 Ga0265316_10001491
405 Ga0307408_100000958
406 Ga0307408_100001304
407 Ga0307408_100001471
408 Ga0316578_10025898
409 Ga0307516_10022211
410 Ga0307414_10003325
411 Ga0307414_10010924
412 Ga0307414_10032649
413 Ga0316585_10041003
414 Ga0307507_10000023
415 Ga0316582_0006326
416 Ga0395899_0000033
417 Ga0395899_0004136
418 Ga0395900_0000095
419 Ga0395900_0002401
420 Ga0395900_0009453
421 Ga0395898_0322227
422 Ga0395905_0000473
423 Ga0395905_0003296
424 Ga0395901_0000890
425 Ga0436361_0827796
426 Ga0439431_0001529
427 Ga0466972_0003246
428 Ga0466966_0005631
429 Ga0466961_0059198
430 Ga0451576_0001593
431 Ga0466958_0111231
432 Ga0495650_0000013
433 Ga0495585_0000299
434 Ga0495585_0034823
435 Ga0495606_0000010
436 Ga0495606_0011403
437 Ga0495606_0045516
438 Ga0495606_0056116
439 Ga0495610_0000370
440 Ga0495616_0002896
441 Ga0495648_0036445
442 Ga0495654_0065099
443 Ga0495609_0003718
444 Ga0495609_0023165
445 Ga0495633_0020334
446 Ga0495668_0000009
447 Ga0495611_0000047
448 Ga0495625_0000100
449 Ga0495625_0000477
450 Ga0495625_0022471
451 Ga0495661_0007850
452 Ga0495658_0045287
453 Ga0495649_0000002
454 Ga0495660_0024912
455 Ga0495687_051191
456 Ga0495686_0000098
457 Ga0495686_0001772
458 Ga0495686_0019273
459 Ga0495686_0030176
460 Ga0495686_0061012
461 Ga0496115_0189371
462 Ga0496117_0002866
463 Ga0496121_0000008
464 Ga0496122_0025682
465 Ga0496123_0007457
466 Ga0495678_005711
467 nmdc:mga0k408_124840_c1
468 Ga0500635_0000697
469 Ga0500644_0007012
470 Ga0500562_000020
471 Ga0500608_004041
472 Ga0500616_0022837
473 Ga0500622_0000467
474 Ga0500622_0002540
475 Ga0500637_0076787
476 2819575500
477 2821138049
478 2896114140
479 2904468844
480 2904784280
481 2919179096
482 2929181248
483 2929244579
484 2945983651
485 2946016961
486 2977235515
487 3003235306
488 8036737179

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

171

353

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mzp-assembly1.cif.gz_A crystal structure of stabilized a2a adenosine receptor a2ar-star2-bril in complex with caffeine at 2.1a resolution 0.5813 40 112
6unc-assembly2.cif.gz_B the crystal structure of phosphopantetheinyl hydrolase (ppth) from mycobacterium tuberculosis 0.5671 138 335
7m1l-assembly1.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.5583 144 209
2ydo-assembly1.cif.gz_A thermostabilised human a2a receptor with adenosine bound 0.558 31 112
3tgh-assembly1.cif.gz_A gap50 the anchor in the inner membrane complex of plasmodium 0.5448 138 376
ID Description Score Start End Superfamily
af_Q08BG1_205_402_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8049 142 348 3.60.21.10
af_Q09320_248_456_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7978 140 355 3.60.21.10
af_Q08BG1_205_402_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7974 142 348 3.60.21.10
af_Q22704_214_405_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7938 140 323 3.60.21.10
af_Q09320_248_456_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7907 140 355 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A5N7Z8G8-F1-model_v4 Metallophosphoesterase 0.975 116 383 GO:0008758
GO:0009245
GO:0016020
AF-A0A800F299-F1-model_v4 Metallophosphoesterase 0.9749 93 381 GO:0008758
GO:0009245
GO:0016020
AF-A0A5M4AIB3-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9644 97 378 GO:0008758
GO:0009245
GO:0016020
AF-A0A2E7FDQ8-F1-model_v4 Phosphoesterase 0.9643 176 382 GO:0008758
GO:0009245
GO:0016020
AF-A0A3D4CHR8-F1-model_v4 Phosphoesterase 0.9599 130 378 GO:0008758
GO:0009245
GO:0016020

Map