F356424

General Info

Members Datasets Scaffolds Average Seq Length
244 176 224 223

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10008031|Ga0105251_100080315
Length 256
Sequence MHLFMHHDHGDHQQKANSKHTRQRGVPTMNHTESAYGLWSLVIINSLVFILFAFSFARPKTSRDWRSFGMFSAFLVALFTEMYGFPLTIYLLMPWLTRNFPGIDFLSHDAGHLLETVLGWKVNPHWGPFHIISNLLVAGGFWLLAAAWRVLYKAQSTGQLALDGPYARIRHPQYVGFVLIMFGFLLQWPTLITLVMFPILLFVYAKLAKREEREMLAHFGDAYRTYCELTPAFLPWSTPRSPDIPTDAPPSSGKQS

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
3 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
4 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
5 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
6 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
7 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
8 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
9 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
10 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
11 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
12 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
13 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
14 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
15 2928058823 Ralstonia sp. 1138 Isolate Unclassified
16 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
17 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
44 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
47 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
48 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
49 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
60 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
61 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
62 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
63 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
64 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
67 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
68 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
69 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
76 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
77 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
78 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
80 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
84 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
85 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
86 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
87 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
88 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
89 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
90 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
94 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
95 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
96 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
97 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
98 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
99 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
100 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
101 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
102 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
103 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
104 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
105 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
106 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
107 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
108 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
109 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
110 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
111 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
112 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
113 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
114 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
115 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
116 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
117 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
122 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
125 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
126 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
127 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
128 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
129 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
130 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
131 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
132 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
133 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
134 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
135 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
136 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
137 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
138 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
144 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
145 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
150 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
155 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
156 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
157 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
158 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
159 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
160 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
161 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
162 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
163 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
164 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
165 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
166 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
167 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
168 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
169 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
170 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
171 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
172 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
174 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
175 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
176 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.39
Metatranscriptomes 0.41
Isolates 8.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.34
Nodule 3.28
Rhizoplane 1.23
Rhizosphere 73.77
Stem 0
Stem Tuber 0
Unclassified 7.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_5565 2124908027 Bacteria 6850
2 JGI24740J21852_10000542 3300001979 Bacteria 16144
3 rootL2_10006443 3300003322 Bacteria 20638
4 rootL2_10110878 3300003322 Bacteria 12249
5 Ga0006562J51391_1006314 3300003578 Bacteria 5592
6 Ga0055526_1025044 3300003771 Bacteria 1928
7 Ga0055537_1009306 3300003773 Bacteria 2183
8 Ga0055530_10000007 3300003791 Bacteria 183172
9 Ga0055540_1000990 3300003792 Bacteria 18352
10 Ga0070674_100621634 3300005356 Bacteria 915
11 Ga0070714_100197346 3300005435 Bacteria 1839
12 Ga0070698_100001575 3300005471 Bacteria 25360
13 Ga0070699_100058405 3300005518 Bacteria 3342
14 Ga0070679_100473060 3300005530 Bacteria 1197
15 Ga0068860_100075107 3300005843 Bacteria 3215
16 Ga0081539_10031614 3300005985 Bacteria 3259
17 Ga0075364_10006225 3300006051 Bacteria 7001
18 Ga0075364_10230315 3300006051 Bacteria 1258
19 Ga0075432_10002039 3300006058 Bacteria 6723
20 Ga0075432_10013347 3300006058 Bacteria 2791
21 Ga0075436_100031615 3300006914 Bacteria 3646
22 Ga0105251_10008031 3300009011 Bacteria 6399
23 Ga0105244_10056505 3300009036 Bacteria 1986
24 Ga0105249_11296528 3300009553 Bacteria 800
25 Ga0105246_10365229 3300011119 Bacteria 1187
26 Ga0157373_10099087 3300013100 Bacteria 2051
27 Ga0157371_10013899 3300013102 Bacteria 6097
28 Ga0163162_10077422 3300013306 Bacteria 3389
29 Ga0157375_10017376 3300013308 Bacteria 6489
30 Ga0182008_10024974 3300014497 Bacteria 3039
31 Ga0182006_1003115 3300015261 Bacteria 8683
32 Ga0182007_10003998 3300015262 Bacteria 6802
33 Ga0163161_10011618 3300017792 Bacteria 6115
34 Ga0214542_1016372 3300021321 Bacteria 7218
35 Ga0214545_1018033 3300021324 Bacteria 6583
36 Ga0214543_1017681 3300021327 Bacteria 6881
37 Ga0209565_1004601 3300025263 Bacteria 4158
38 Ga0209673_1004945 3300025273 Bacteria 6929
39 Ga0209676_1000003 3300025292 Bacteria 1454178
40 Ga0209025_1001215 3300025294 Bacteria 36003
41 Ga0209564_1009895 3300025295 Bacteria 4465
42 Ga0209050_1000004 3300025298 Bacteria 1600040
43 Ga0209050_1003185 3300025298 Bacteria 12449
44 Ga0209051_1000006 3300025303 Bacteria 1015785
45 Ga0207713_1007545 3300025735 Bacteria 6396
46 Ga0207681_10526044 3300025923 Bacteria 971
47 Ga0207428_10003325 3300027907 Bacteria 15631
48 Ga0207428_10073256 3300027907 Bacteria 2687
49 Ga0265319_1003808 3300028563 Bacteria 7728
50 Ga0265334_10001153 3300028573 Bacteria 12924
51 Ga0265318_10003535 3300028577 Bacteria 7827
52 Ga0265323_10000528 3300028653 Bacteria 21187
53 Ga0265322_10002277 3300028654 Bacteria 5944
54 Ga0265336_10000128 3300028666 Bacteria 55655
55 Ga0265338_10000119 3300028800 Bacteria 146599
56 Ga0265324_10000858 3300029957 Bacteria 19540
57 Ga0316177_1062613 3300030731 Bacteria 1168
58 Ga0265332_10008294 3300031238 Bacteria 4668
59 Ga0307509_10032014 3300031507 Bacteria 5798
60 Ga0307509_10090646 3300031507 Bacteria 3132
61 Ga0307408_100002838 3300031548 Bacteria 12017
62 Ga0307508_10000403 3300031616 Bacteria 51779
63 Ga0307516_10024267 3300031730 Bacteria 6196
64 Ga0307406_10168642 3300031901 Bacteria 1582
65 Ga0307412_10060516 3300031911 Bacteria 2542
66 Ga0307507_10023550 3300033179 Bacteria 6753
67 Ga0373943_0011857 3300035170 Bacteria 3922
68 Ga0373931_0000523 3300035691 Bacteria 15729
69 Ga0373935_0029455 3300035692 Bacteria 3398
70 Ga0373927_0235600 3300035695 Bacteria 1203
71 Ga0373947_0002842 3300035725 Bacteria 10333
72 Ga0395905_0066846 3300037471 Bacteria 3366
73 Ga0395905_0094353 3300037471 Bacteria 2807
74 Ga0395901_0212260 3300038443 Bacteria 2026
75 Ga0439466_0004586 3300041411 Bacteria 5307
76 Ga0439456_002615 3300042013 Bacteria 3625
77 Ga0439463_003687 3300042016 Bacteria 3860
78 Ga0450903_001319 3300042138 Bacteria 4638
79 Ga0439460_0000193 3300042461 Bacteria 11893
80 Ga0439440_0000340 3300042993 Bacteria 7718
81 Ga0466972_0000262 3300044658 Bacteria 34359
82 Ga0453683_0018716 3300044673 Bacteria 4442
83 Ga0453683_0588715 3300044673 Bacteria 725
84 Ga0453684_0584744 3300044712 Bacteria 1226
85 Ga0451576_0000057 3300045051 Bacteria 300798
86 Ga0451576_0004207 3300045051 Bacteria 18930
87 Ga0495617_000074 3300046452 Bacteria 80489
88 Ga0495617_037794 3300046452 Bacteria 1616
89 Ga0495603_0023643 3300046455 Bacteria 3717
90 Ga0495638_0000625 3300046460 Bacteria 39160
91 Ga0495638_0006081 3300046460 Bacteria 8834
92 Ga0495650_0000522 3300046471 Bacteria 56293
93 Ga0495580_0299768 3300046472 Bacteria 1094
94 Ga0495605_0007248 3300046474 Bacteria 6299
95 Ga0495605_0008813 3300046474 Bacteria 5688
96 Ga0495605_0010649 3300046474 Bacteria 5140
97 Ga0495639_0276218 3300046475 Bacteria 834
98 Ga0495584_0002175 3300046491 Bacteria 11179
99 Ga0495584_0016862 3300046491 Bacteria 3724
100 Ga0495584_0047380 3300046491 Bacteria 2167
101 Ga0495585_0046669 3300046492 Bacteria 2415
102 Ga0495585_0247383 3300046492 Bacteria 891
103 Ga0495596_0001120 3300046500 Bacteria 15849
104 Ga0495607_0000092 3300046501 Bacteria 93857
105 Ga0495607_0001626 3300046501 Bacteria 19473
106 Ga0495607_0009961 3300046501 Bacteria 6400
107 Ga0495607_0014201 3300046501 Bacteria 5194
108 Ga0495583_0001121 3300046506 Bacteria 29479
109 Ga0495583_0002534 3300046506 Bacteria 15449
110 Ga0495583_0003767 3300046506 Bacteria 11267
111 Ga0495583_0005386 3300046506 Bacteria 8713
112 Ga0495583_0153218 3300046506 Bacteria 954
113 Ga0495616_0006398 3300046513 Bacteria 7128
114 Ga0495616_0012245 3300046513 Bacteria 4877
115 Ga0495631_0070573 3300046518 Bacteria 1510
116 Ga0495632_0002828 3300046519 Bacteria 12843
117 Ga0495632_0012696 3300046519 Bacteria 4843
118 Ga0495637_0005591 3300046520 Bacteria 6381
119 Ga0495643_0003927 3300046522 Bacteria 10652
120 Ga0495643_0010131 3300046522 Bacteria 5812
121 Ga0495643_0037073 3300046522 Bacteria 2676
122 Ga0495644_0000006 3300046523 Bacteria 113088
123 Ga0495648_0004088 3300046524 Bacteria 12588
124 Ga0495648_0059556 3300046524 Bacteria 2277
125 Ga0495648_0096228 3300046524 Bacteria 1645
126 Ga0495642_0095375 3300046528 Bacteria 1262
127 Ga0495654_0000265 3300046530 Bacteria 47619
128 Ga0495654_0003979 3300046530 Bacteria 8897
129 Ga0495654_0011668 3300046530 Bacteria 4747
130 Ga0495665_0068578 3300046531 Bacteria 1870
131 Ga0495586_0037231 3300046535 Bacteria 2611
132 Ga0495609_0000655 3300046538 Bacteria 26899
133 Ga0495609_0006177 3300046538 Bacteria 6159
134 Ga0495609_0007489 3300046538 Bacteria 5444
135 Ga0495597_0003001 3300046542 Bacteria 10178
136 Ga0495597_0004653 3300046542 Bacteria 7466
137 Ga0495597_0006821 3300046542 Bacteria 5868
138 Ga0495668_0000438 3300046616 Bacteria 53335
139 Ga0495668_0002658 3300046616 Bacteria 14371
140 Ga0495611_0002029 3300046648 Bacteria 9564
141 Ga0495611_0011508 3300046648 Bacteria 3751
142 Ga0495625_0008294 3300046660 Bacteria 8878
143 Ga0495625_0299602 3300046660 Bacteria 1029
144 Ga0495661_0014665 3300046665 Bacteria 5247
145 Ga0495661_0023819 3300046665 Bacteria 3969
146 Ga0495661_0045099 3300046665 Bacteria 2698
147 Ga0495661_0133759 3300046665 Bacteria 1356
148 Ga0495647_0010562 3300046681 Bacteria 3145
149 Ga0495658_0083489 3300046683 Bacteria 1879
150 Ga0495670_0185192 3300046691 Bacteria 1100
151 Ga0495671_0004678 3300046692 Bacteria 8105
152 Ga0495671_0015501 3300046692 Bacteria 4081
153 Ga0495649_0000304 3300046694 Bacteria 43073
154 Ga0495649_0272916 3300046694 Bacteria 865
155 Ga0495589_0007239 3300046794 Bacteria 5812
156 Ga0495589_0121588 3300046794 Bacteria 1257
157 Ga0495660_0004621 3300046810 Bacteria 8303
158 Ga0495660_0009120 3300046810 Bacteria 5794
159 Ga0495636_0001816 3300047318 Bacteria 8165
160 Ga0495636_0003416 3300047318 Bacteria 6159
161 Ga0495636_0053240 3300047318 Bacteria 1699
162 Ga0495636_0114152 3300047318 Bacteria 1190
163 Ga0495672_0000352 3300047320 Bacteria 58759
164 Ga0495672_0001041 3300047320 Bacteria 28380
165 Ga0495672_0001626 3300047320 Bacteria 21880
166 Ga0495672_0001770 3300047320 Bacteria 20766
167 Ga0495672_0003517 3300047320 Bacteria 13351
168 Ga0495676_0303335 3300047321 Bacteria 1076
169 Ga0495683_0001681 3300047323 Bacteria 14074
170 Ga0495683_0003765 3300047323 Bacteria 8760
171 Ga0495687_003818 3300047443 Bacteria 10624
172 Ga0495687_006458 3300047443 Bacteria 7180
173 Ga0495687_078224 3300047443 Bacteria 1303
174 Ga0495687_082495 3300047443 Bacteria 1255
175 Ga0495677_0009323 3300047445 Bacteria 3627
176 Ga0495677_0030146 3300047445 Bacteria 1974
177 Ga0495677_0044191 3300047445 Bacteria 1633
178 Ga0495679_000581 3300047446 Bacteria 25231
179 Ga0495685_097528 3300047447 Bacteria 971
180 Ga0495673_0019442 3300047469 Bacteria 3402
181 Ga0495681_0041694 3300047470 Bacteria 2227
182 Ga0495681_0087985 3300047470 Bacteria 1376
183 Ga0495602_0021650 3300048088 Bacteria 6321
184 Ga0495626_0004608 3300048091 Bacteria 8400
185 Ga0495626_0008976 3300048091 Bacteria 5425
186 Ga0495626_0043574 3300048091 Bacteria 2104
187 Ga0496104_0056976 3300048907 Bacteria 3698
188 Ga0496113_0145293 3300048916 Bacteria 1868
189 Ga0496124_0001825 3300048927 Bacteria 29428
190 Ga0496125_0012569 3300048928 Bacteria 8391
191 Ga0495682_0007600 3300049460 Bacteria 4304
192 Ga0495682_0008818 3300049460 Bacteria 3962
193 Ga0495682_0031851 3300049460 Bacteria 1948
194 Ga0495682_0059453 3300049460 Bacteria 1381
195 Ga0501033_0724126 3300049570 Bacteria 676
196 Ga0501034_0000215 3300049571 Bacteria 110067
197 Ga0501075_0073693 3300049591 Bacteria 2582
198 Ga0501257_015649 3300049686 Bacteria 1754
199 Ga0501079_0011552 3300049741 Bacteria 6742
200 Ga0501080_0341340 3300049742 Bacteria 1353
201 Ga0501081_0004849 3300049743 Bacteria 8645
202 Ga0501045_0106600 3300049824 Bacteria 2077
203 nmdc:mga00v17_49666_c1 3300050491 Bacteria 2546
204 Ga0500635_0010337 3300053080 Bacteria 2617
205 Ga0500647_0014677 3300053091 Bacteria 3567
206 Ga0500566_0000005 3300053094 Bacteria 159299
207 Ga0500640_004232 3300053095 Bacteria 5181
208 Ga0500572_000016 3300053111 Bacteria 51017
209 Ga0500591_111914 3300053115 Bacteria 1142
210 Ga0500607_001066 3300053121 Bacteria 25835
211 Ga0500607_055910 3300053121 Bacteria 2085
212 Ga0500614_010721 3300053123 Bacteria 1972
213 Ga0500559_0005713 3300053136 Bacteria 5688
214 Ga0500559_0042999 3300053136 Bacteria 1973
215 Ga0500603_000422 3300053150 Bacteria 11002
216 Ga0500630_001011 3300053159 Bacteria 13149
217 Ga0500638_007824 3300053162 Bacteria 4509
218 Ga0500639_000106 3300053163 Bacteria 39379
219 Ga0500636_0000165 3300053177 Bacteria 34706
220 Ga0500637_0001366 3300053178 Bacteria 10358
221 Ga0500625_000601 3300053729 Bacteria 10274
222 Ga0500596_001860 3300053735 Bacteria 4241
223 Ga0500601_006187 3300053737 Bacteria 1318
224 Ga0530510_0072855 3300061734 Bacteria 2493

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044673 Ga0453683_0588715 Ga0453683_0588715_145_684 177
2 3300053080 Ga0500635_0010337 Ga0500635_0010337_1951_2586 191
3 3300033179 Ga0307507_10023550 Ga0307507_100235506 204
4 3300046524 Ga0495648_0004088 Ga0495648_0004088_6046_6675 204
5 3300053091 Ga0500647_0014677 Ga0500647_0014677_1820_2494 204
6 3300053094 Ga0500566_0000005 Ga0500566_0000005_73864_74538 204
7 3300053095 Ga0500640_004232 Ga0500640_004232_675_1349 204
8 3300053111 Ga0500572_000016 Ga0500572_000016_23761_24435 204
9 3300053115 Ga0500591_111914 Ga0500591_111914_139_813 204
10 3300053123 Ga0500614_010721 Ga0500614_010721_464_1138 204
11 3300053136 Ga0500559_0005713 Ga0500559_0005713_2294_2968 204
12 3300053150 Ga0500603_000422 Ga0500603_000422_8323_8997 204
13 3300053159 Ga0500630_001011 Ga0500630_001011_3156_3830 204
14 3300053162 Ga0500638_007824 Ga0500638_007824_3503_4177 204
15 3300053163 Ga0500639_000106 Ga0500639_000106_29386_30060 204
16 3300053735 Ga0500596_001860 Ga0500596_001860_756_1430 204
17 3300053737 Ga0500601_006187 Ga0500601_006187_563_1237 204
18 3300028563 Ga0265319_1003808 Ga0265319_10038085 205
19 3300028573 Ga0265334_10001153 Ga0265334_100011537 205
20 3300028577 Ga0265318_10003535 Ga0265318_100035353 205
21 3300028653 Ga0265323_10000528 Ga0265323_100005289 205
22 3300028654 Ga0265322_10002277 Ga0265322_100022774 205
23 3300028666 Ga0265336_10000128 Ga0265336_1000012818 205
24 3300028800 Ga0265338_10000119 Ga0265338_1000011918 205
25 3300029957 Ga0265324_10000858 Ga0265324_100008585 205
26 3300031616 Ga0307508_10000403 Ga0307508_100004038 205
27 3300031507 Ga0307509_10032014 Ga0307509_100320145 206
28 3300031507 Ga0307509_10090646 Ga0307509_100906462 206
29 3300031730 Ga0307516_10024267 Ga0307516_100242673 206
30 3300037471 Ga0395905_0094353 Ga0395905_0094353_863_1534 207
31 3300046530 Ga0495654_0011668 Ga0495654_0011668_1476_2099 207
32 3300046694 Ga0495649_0272916 Ga0495649_0272916_142_771 207
33 3300046522 Ga0495643_0037073 Ga0495643_0037073_2029_2655 208
34 3300005356 Ga0070674_100621634 Ga0070674_1006216342 209
35 3300035695 Ga0373927_0235600 Ga0373927_0235600_245_916 210
36 3300045051 Ga0451576_0000057 Ga0451576_0000057_193542_194207 210
37 3300006051 Ga0075364_10230315 Ga0075364_102303152 211
38 3300046501 Ga0495607_0009961 Ga0495607_0009961_2010_2666 211
39 iso_pu_bacteria 2998344455 2998346174 211
40 iso_pu_bacteria 2998344455 2998347324 211
41 3300003322 rootL2_10006443 rootL2_1000644313 212
42 3300003771 Ga0055526_1025044 Ga0055526_10250443 213
43 3300003773 Ga0055537_1009306 Ga0055537_10093063 213
44 3300025273 Ga0209673_1004945 Ga0209673_10049453 213
45 3300025295 Ga0209564_1009895 Ga0209564_10098954 213
46 3300005530 Ga0070679_100473060 Ga0070679_1004730602 215
47 3300044658 Ga0466972_0000262 Ga0466972_0000262_21685_22332 215
48 3300049570 Ga0501033_0724126 Ga0501033_0724126_13_660 215
49 iso_pu_bacteria 2596583598 2597031188 215
50 3300005435 Ga0070714_100197346 Ga0070714_1001973462 216
51 3300025263 Ga0209565_1004601 Ga0209565_10046015 216
52 3300025298 Ga0209050_1003185 Ga0209050_10031859 216
53 3300030731 Ga0316177_1062613 Ga0316177_10626132 216
54 3300038443 Ga0395901_0212260 Ga0395901_0212260_657_1310 216
55 3300044673 Ga0453683_0018716 Ga0453683_0018716_897_1547 216
56 3300045051 Ga0451576_0004207 Ga0451576_0004207_13910_14560 216
57 3300047318 Ga0495636_0001816 Ga0495636_0001816_7381_8031 216
58 3300047443 Ga0495687_082495 Ga0495687_082495_65_718 216
59 iso_pu_bacteria 2513237165 2514046055 216
60 iso_pu_bacteria 2596583598 2597031210 216
61 iso_pu_bacteria 2900577576 2900580767 216
62 iso_pu_bacteria 2901300506 2901302863 216
63 iso_pu_bacteria 2928058823 2928060680 216
64 iso_pu_bacteria 644736347 644749789 216
65 3300015261 Ga0182006_1003115 Ga0182006_10031158 217
66 3300015262 Ga0182007_10003998 Ga0182007_100039985 217
67 3300035691 Ga0373931_0000523 Ga0373931_0000523_10008_10664 217
68 3300037471 Ga0395905_0066846 Ga0395905_0066846_304_969 217
69 3300046491 Ga0495584_0002175 Ga0495584_0002175_8675_9334 217
70 3300046492 Ga0495585_0046669 Ga0495585_0046669_1291_1947 217
71 3300046500 Ga0495596_0001120 Ga0495596_0001120_3855_4514 217
72 3300046506 Ga0495583_0001121 Ga0495583_0001121_27134_27793 217
73 3300046506 Ga0495583_0002534 Ga0495583_0002534_3989_4648 217
74 3300046519 Ga0495632_0012696 Ga0495632_0012696_70_729 217
75 3300046520 Ga0495637_0005591 Ga0495637_0005591_397_1056 217
76 3300046524 Ga0495648_0059556 Ga0495648_0059556_925_1584 217
77 3300046528 Ga0495642_0095375 Ga0495642_0095375_439_1098 217
78 3300046538 Ga0495609_0000655 Ga0495609_0000655_20098_20757 217
79 3300046542 Ga0495597_0006821 Ga0495597_0006821_1535_2194 217
80 3300046616 Ga0495668_0002658 Ga0495668_0002658_2015_2674 217
81 3300046660 Ga0495625_0299602 Ga0495625_0299602_356_1015 217
82 3300046665 Ga0495661_0023819 Ga0495661_0023819_3016_3675 217
83 3300046794 Ga0495589_0121588 Ga0495589_0121588_467_1126 217
84 3300047320 Ga0495672_0000352 Ga0495672_0000352_50613_51272 217
85 3300047445 Ga0495677_0030146 Ga0495677_0030146_365_1024 217
86 3300047470 Ga0495681_0041694 Ga0495681_0041694_1414_2073 217
87 3300048091 Ga0495626_0004608 Ga0495626_0004608_1346_2005 217
88 3300061734 Ga0530510_0072855 Ga0530510_0072855_510_1166 217
89 3300003322 rootL2_10110878 rootL2_1011087814 218
90 3300005518 Ga0070699_100058405 Ga0070699_1000584055 218
91 3300005843 Ga0068860_100075107 Ga0068860_1000751075 218
92 3300025923 Ga0207681_10526044 Ga0207681_105260442 218
93 3300031238 Ga0265332_10008294 Ga0265332_100082944 218
94 3300042016 Ga0439463_003687 Ga0439463_003687_3007_3693 218
95 3300046810 Ga0495660_0009120 Ga0495660_0009120_3915_4580 218
96 3300048907 Ga0496104_0056976 Ga0496104_0056976_1675_2331 218
97 3300048916 Ga0496113_0145293 Ga0496113_0145293_596_1252 218
98 3300053121 Ga0500607_055910 Ga0500607_055910_1393_2055 218
99 3300053136 Ga0500559_0042999 Ga0500559_0042999_342_1004 218
100 3300053177 Ga0500636_0000165 Ga0500636_0000165_9471_10133 218
101 3300053178 Ga0500637_0001366 Ga0500637_0001366_9454_10116 218
102 3300053729 Ga0500625_000601 Ga0500625_000601_2928_3590 218
103 3300001979 JGI24740J21852_10000542 JGI24740J21852_100005423 219
104 3300031911 Ga0307412_10060516 Ga0307412_100605165 219
105 3300035170 Ga0373943_0011857 Ga0373943_0011857_2426_3094 219
106 3300035692 Ga0373935_0029455 Ga0373935_0029455_995_1663 219
107 3300035725 Ga0373947_0002842 Ga0373947_0002842_6741_7409 219
108 3300044712 Ga0453684_0584744 Ga0453684_0584744_362_1021 219
109 3300046452 Ga0495617_037794 Ga0495617_037794_515_1177 219
110 3300046455 Ga0495603_0023643 Ga0495603_0023643_548_1216 219
111 3300046472 Ga0495580_0299768 Ga0495580_0299768_10_678 219
112 3300046475 Ga0495639_0276218 Ga0495639_0276218_148_816 219
113 3300046491 Ga0495584_0016862 Ga0495584_0016862_508_1167 219
114 3300046492 Ga0495585_0247383 Ga0495585_0247383_212_874 219
115 3300046506 Ga0495583_0005386 Ga0495583_0005386_7339_8001 219
116 3300046506 Ga0495583_0153218 Ga0495583_0153218_268_927 219
117 3300046531 Ga0495665_0068578 Ga0495665_0068578_307_975 219
118 3300046535 Ga0495586_0037231 Ga0495586_0037231_1103_1771 219
119 3300046648 Ga0495611_0011508 Ga0495611_0011508_688_1350 219
120 3300046665 Ga0495661_0133759 Ga0495661_0133759_422_1081 219
121 3300046681 Ga0495647_0010562 Ga0495647_0010562_1746_2414 219
122 3300046683 Ga0495658_0083489 Ga0495658_0083489_481_1149 219
123 3300046691 Ga0495670_0185192 Ga0495670_0185192_10_672 219
124 3300046692 Ga0495671_0004678 Ga0495671_0004678_214_891 219
125 3300047318 Ga0495636_0053240 Ga0495636_0053240_525_1187 219
126 3300047318 Ga0495636_0114152 Ga0495636_0114152_223_882 219
127 3300047320 Ga0495672_0003517 Ga0495672_0003517_9227_9889 219
128 3300047321 Ga0495676_0303335 Ga0495676_0303335_209_877 219
129 3300047443 Ga0495687_003818 Ga0495687_003818_7339_8001 219
130 3300047443 Ga0495687_078224 Ga0495687_078224_138_797 219
131 3300047445 Ga0495677_0009323 Ga0495677_0009323_2540_3199 219
132 3300047445 Ga0495677_0044191 Ga0495677_0044191_262_924 219
133 3300047447 Ga0495685_097528 Ga0495685_097528_87_749 219
134 3300048088 Ga0495602_0021650 Ga0495602_0021650_838_1500 219
135 3300048091 Ga0495626_0043574 Ga0495626_0043574_876_1553 219
136 3300049460 Ga0495682_0007600 Ga0495682_0007600_359_1021 219
137 3300049591 Ga0501075_0073693 Ga0501075_0073693_781_1443 219
138 3300049686 Ga0501257_015649 Ga0501257_015649_21_680 219
139 3300049741 Ga0501079_0011552 Ga0501079_0011552_3641_4300 219
140 3300049742 Ga0501080_0341340 Ga0501080_0341340_363_1022 219
141 3300049743 Ga0501081_0004849 Ga0501081_0004849_2426_3085 219
142 3300049824 Ga0501045_0106600 Ga0501045_0106600_52_714 219
143 iso_pu_bacteria 2617270741 2617377157 219
144 iso_pu_bacteria 2824732956 2824734133 219
145 iso_pu_bacteria 2874604998 2874612462 219
146 iso_pu_bacteria 2876761206 2876765814 219
147 iso_pu_bacteria 2889033259 2889038926 219
148 iso_pu_bacteria 2908775508 2908783070 219
149 3300009553 Ga0105249_11296528 Ga0105249_112965281 220
150 3300025294 Ga0209025_1001215 Ga0209025_100121530 220
151 3300049571 Ga0501034_0000215 Ga0501034_0000215_42169_42837 220
152 3300046665 Ga0495661_0045099 Ga0495661_0045099_543_1229 221
153 3300005471 Ga0070698_100001575 Ga0070698_10000157512 222
154 3300053121 Ga0500607_001066 Ga0500607_001066_7493_8167 222
155 iso_pu_bacteria 2512047018 2512327291 222
156 iso_pu_bacteria 2582580891 2583792482 222
157 iso_pu_bacteria 8015687852 8015690861 222
158 iso_pu_bacteria 8055770955 8055774032 222
159 3300005985 Ga0081539_10031614 Ga0081539_100316142 223
160 3300021321 Ga0214542_1016372 Ga0214542_10163725 223
161 3300021324 Ga0214545_1018033 Ga0214545_10180334 223
162 3300021327 Ga0214543_1017681 Ga0214543_10176815 223
163 iso_pu_bacteria 2600254931 2600362946 224
164 3300003791 Ga0055530_10000007 Ga0055530_1000000772 226
165 3300003792 Ga0055540_1000990 Ga0055540_100099013 226
166 3300006058 Ga0075432_10002039 Ga0075432_100020394 226
167 3300025292 Ga0209676_1000003 Ga0209676_1000003610 226
168 3300025298 Ga0209050_1000004 Ga0209050_1000004592 226
169 3300025303 Ga0209051_1000006 Ga0209051_1000006383 226
170 3300027907 Ga0207428_10073256 Ga0207428_100732563 226
171 3300046460 Ga0495638_0000625 Ga0495638_0000625_30102_30785 227
172 3300046491 Ga0495584_0047380 Ga0495584_0047380_919_1602 227
173 3300046501 Ga0495607_0001626 Ga0495607_0001626_15759_16442 227
174 3300046513 Ga0495616_0012245 Ga0495616_0012245_103_786 227
175 3300046519 Ga0495632_0002828 Ga0495632_0002828_11028_11711 227
176 3300046523 Ga0495644_0000006 Ga0495644_0000006_60602_61285 227
177 3300046542 Ga0495597_0004653 Ga0495597_0004653_4917_5600 227
178 3300046692 Ga0495671_0015501 Ga0495671_0015501_1517_2200 227
179 3300046694 Ga0495649_0000304 Ga0495649_0000304_15765_16448 227
180 3300046810 Ga0495660_0004621 Ga0495660_0004621_5611_6294 227
181 3300047320 Ga0495672_0001770 Ga0495672_0001770_11660_12343 227
182 3300047323 Ga0495683_0001681 Ga0495683_0001681_10433_11116 227
183 3300048927 Ga0496124_0001825 Ga0496124_0001825_8852_9535 227
184 3300003578 Ga0006562J51391_1006314 Ga0006562J51391_10063143 228
185 3300006051 Ga0075364_10006225 Ga0075364_100062255 228
186 3300006058 Ga0075432_10013347 Ga0075432_100133472 228
187 3300006914 Ga0075436_100031615 Ga0075436_1000316153 228
188 3300017792 Ga0163161_10011618 Ga0163161_100116185 228
189 3300025735 Ga0207713_1007545 Ga0207713_10075455 228
190 3300027907 Ga0207428_10003325 Ga0207428_1000332510 228
191 3300031548 Ga0307408_100002838 Ga0307408_1000028388 228
192 3300031901 Ga0307406_10168642 Ga0307406_101686422 228
193 3300046452 Ga0495617_000074 Ga0495617_000074_19305_19991 228
194 3300046471 Ga0495650_0000522 Ga0495650_0000522_43543_44229 228
195 3300046474 Ga0495605_0008813 Ga0495605_0008813_3503_4189 228
196 3300046474 Ga0495605_0010649 Ga0495605_0010649_1263_1949 228
197 3300046501 Ga0495607_0000092 Ga0495607_0000092_38724_39410 228
198 3300046518 Ga0495631_0070573 Ga0495631_0070573_589_1275 228
199 3300046522 Ga0495643_0010131 Ga0495643_0010131_3627_4313 228
200 3300046530 Ga0495654_0000265 Ga0495654_0000265_33089_33775 228
201 3300046538 Ga0495609_0006177 Ga0495609_0006177_3627_4313 228
202 3300046648 Ga0495611_0002029 Ga0495611_0002029_7356_8042 228
203 3300046794 Ga0495589_0007239 Ga0495589_0007239_3627_4313 228
204 3300047318 Ga0495636_0003416 Ga0495636_0003416_1847_2533 228
205 3300047320 Ga0495672_0001041 Ga0495672_0001041_9940_10626 228
206 3300047320 Ga0495672_0001626 Ga0495672_0001626_19348_20034 228
207 3300047323 Ga0495683_0003765 Ga0495683_0003765_6816_7502 228
208 3300047443 Ga0495687_006458 Ga0495687_006458_1292_1978 228
209 3300047469 Ga0495673_0019442 Ga0495673_0019442_529_1215 228
210 3300049460 Ga0495682_0008818 Ga0495682_0008818_1777_2463 228
211 3300049460 Ga0495682_0031851 Ga0495682_0031851_1201_1887 228
212 3300050491 nmdc:mga00v17_49666_c1 nmdc:mga00v17_49666_c1_1088_1774 228
213 3300011119 Ga0105246_10365229 Ga0105246_103652292 235
214 3300013100 Ga0157373_10099087 Ga0157373_100990872 235
215 3300046460 Ga0495638_0006081 Ga0495638_0006081_3981_4742 242
216 3300046474 Ga0495605_0007248 Ga0495605_0007248_600_1361 242
217 3300046501 Ga0495607_0014201 Ga0495607_0014201_425_1186 242
218 3300046506 Ga0495583_0003767 Ga0495583_0003767_3282_4043 242
219 3300046513 Ga0495616_0006398 Ga0495616_0006398_3875_4636 242
220 3300046522 Ga0495643_0003927 Ga0495643_0003927_5610_6371 242
221 3300046524 Ga0495648_0096228 Ga0495648_0096228_281_1042 242
222 3300046530 Ga0495654_0003979 Ga0495654_0003979_684_1445 242
223 3300046538 Ga0495609_0007489 Ga0495609_0007489_1508_2269 242
224 3300046542 Ga0495597_0003001 Ga0495597_0003001_2072_2833 242
225 3300046616 Ga0495668_0000438 Ga0495668_0000438_14336_15097 242
226 3300046660 Ga0495625_0008294 Ga0495625_0008294_5487_6248 242
227 3300046665 Ga0495661_0014665 Ga0495661_0014665_3883_4644 242
228 3300047446 Ga0495679_000581 Ga0495679_000581_10597_11358 242
229 3300047470 Ga0495681_0087985 Ga0495681_0087985_180_941 242
230 3300048091 Ga0495626_0008976 Ga0495626_0008976_1528_2289 242
231 3300049460 Ga0495682_0059453 Ga0495682_0059453_541_1302 242
232 3300041411 Ga0439466_0004586 Ga0439466_0004586_4200_4958 252
233 3300042013 Ga0439456_002615 Ga0439456_002615_2127_2885 252
234 3300042138 Ga0450903_001319 Ga0450903_001319_3246_4004 252
235 3300042461 Ga0439460_0000193 Ga0439460_0000193_2019_2777 252
236 3300042993 Ga0439440_0000340 Ga0439440_0000340_2218_2976 252
237 2124908027 MRS2a_Contig_5565 MRS2a_00439130 256
238 3300009011 Ga0105251_10008031 Ga0105251_100080315 256
239 3300009036 Ga0105244_10056505 Ga0105244_100565053 256
240 3300013102 Ga0157371_10013899 Ga0157371_100138995 256
241 3300013306 Ga0163162_10077422 Ga0163162_100774222 256
242 3300013308 Ga0157375_10017376 Ga0157375_100173766 256
243 3300014497 Ga0182008_10024974 Ga0182008_100249743 256
244 3300048928 Ga0496125_0012569 Ga0496125_0012569_2285_3055 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04140

ICMT

Isoprenylcysteine carboxyl methyltransferase (ICMT) family

129

218

0.78

PF04191

PEMT

Phospholipid methyltransferase

128

222

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
4quv-assembly3.cif.gz_A structure of an integral membrane delta(14)-sterol reductase 0.7013 105 231
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.6837 128 231
4quv-assembly3.cif.gz_B structure of an integral membrane delta(14)-sterol reductase 0.4923 41 232
5vg9-assembly1.cif.gz_A structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase) without a monobody 0.4816 41 236
5v7p-assembly1.cif.gz_A atomic structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody 0.4652 30 236
ID Description Score Start End Superfamily
af_P71912_2_135_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8533 129 237 1.20.120.1630
af_Q9SI62_223_343_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8383 127 221 1.20.120.550
af_F1R5J9_127_285_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7812 110 230 1.20.120.1630
af_Q4D7B7_120_287_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7304 110 230 1.20.120.1630
af_I1KVX6_202_393_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7279 110 230 1.20.120.1630
ID Description Score Start End GO Terms
AF-N6ZA61-F1-model_v4 Protein-S-isoprenylcysteine methyltransferase 0.9754 133 235 GO:0004671
GO:0016020
GO:0032259
AF-A0A531K9X7-F1-model_v4 Isoprenylcysteine carboxylmethyltransferase family protein 0.9708 126 236 GO:0008168
GO:0012505
GO:0016020
GO:0032259
AF-A0A512LA56-F1-model_v4 Isoprenylcysteine carboxyl methyltransferase 0.9412 103 236 GO:0004671
GO:0016020
AF-A0A1F5E2K7-F1-model_v4 Steroid 5-alpha reductase C-terminal domain-containing protein 0.9409 127 230 GO:0004671
GO:0016020
AF-A0A4U8WMT9-F1-model_v4 Protein-S-isoprenylcysteine O-methyltransferase Ste14 0.9383 129 230 GO:0012505
GO:0016020

Feature Viewer

pLDDT pTM Quality
76.46 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map