F356287

General Info

Members Datasets Scaffolds Average Seq Length
244 160 488 200

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100146662|Ga0068867_1001466622
Length 218
Sequence MAIADDTRLNRGLTPRGRFITVEGIDGAGKSSHLEFLCEHVRAKGHGALLTREPGGTPTGERLRDVVLHQPMSPVAEALVMFGARSVHVTTMIEPALAAGTWVVCDRFSDSTYAYQCGGRGLERQAVSMLEALVHPNLQPDATFLFDLDPSIAYERQRAQSRTPDRFESEQAEFFVRVRNGYLDRARQHAYRFHVVDAAGSLEDVRTRLAAAFDKAFP

Samples

Sample ID Description Type Environment
1 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
107 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
121 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
122 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
123 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
157 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.46
Nodule 0
Rhizoplane 0.41
Rhizosphere 95.49
Stem 0
Stem Tuber 0
Unclassified 2.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068867_100146662 3300005459 Bacteria 1850
2 Ga0070658_10036515 3300005327 Bacteria 3960
3 Ga0070690_100225933 3300005330 Bacteria 1314
4 Ga0070677_10027146 3300005333 Bacteria 2153
5 Ga0070680_100090815 3300005336 Bacteria 2528
6 Ga0068868_100129113 3300005338 Bacteria 2067
7 Ga0068868_100330079 3300005338 Bacteria 1302
8 Ga0070660_100198529 3300005339 Bacteria 1627
9 Ga0070689_100017692 3300005340 Bacteria 5241
10 Ga0070689_100066115 3300005340 Bacteria 2817
11 Ga0070661_100347989 3300005344 Bacteria 1162
12 Ga0070661_100414561 3300005344 Bacteria 1067
13 Ga0070692_10097673 3300005345 Bacteria 1606
14 Ga0070675_100078316 3300005354 Bacteria 2752
15 Ga0070675_100113192 3300005354 Bacteria 2298
16 Ga0070675_100298881 3300005354 Bacteria 1418
17 Ga0070675_100447092 3300005354 Bacteria 1159
18 Ga0070671_100265459 3300005355 Bacteria 1459
19 Ga0070673_100205336 3300005364 Bacteria 1698
20 Ga0070688_100151532 3300005365 Bacteria 1585
21 Ga0070659_100786079 3300005366 Bacteria 827
22 Ga0070709_10041734 3300005434 Bacteria 2829
23 Ga0070714_100122567 3300005435 Bacteria 2314
24 Ga0070700_100172217 3300005441 Bacteria 1500
25 Ga0070700_100341234 3300005441 Bacteria 1107
26 Ga0070681_10111361 3300005458 Bacteria 2676
27 Ga0068867_100438179 3300005459 Bacteria 1110
28 Ga0070685_10264423 3300005466 Bacteria 1145
29 Ga0070699_100108119 3300005518 Bacteria 2441
30 Ga0070699_100371644 3300005518 Bacteria 1290
31 Ga0070679_100028128 3300005530 Bacteria 5540
32 Ga0070679_100173499 3300005530 Bacteria 2129
33 Ga0070679_100580071 3300005530 Bacteria 1065
34 Ga0070679_101237400 3300005530 Bacteria 692
35 Ga0070684_100518348 3300005535 Bacteria 1105
36 Ga0068853_100056533 3300005539 Bacteria 3384
37 Ga0068853_100428588 3300005539 Bacteria 1241
38 Ga0070672_100093672 3300005543 Bacteria 2427
39 Ga0070686_100402664 3300005544 Bacteria 1041
40 Ga0070696_100029980 3300005546 Bacteria 3721
41 Ga0070696_100285585 3300005546 Bacteria 1259
42 Ga0070693_100025254 3300005547 Bacteria 3196
43 Ga0070693_100071341 3300005547 Bacteria 2046
44 Ga0068855_100042384 3300005563 Bacteria 5393
45 Ga0068855_100072370 3300005563 Bacteria 4007
46 Ga0068855_100715203 3300005563 Bacteria 1071
47 Ga0068854_100115449 3300005578 Bacteria 2031
48 Ga0070702_100312824 3300005615 Bacteria 1091
49 Ga0068852_100005289 3300005616 Bacteria 9216
50 Ga0068852_100014867 3300005616 Bacteria 6014
51 Ga0068852_100201615 3300005616 Bacteria 1883
52 Ga0068852_100287979 3300005616 Bacteria 1586
53 Ga0068852_100421935 3300005616 Bacteria 1316
54 Ga0068859_100148609 3300005617 Bacteria 2419
55 Ga0068859_100301651 3300005617 Bacteria 1695
56 Ga0068864_100492502 3300005618 Bacteria 1178
57 Ga0068851_10003741 3300005834 Bacteria 6799
58 Ga0068870_10557822 3300005840 Bacteria 772
59 Ga0068863_100122542 3300005841 Bacteria 2480
60 Ga0068863_100260289 3300005841 Bacteria 1677
61 Ga0068858_100003702 3300005842 Bacteria 15141
62 Ga0068858_100062716 3300005842 Bacteria 3437
63 Ga0068858_100068078 3300005842 Bacteria 3299
64 Ga0068860_100344612 3300005843 Bacteria 1465
65 Ga0068860_100695494 3300005843 Bacteria 1026
66 Ga0075365_10322898 3300006038 Bacteria 1087
67 Ga0075367_10131412 3300006178 Bacteria 1548
68 Ga0097621_100009681 3300006237 Bacteria 7009
69 Ga0097621_100037072 3300006237 Bacteria 3903
70 Ga0097621_100320820 3300006237 Bacteria 1372
71 Ga0068871_100024343 3300006358 Bacteria 4694
72 Ga0068871_100057637 3300006358 Bacteria 3160
73 Ga0068871_100375950 3300006358 Bacteria 1261
74 Ga0075434_100274840 3300006871 Bacteria 1704
75 Ga0075434_100439325 3300006871 Bacteria 1326
76 Ga0075436_100000987 3300006914 Bacteria 19077
77 Ga0097620_100148601 3300006931 Bacteria 2419
78 Ga0097620_100301646 3300006931 Bacteria 1695
79 Ga0075435_100552534 3300007076 Bacteria 997
80 Ga0105240_10002905 3300009093 Bacteria 27041
81 Ga0105240_10232202 3300009093 Bacteria 2143
82 Ga0105240_10410010 3300009093 Bacteria 1524
83 Ga0105245_10010527 3300009098 Bacteria 8048
84 Ga0105245_10021160 3300009098 Bacteria 5704
85 Ga0105245_10154689 3300009098 Bacteria 2171
86 Ga0105245_10767999 3300009098 Bacteria 1000
87 Ga0105241_10013856 3300009174 Bacteria 5906
88 Ga0105242_10001746 3300009176 Bacteria 17183
89 Ga0105242_10525615 3300009176 Bacteria 1130
90 Ga0105248_10023978 3300009177 Bacteria 6783
91 Ga0105248_10180752 3300009177 Bacteria 2377
92 Ga0105248_10209058 3300009177 Bacteria 2199
93 Ga0105238_10035147 3300009551 Bacteria 5096
94 Ga0105238_10134561 3300009551 Bacteria 2450
95 Ga0157371_10666641 3300013102 Unclassified 777
96 Ga0157370_10004150 3300013104 Bacteria 16766
97 Ga0157369_10006999 3300013105 Bacteria 13013
98 Ga0157374_10019914 3300013296 Bacteria 5947
99 Ga0157378_10255885 3300013297 Bacteria 1678
100 Ga0157378_10369891 3300013297 Bacteria 1405
101 Ga0163162_10149919 3300013306 Bacteria 2449
102 Ga0163162_10700685 3300013306 Bacteria 1134
103 Ga0163162_10772393 3300013306 Bacteria 1079
104 Ga0157372_10001916 3300013307 Bacteria 22581
105 Ga0157372_10019000 3300013307 Bacteria 7397
106 Ga0157372_10353003 3300013307 Bacteria 1713
107 Ga0157375_10122725 3300013308 Bacteria 2709
108 Ga0163163_11185716 3300014325 Unclassified 826
109 Ga0157380_10904777 3300014326 Bacteria 909
110 Ga0157377_10002732 3300014745 Bacteria 7848
111 Ga0157379_10026889 3300014968 Bacteria 5122
112 Ga0157379_10109700 3300014968 Bacteria 2479
113 Ga0157379_10502659 3300014968 Bacteria 1124
114 Ga0157376_10133494 3300014969 Bacteria 2218
115 Ga0157376_11048831 3300014969 Bacteria 839
116 Ga0207692_10152284 3300025898 Bacteria 1325
117 Ga0207688_10016585 3300025901 Bacteria 3997
118 Ga0207699_10005566 3300025906 Bacteria 6041
119 Ga0207645_10175945 3300025907 Bacteria 1403
120 Ga0207705_10014620 3300025909 Bacteria 5648
121 Ga0207705_10204798 3300025909 Bacteria 1495
122 Ga0207707_10259115 3300025912 Bacteria 1509
123 Ga0207695_10002497 3300025913 Bacteria 27080
124 Ga0207695_10291636 3300025913 Bacteria 1524
125 Ga0207660_10085650 3300025917 Bacteria 2325
126 Ga0207662_10202405 3300025918 Bacteria 1286
127 Ga0207662_10271213 3300025918 Bacteria 1120
128 Ga0207662_10280670 3300025918 Bacteria 1102
129 Ga0207649_10092581 3300025920 Bacteria 1982
130 Ga0207652_10017077 3300025921 Bacteria 5936
131 Ga0207652_10074602 3300025921 Bacteria 2954
132 Ga0207652_10369415 3300025921 Bacteria 1295
133 Ga0207694_10173238 3300025924 Bacteria 1748
134 Ga0207694_10182264 3300025924 Bacteria 1703
135 Ga0207694_10481396 3300025924 Bacteria 1038
136 Ga0207694_10557495 3300025924 Bacteria 962
137 Ga0207659_10026814 3300025926 Bacteria 3893
138 Ga0207659_10099123 3300025926 Bacteria 2193
139 Ga0207687_10345561 3300025927 Bacteria 1211
140 Ga0207700_10685034 3300025928 Unclassified 915
141 Ga0207664_10465001 3300025929 Bacteria 1130
142 Ga0207664_10653660 3300025929 Bacteria 945
143 Ga0207690_10181266 3300025932 Bacteria 1586
144 Ga0207686_10017081 3300025934 Bacteria 4082
145 Ga0207670_10013626 3300025936 Bacteria 4800
146 Ga0207670_10074761 3300025936 Bacteria 2353
147 Ga0207670_10396312 3300025936 Bacteria 1103
148 Ga0207669_10070647 3300025937 Bacteria 2190
149 Ga0207704_10059066 3300025938 Bacteria 2365
150 Ga0207691_10272171 3300025940 Bacteria 1458
151 Ga0207711_10114372 3300025941 Bacteria 2403
152 Ga0207711_10215402 3300025941 Bacteria 1755
153 Ga0207689_10008792 3300025942 Bacteria 8778
154 Ga0207689_10109024 3300025942 Bacteria 2275
155 Ga0207661_10846519 3300025944 Bacteria 842
156 Ga0207667_10077992 3300025949 Bacteria 3434
157 Ga0207640_10102314 3300025981 Bacteria 2012
158 Ga0207640_10554423 3300025981 Bacteria 966
159 Ga0207677_10642162 3300026023 Bacteria 936
160 Ga0207703_10007668 3300026035 Bacteria 8553
161 Ga0207639_10052144 3300026041 Bacteria 3116
162 Ga0207639_10156745 3300026041 Bacteria 1914
163 Ga0207639_10864091 3300026041 Bacteria 845
164 Ga0207708_10081993 3300026075 Bacteria 2479
165 Ga0207708_10082951 3300026075 Bacteria 2464
166 Ga0207708_10334297 3300026075 Bacteria 1239
167 Ga0207708_10387151 3300026075 Bacteria 1154
168 Ga0207641_10725107 3300026088 Unclassified 980
169 Ga0207676_10245875 3300026095 Bacteria 1608
170 Ga0207683_10078381 3300026121 Bacteria 2927
171 Ga0207698_10017698 3300026142 Bacteria 4843
172 Ga0207698_10037967 3300026142 Bacteria 3553
173 Ga0207698_10062714 3300026142 Bacteria 2905
174 Ga0207698_10286411 3300026142 Bacteria 1526
175 Ga0265328_10001293 3300031239 Bacteria 11554
176 Ga0265328_10003603 3300031239 Bacteria 6831
177 Ga0265331_10000237 3300031250 Bacteria 66600
178 Ga0265331_10005085 3300031250 Bacteria 8031
179 Ga0265327_10000517 3300031251 Bacteria 66613
180 Ga0265327_10019851 3300031251 Bacteria 4115
181 Ga0265327_10092807 3300031251 Bacteria 1469
182 Ga0307408_100485698 3300031548 Bacteria 1078
183 Ga0316576_10069919 3300031727 Bacteria 2589
184 Ga0316578_10393797 3300031728 Unclassified 821
185 Ga0307405_10699556 3300031731 Bacteria 839
186 Ga0307413_10506505 3300031824 Bacteria 970
187 Ga0307412_10146047 3300031911 Bacteria 1739
188 Ga0307412_10232285 3300031911 Bacteria 1421
189 Ga0307412_10296477 3300031911 Bacteria 1276
190 Ga0307412_10304555 3300031911 Bacteria 1261
191 Ga0307416_100214990 3300032002 Bacteria 1838
192 Ga0307411_10079762 3300032005 Bacteria 2249
193 Ga0316574_0085099 3300035398 Bacteria 2012
194 Ga0373935_0206367 3300035692 Bacteria 1360
195 Ga0373937_0016063 3300036401 Bacteria 6641
196 Ga0316584_0085255 3300036712 Bacteria 2365
197 Ga0395900_0183335 3300037418 Bacteria 2126
198 Ga0395905_0129829 3300037471 Bacteria 2370
199 Ga0395901_0099914 3300038443 Bacteria 3043
200 Ga0400488_29660 3300038741 Bacteria 7958
201 Ga0400483_018446 3300039062 Bacteria 1784
202 Ga0400483_067063 3300039062 Bacteria 31217
203 Ga0400487_03286 3300039110 Bacteria 2043
204 Ga0451577_0179295 3300042876 Bacteria 1910
205 Ga0495592_0017802 3300046454 Bacteria 5401
206 Ga0495608_0028436 3300046511 Bacteria 3800
207 Ga0495618_0146578 3300046514 Bacteria 1509
208 Ga0495628_0167687 3300046516 Bacteria 1666
209 Ga0495587_0030820 3300046536 Bacteria 3251
210 Ga0495621_0064562 3300046539 Bacteria 1336
211 Ga0495645_0004110 3300046543 Bacteria 9941
212 Ga0495667_0113333 3300046559 Bacteria 1752
213 Ga0495635_0103790 3300046663 Bacteria 1942
214 Ga0495623_0114191 3300046679 Bacteria 1633
215 Ga0495670_0103384 3300046691 Bacteria 1469
216 Ga0495600_0027339 3300046809 Bacteria 3686
217 Ga0495604_0239044 3300047317 Bacteria 1243
218 Ga0495675_0376234 3300047444 Bacteria 831
219 Ga0495684_0020851 3300047471 Bacteria 5050
220 Ga0495602_0106266 3300048088 Bacteria 2292
221 Ga0496104_0008038 3300048907 Bacteria 9356
222 Ga0501034_0481880 3300049571 Bacteria 1156
223 Ga0501040_0344167 3300049576 Bacteria 1068
224 Ga0501047_0001153 3300049581 Bacteria 26233
225 Ga0501069_0001813 3300049585 Bacteria 10679
226 Ga0501070_0009668 3300049586 Bacteria 8154
227 Ga0501071_0183055 3300049587 Bacteria 1570
228 Ga0501073_0004424 3300049589 Bacteria 10561
229 Ga0501074_0001266 3300049590 Bacteria 16695
230 Ga0501079_0004022 3300049741 Bacteria 10880
231 Ga0501080_0002979 3300049742 Bacteria 14907
232 Ga0501044_0147075 3300049823 Bacteria 2341
233 Ga0501044_0467942 3300049823 Bacteria 1165
234 Ga0501045_0239682 3300049824 Bacteria 1350
235 nmdc:mga0yw44_452173_c1 3300050492 Bacteria 870
236 nmdc:mga0k408_12294_c1 3300050493 Bacteria 4677
237 nmdc:mga0k408_337638_c1 3300050493 Bacteria 898
238 nmdc:mga0k408_8372_c1 3300050493 Bacteria 5548
239 nmdc:mga0n895_64532_c1 3300050512 Bacteria 3622
240 nmdc:mga0rr50_788635_c1 3300050513 Bacteria 811
241 nmdc:mga08x19_2547_c1 3300050514 Bacteria 11078
242 nmdc:mga0a205_11677_c1 3300050515 Bacteria 8099
243 Ga0495601_0015613 3300053077 Bacteria 4591
244 Ga0530510_0408058 3300061734 Bacteria 1025
245 Ga0068867_100146662
246 Ga0070658_10036515
247 Ga0070690_100225933
248 Ga0070677_10027146
249 Ga0070680_100090815
250 Ga0068868_100129113
251 Ga0068868_100330079
252 Ga0070660_100198529
253 Ga0070689_100017692
254 Ga0070689_100066115
255 Ga0070661_100347989
256 Ga0070661_100414561
257 Ga0070692_10097673
258 Ga0070675_100078316
259 Ga0070675_100113192
260 Ga0070675_100298881
261 Ga0070675_100447092
262 Ga0070671_100265459
263 Ga0070673_100205336
264 Ga0070688_100151532
265 Ga0070659_100786079
266 Ga0070709_10041734
267 Ga0070714_100122567
268 Ga0070700_100172217
269 Ga0070700_100341234
270 Ga0070681_10111361
271 Ga0068867_100438179
272 Ga0070685_10264423
273 Ga0070699_100108119
274 Ga0070699_100371644
275 Ga0070679_100028128
276 Ga0070679_100173499
277 Ga0070679_100580071
278 Ga0070679_101237400
279 Ga0070684_100518348
280 Ga0068853_100056533
281 Ga0068853_100428588
282 Ga0070672_100093672
283 Ga0070686_100402664
284 Ga0070696_100029980
285 Ga0070696_100285585
286 Ga0070693_100025254
287 Ga0070693_100071341
288 Ga0068855_100042384
289 Ga0068855_100072370
290 Ga0068855_100715203
291 Ga0068854_100115449
292 Ga0070702_100312824
293 Ga0068852_100005289
294 Ga0068852_100014867
295 Ga0068852_100201615
296 Ga0068852_100287979
297 Ga0068852_100421935
298 Ga0068859_100148609
299 Ga0068859_100301651
300 Ga0068864_100492502
301 Ga0068851_10003741
302 Ga0068870_10557822
303 Ga0068863_100122542
304 Ga0068863_100260289
305 Ga0068858_100003702
306 Ga0068858_100062716
307 Ga0068858_100068078
308 Ga0068860_100344612
309 Ga0068860_100695494
310 Ga0075365_10322898
311 Ga0075367_10131412
312 Ga0097621_100009681
313 Ga0097621_100037072
314 Ga0097621_100320820
315 Ga0068871_100024343
316 Ga0068871_100057637
317 Ga0068871_100375950
318 Ga0075434_100274840
319 Ga0075434_100439325
320 Ga0075436_100000987
321 Ga0097620_100148601
322 Ga0097620_100301646
323 Ga0075435_100552534
324 Ga0105240_10002905
325 Ga0105240_10232202
326 Ga0105240_10410010
327 Ga0105245_10010527
328 Ga0105245_10021160
329 Ga0105245_10154689
330 Ga0105245_10767999
331 Ga0105241_10013856
332 Ga0105242_10001746
333 Ga0105242_10525615
334 Ga0105248_10023978
335 Ga0105248_10180752
336 Ga0105248_10209058
337 Ga0105238_10035147
338 Ga0105238_10134561
339 Ga0157371_10666641
340 Ga0157370_10004150
341 Ga0157369_10006999
342 Ga0157374_10019914
343 Ga0157378_10255885
344 Ga0157378_10369891
345 Ga0163162_10149919
346 Ga0163162_10700685
347 Ga0163162_10772393
348 Ga0157372_10001916
349 Ga0157372_10019000
350 Ga0157372_10353003
351 Ga0157375_10122725
352 Ga0163163_11185716
353 Ga0157380_10904777
354 Ga0157377_10002732
355 Ga0157379_10026889
356 Ga0157379_10109700
357 Ga0157379_10502659
358 Ga0157376_10133494
359 Ga0157376_11048831
360 Ga0207692_10152284
361 Ga0207688_10016585
362 Ga0207699_10005566
363 Ga0207645_10175945
364 Ga0207705_10014620
365 Ga0207705_10204798
366 Ga0207707_10259115
367 Ga0207695_10002497
368 Ga0207695_10291636
369 Ga0207660_10085650
370 Ga0207662_10202405
371 Ga0207662_10271213
372 Ga0207662_10280670
373 Ga0207649_10092581
374 Ga0207652_10017077
375 Ga0207652_10074602
376 Ga0207652_10369415
377 Ga0207694_10173238
378 Ga0207694_10182264
379 Ga0207694_10481396
380 Ga0207694_10557495
381 Ga0207659_10026814
382 Ga0207659_10099123
383 Ga0207687_10345561
384 Ga0207700_10685034
385 Ga0207664_10465001
386 Ga0207664_10653660
387 Ga0207690_10181266
388 Ga0207686_10017081
389 Ga0207670_10013626
390 Ga0207670_10074761
391 Ga0207670_10396312
392 Ga0207669_10070647
393 Ga0207704_10059066
394 Ga0207691_10272171
395 Ga0207711_10114372
396 Ga0207711_10215402
397 Ga0207689_10008792
398 Ga0207689_10109024
399 Ga0207661_10846519
400 Ga0207667_10077992
401 Ga0207640_10102314
402 Ga0207640_10554423
403 Ga0207677_10642162
404 Ga0207703_10007668
405 Ga0207639_10052144
406 Ga0207639_10156745
407 Ga0207639_10864091
408 Ga0207708_10081993
409 Ga0207708_10082951
410 Ga0207708_10334297
411 Ga0207708_10387151
412 Ga0207641_10725107
413 Ga0207676_10245875
414 Ga0207683_10078381
415 Ga0207698_10017698
416 Ga0207698_10037967
417 Ga0207698_10062714
418 Ga0207698_10286411
419 Ga0265328_10001293
420 Ga0265328_10003603
421 Ga0265331_10000237
422 Ga0265331_10005085
423 Ga0265327_10000517
424 Ga0265327_10019851
425 Ga0265327_10092807
426 Ga0307408_100485698
427 Ga0316576_10069919
428 Ga0316578_10393797
429 Ga0307405_10699556
430 Ga0307413_10506505
431 Ga0307412_10146047
432 Ga0307412_10232285
433 Ga0307412_10296477
434 Ga0307412_10304555
435 Ga0307416_100214990
436 Ga0307411_10079762
437 Ga0316574_0085099
438 Ga0373935_0206367
439 Ga0373937_0016063
440 Ga0316584_0085255
441 Ga0395900_0183335
442 Ga0395905_0129829
443 Ga0395901_0099914
444 Ga0400488_29660
445 Ga0400483_018446
446 Ga0400483_067063
447 Ga0400487_03286
448 Ga0451577_0179295
449 Ga0495592_0017802
450 Ga0495608_0028436
451 Ga0495618_0146578
452 Ga0495628_0167687
453 Ga0495587_0030820
454 Ga0495621_0064562
455 Ga0495645_0004110
456 Ga0495667_0113333
457 Ga0495635_0103790
458 Ga0495623_0114191
459 Ga0495670_0103384
460 Ga0495600_0027339
461 Ga0495604_0239044
462 Ga0495675_0376234
463 Ga0495684_0020851
464 Ga0495602_0106266
465 Ga0496104_0008038
466 Ga0501034_0481880
467 Ga0501040_0344167
468 Ga0501047_0001153
469 Ga0501069_0001813
470 Ga0501070_0009668
471 Ga0501071_0183055
472 Ga0501073_0004424
473 Ga0501074_0001266
474 Ga0501079_0004022
475 Ga0501080_0002979
476 Ga0501044_0147075
477 Ga0501044_0467942
478 Ga0501045_0239682
479 nmdc:mga0yw44_452173_c1
480 nmdc:mga0k408_12294_c1
481 nmdc:mga0k408_337638_c1
482 nmdc:mga0k408_8372_c1
483 nmdc:mga0n895_64532_c1
484 nmdc:mga0rr50_788635_c1
485 nmdc:mga08x19_2547_c1
486 nmdc:mga0a205_11677_c1
487 Ga0495601_0015613
488 Ga0530510_0408058

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02223

Thymidylate_kin

Thymidylate kinase

22

209

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xak-assembly1.cif.gz_A crystal structure (form ii) of thymidylate kinase from thermus thermophilus hb8 0.959 4 202
3hjn-assembly1.cif.gz_B crystal structure of thymidylate kinase in complex with dtdp and adp from thermotoga maritima 0.957 6 198
3hjn-assembly1.cif.gz_A crystal structure of thymidylate kinase in complex with dtdp and adp from thermotoga maritima 0.9567 6 201
5xak-assembly1.cif.gz_B crystal structure (form ii) of thymidylate kinase from thermus thermophilus hb8 0.955 4 202
5x8j-assembly1.cif.gz_A k16m mutant of thermus thermophilus hb8 thymidylate kinase 0.9544 4 205
ID Description Score Start End Superfamily
2pbrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9542 6 202 3.40.50.300
3lv8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9288 4 204 3.40.50.300
5x7jB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9285 4 205 3.40.50.300
2pbrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9259 6 202 3.40.50.300
2z0hB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9253 6 198 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3S2U673-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9857 2 204 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A2I6SAR0-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9828 3 203 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A537BJB9-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.982 1 202 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A2W4UMP0-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9813 2 202 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A3B9PLG0-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9812 2 204 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235

Map