F356203
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 244 | 185 | 243 | 85 |
Family's Representative Sequence
| Representative Sequence | 3300005335|Ga0070666_10796213|Ga0070666_107962131 |
| Length | 98 |
| Sequence | MTDSPCAHLDTITDAAPSSNGCEDCLRIGGHWMHLRRCTSCGHVGCCDSSPNRHATAHFHETGHPIVQSFEPGEDWLWCYADDVGFEIDSMMHSPAHT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 53 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 60 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 133 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 134 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 135 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 136 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 138 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 139 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 140 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 141 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 142 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 143 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 160 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 161 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 164 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 165 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 166 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 167 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 180 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 181 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.13 |
| Metatranscriptomes | 2.46 |
| Isolates | 0.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.82 |
| Nodule | 0 |
| Rhizoplane | 5.74 |
| Rhizosphere | 93.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24742J22300_10025483 | 3300002244 | Bacteria | 1022 |
| 2 | JGI25406J46586_10014452 | 3300003203 | Bacteria | 3356 |
| 3 | rootL2_10171375 | 3300003322 | Bacteria | 3983 |
| 4 | Ga0065704_10301597 | 3300005289 | Bacteria | 884 |
| 5 | Ga0065707_10362308 | 3300005295 | Bacteria | 902 |
| 6 | Ga0070683_101618152 | 3300005329 | Bacteria | 623 |
| 7 | Ga0070690_100350680 | 3300005330 | Bacteria | 1071 |
| 8 | Ga0070690_100903533 | 3300005330 | Bacteria | 691 |
| 9 | Ga0070670_100021992 | 3300005331 | Bacteria | 5487 |
| 10 | Ga0070677_10011382 | 3300005333 | Bacteria | 3067 |
| 11 | Ga0068869_100715556 | 3300005334 | Bacteria | 855 |
| 12 | Ga0070666_10206669 | 3300005335 | Bacteria | 1382 |
| 13 | Ga0070666_10796213 | 3300005335 | Bacteria | 696 |
| 14 | Ga0070680_100902019 | 3300005336 | Bacteria | 763 |
| 15 | Ga0070680_101006593 | 3300005336 | Bacteria | 720 |
| 16 | Ga0070680_101513171 | 3300005336 | Bacteria | 581 |
| 17 | Ga0070682_100007672 | 3300005337 | Bacteria | 6079 |
| 18 | Ga0068868_100306748 | 3300005338 | Bacteria | 1349 |
| 19 | Ga0070660_100008432 | 3300005339 | Bacteria | 7206 |
| 20 | Ga0070689_100478711 | 3300005340 | Bacteria | 1063 |
| 21 | Ga0070689_101473506 | 3300005340 | Bacteria | 616 |
| 22 | Ga0070668_100086549 | 3300005347 | Bacteria | 2464 |
| 23 | Ga0070668_100399997 | 3300005347 | Bacteria | 1172 |
| 24 | Ga0070669_100039529 | 3300005353 | Bacteria | 3428 |
| 25 | Ga0070675_100019436 | 3300005354 | Bacteria | 5414 |
| 26 | Ga0070674_100116985 | 3300005356 | Bacteria | 1967 |
| 27 | Ga0070667_100174492 | 3300005367 | Bacteria | 1899 |
| 28 | Ga0070709_11573008 | 3300005434 | Bacteria | 535 |
| 29 | Ga0070701_10267742 | 3300005438 | Bacteria | 1038 |
| 30 | Ga0070700_100119064 | 3300005441 | Bacteria | 1767 |
| 31 | Ga0070700_100511090 | 3300005441 | Bacteria | 926 |
| 32 | Ga0070700_100553642 | 3300005441 | Bacteria | 894 |
| 33 | Ga0070663_100092015 | 3300005455 | Bacteria | 2248 |
| 34 | Ga0070678_100032212 | 3300005456 | Bacteria | 3626 |
| 35 | Ga0070662_100019644 | 3300005457 | Bacteria | 4589 |
| 36 | Ga0070681_10057015 | 3300005458 | Bacteria | 3887 |
| 37 | Ga0068867_100030986 | 3300005459 | Bacteria | 3859 |
| 38 | Ga0070706_100001961 | 3300005467 | Bacteria | 21200 |
| 39 | Ga0070707_100930834 | 3300005468 | Bacteria | 834 |
| 40 | Ga0070698_100212615 | 3300005471 | Bacteria | 1868 |
| 41 | Ga0070698_100281864 | 3300005471 | Bacteria | 1593 |
| 42 | Ga0070699_100070901 | 3300005518 | Bacteria | 3030 |
| 43 | Ga0070699_100833532 | 3300005518 | Bacteria | 844 |
| 44 | Ga0070679_100317585 | 3300005530 | Bacteria | 1507 |
| 45 | Ga0070679_102040880 | 3300005530 | Bacteria | 523 |
| 46 | Ga0070697_100001000 | 3300005536 | Bacteria | 21314 |
| 47 | Ga0070672_100022469 | 3300005543 | Bacteria | 4634 |
| 48 | Ga0070665_100014159 | 3300005548 | Bacteria | 8014 |
| 49 | Ga0070704_100064682 | 3300005549 | Bacteria | 2630 |
| 50 | Ga0070664_101708114 | 3300005564 | Bacteria | 597 |
| 51 | Ga0068857_102530524 | 3300005577 | Bacteria | 504 |
| 52 | Ga0068856_102481403 | 3300005614 | Bacteria | 525 |
| 53 | Ga0068852_101805383 | 3300005616 | Bacteria | 634 |
| 54 | Ga0068859_101758968 | 3300005617 | Bacteria | 685 |
| 55 | Ga0068864_100038977 | 3300005618 | Bacteria | 4060 |
| 56 | Ga0068870_10136018 | 3300005840 | Bacteria | 1433 |
| 57 | Ga0068863_100003787 | 3300005841 | Bacteria | 14960 |
| 58 | Ga0068862_100137278 | 3300005844 | Bacteria | 2168 |
| 59 | Ga0068862_101892003 | 3300005844 | Bacteria | 606 |
| 60 | Ga0081539_10000788 | 3300005985 | Bacteria | 61718 |
| 61 | Ga0081539_10087308 | 3300005985 | Bacteria | 1621 |
| 62 | Ga0070712_100801909 | 3300006175 | Bacteria | 808 |
| 63 | Ga0070712_101484907 | 3300006175 | Bacteria | 592 |
| 64 | Ga0075428_100180506 | 3300006844 | Bacteria | 2285 |
| 65 | Ga0075428_100439233 | 3300006844 | Bacteria | 1398 |
| 66 | Ga0075428_101920797 | 3300006844 | Bacteria | 615 |
| 67 | Ga0075430_100587738 | 3300006846 | Bacteria | 919 |
| 68 | Ga0075431_100025033 | 3300006847 | Bacteria | 6119 |
| 69 | Ga0075431_100069284 | 3300006847 | Bacteria | 3639 |
| 70 | Ga0075434_101919421 | 3300006871 | Bacteria | 598 |
| 71 | Ga0075429_100362941 | 3300006880 | Bacteria | 1268 |
| 72 | Ga0068865_100044141 | 3300006881 | Bacteria | 3050 |
| 73 | Ga0075436_100061722 | 3300006914 | Bacteria | 2590 |
| 74 | Ga0097620_101758976 | 3300006931 | Bacteria | 685 |
| 75 | Ga0075435_100705543 | 3300007076 | Bacteria | 877 |
| 76 | Ga0075435_101723044 | 3300007076 | Bacteria | 550 |
| 77 | Ga0099795_10300940 | 3300007788 | Bacteria | 705 |
| 78 | Ga0111539_10143962 | 3300009094 | Bacteria | 2790 |
| 79 | Ga0105245_10433290 | 3300009098 | Bacteria | 1320 |
| 80 | Ga0105245_10673089 | 3300009098 | Bacteria | 1066 |
| 81 | Ga0105247_10325612 | 3300009101 | Bacteria | 1074 |
| 82 | Ga0114129_10046605 | 3300009147 | Bacteria | 6091 |
| 83 | Ga0114129_10506986 | 3300009147 | Bacteria | 1575 |
| 84 | Ga0105243_11539255 | 3300009148 | Bacteria | 690 |
| 85 | Ga0105238_12589153 | 3300009551 | Bacteria | 543 |
| 86 | Ga0105249_10181276 | 3300009553 | Bacteria | 2049 |
| 87 | Ga0105246_10377838 | 3300011119 | Bacteria | 1170 |
| 88 | Ga0157373_11417885 | 3300013100 | Bacteria | 528 |
| 89 | Ga0157369_10523983 | 3300013105 | Bacteria | 1226 |
| 90 | Ga0163162_10157068 | 3300013306 | Bacteria | 2395 |
| 91 | Ga0157372_12791187 | 3300013307 | Bacteria | 560 |
| 92 | Ga0157375_10002623 | 3300013308 | Bacteria | 15585 |
| 93 | Ga0163163_10007072 | 3300014325 | Bacteria | 9863 |
| 94 | Ga0157380_10027029 | 3300014326 | Bacteria | 4360 |
| 95 | Ga0157377_10147223 | 3300014745 | Bacteria | 1453 |
| 96 | Ga0157379_10493017 | 3300014968 | Bacteria | 1135 |
| 97 | Ga0163161_10019272 | 3300017792 | Bacteria | 4784 |
| 98 | Ga0224712_10514264 | 3300022467 | Bacteria | 579 |
| 99 | Ga0207656_10090925 | 3300025321 | Bacteria | 1385 |
| 100 | Ga0207682_10001705 | 3300025893 | Bacteria | 10055 |
| 101 | Ga0207688_10282052 | 3300025901 | Bacteria | 1012 |
| 102 | Ga0207688_10378149 | 3300025901 | Bacteria | 876 |
| 103 | Ga0207680_11152681 | 3300025903 | Bacteria | 553 |
| 104 | Ga0207647_10358916 | 3300025904 | Bacteria | 825 |
| 105 | Ga0207645_10057663 | 3300025907 | Bacteria | 2480 |
| 106 | Ga0207705_10149124 | 3300025909 | Bacteria | 1751 |
| 107 | Ga0207684_10006589 | 3300025910 | Bacteria | 10562 |
| 108 | Ga0207654_10574044 | 3300025911 | Bacteria | 803 |
| 109 | Ga0207707_10231201 | 3300025912 | Bacteria | 1609 |
| 110 | Ga0207707_10770477 | 3300025912 | Bacteria | 803 |
| 111 | Ga0207695_10182510 | 3300025913 | Bacteria | 2019 |
| 112 | Ga0207671_10126816 | 3300025914 | Bacteria | 1956 |
| 113 | Ga0207693_11382189 | 3300025915 | Bacteria | 523 |
| 114 | Ga0207660_11658950 | 3300025917 | Bacteria | 515 |
| 115 | Ga0207657_10003235 | 3300025919 | Bacteria | 17432 |
| 116 | Ga0207657_10005688 | 3300025919 | Bacteria | 13006 |
| 117 | Ga0207657_10731755 | 3300025919 | Bacteria | 767 |
| 118 | Ga0207649_11046778 | 3300025920 | Bacteria | 643 |
| 119 | Ga0207652_10727350 | 3300025921 | Bacteria | 884 |
| 120 | Ga0207652_11242744 | 3300025921 | Bacteria | 647 |
| 121 | Ga0207652_11542341 | 3300025921 | Bacteria | 568 |
| 122 | Ga0207646_11614454 | 3300025922 | Bacteria | 559 |
| 123 | Ga0207681_10114127 | 3300025923 | Bacteria | 1970 |
| 124 | Ga0207694_10146809 | 3300025924 | Unclassified | 1899 |
| 125 | Ga0207650_10022140 | 3300025925 | Bacteria | 4498 |
| 126 | Ga0207650_10928281 | 3300025925 | Bacteria | 739 |
| 127 | Ga0207659_10008730 | 3300025926 | Bacteria | 6308 |
| 128 | Ga0207664_11471377 | 3300025929 | Bacteria | 602 |
| 129 | Ga0207644_10570076 | 3300025931 | Bacteria | 938 |
| 130 | Ga0207690_10167919 | 3300025932 | Bacteria | 1641 |
| 131 | Ga0207690_10492751 | 3300025932 | Bacteria | 990 |
| 132 | Ga0207690_10511368 | 3300025932 | Bacteria | 972 |
| 133 | Ga0207706_10050747 | 3300025933 | Unclassified | 3666 |
| 134 | Ga0207706_10070633 | 3300025933 | Bacteria | 3071 |
| 135 | Ga0207686_10562958 | 3300025934 | Bacteria | 892 |
| 136 | Ga0207709_11071097 | 3300025935 | Bacteria | 661 |
| 137 | Ga0207670_10212851 | 3300025936 | Bacteria | 1475 |
| 138 | Ga0207670_10382748 | 3300025936 | Bacteria | 1121 |
| 139 | Ga0207669_10226841 | 3300025937 | Bacteria | 1375 |
| 140 | Ga0207669_10322512 | 3300025937 | Bacteria | 1183 |
| 141 | Ga0207665_10178612 | 3300025939 | Bacteria | 1536 |
| 142 | Ga0207691_10001286 | 3300025940 | Bacteria | 25022 |
| 143 | Ga0207689_10236787 | 3300025942 | Bacteria | 1509 |
| 144 | Ga0207689_11702482 | 3300025942 | Bacteria | 522 |
| 145 | Ga0207661_10147872 | 3300025944 | Bacteria | 2029 |
| 146 | Ga0207661_10594084 | 3300025944 | Bacteria | 1016 |
| 147 | Ga0207679_10152891 | 3300025945 | Bacteria | 1880 |
| 148 | Ga0207679_10431841 | 3300025945 | Bacteria | 1164 |
| 149 | Ga0207679_11036169 | 3300025945 | Bacteria | 752 |
| 150 | Ga0207651_11699875 | 3300025960 | Bacteria | 568 |
| 151 | Ga0207668_10028308 | 3300025972 | Bacteria | 3662 |
| 152 | Ga0207668_11277574 | 3300025972 | Bacteria | 660 |
| 153 | Ga0207640_10059033 | 3300025981 | Bacteria | 2530 |
| 154 | Ga0207640_10277979 | 3300025981 | Bacteria | 1314 |
| 155 | Ga0207640_10365059 | 3300025981 | Bacteria | 1165 |
| 156 | Ga0207658_10014259 | 3300025986 | Bacteria | 5442 |
| 157 | Ga0207658_10295432 | 3300025986 | Bacteria | 1394 |
| 158 | Ga0207677_10330366 | 3300026023 | Bacteria | 1270 |
| 159 | Ga0207677_10523931 | 3300026023 | Bacteria | 1028 |
| 160 | Ga0207677_11610918 | 3300026023 | Bacteria | 601 |
| 161 | Ga0207703_12202137 | 3300026035 | Bacteria | 527 |
| 162 | Ga0207678_10116831 | 3300026067 | Bacteria | 2276 |
| 163 | Ga0207708_10004525 | 3300026075 | Bacteria | 10228 |
| 164 | Ga0207708_10335715 | 3300026075 | Unclassified | 1237 |
| 165 | Ga0207702_10187998 | 3300026078 | Bacteria | 1906 |
| 166 | Ga0207641_10548121 | 3300026088 | Bacteria | 1127 |
| 167 | Ga0207641_10698284 | 3300026088 | Bacteria | 999 |
| 168 | Ga0207648_10125053 | 3300026089 | Bacteria | 2262 |
| 169 | Ga0207676_10004523 | 3300026095 | Bacteria | 9835 |
| 170 | Ga0207676_10185703 | 3300026095 | Bacteria | 1825 |
| 171 | Ga0207674_10025504 | 3300026116 | Bacteria | 6303 |
| 172 | Ga0207674_10028831 | 3300026116 | Bacteria | 5852 |
| 173 | Ga0207674_10332525 | 3300026116 | Bacteria | 1469 |
| 174 | Ga0207674_11050595 | 3300026116 | Bacteria | 784 |
| 175 | Ga0207675_100283608 | 3300026118 | Bacteria | 1610 |
| 176 | Ga0207683_10003401 | 3300026121 | Bacteria | 13851 |
| 177 | Ga0209179_1029931 | 3300027512 | Bacteria | 1111 |
| 178 | Ga0268264_10504692 | 3300028381 | Bacteria | 1180 |
| 179 | Ga0265760_10027698 | 3300031090 | Bacteria | 1661 |
| 180 | Ga0307407_11020693 | 3300031903 | Bacteria | 640 |
| 181 | Ga0373938_0168790 | 3300034957 | Bacteria | 592 |
| 182 | Ga0373939_0363599 | 3300035114 | Bacteria | 592 |
| 183 | Ga0373937_0527934 | 3300036401 | Bacteria | 1121 |
| 184 | Ga0395900_1794373 | 3300037418 | Bacteria | 524 |
| 185 | Ga0395905_0175221 | 3300037471 | Bacteria | 2014 |
| 186 | Ga0242420_015565 | 3300038996 | Bacteria | 1316 |
| 187 | Ga0436360_1208270 | 3300039438 | Unclassified | 985 |
| 188 | Ga0439435_0183745 | 3300042436 | Bacteria | 684 |
| 189 | Ga0451577_1904154 | 3300042876 | Bacteria | 521 |
| 190 | Ga0495590_0357279 | 3300046457 | Bacteria | 556 |
| 191 | Ga0495580_0790115 | 3300046472 | Bacteria | 616 |
| 192 | Ga0495594_0419631 | 3300046499 | Bacteria | 761 |
| 193 | Ga0495608_0196157 | 3300046511 | Bacteria | 1274 |
| 194 | Ga0495665_0506371 | 3300046531 | Bacteria | 608 |
| 195 | Ga0495587_0305779 | 3300046536 | Bacteria | 889 |
| 196 | Ga0495635_0087639 | 3300046663 | Bacteria | 2130 |
| 197 | Ga0495657_0755399 | 3300046675 | Bacteria | 557 |
| 198 | Ga0495647_0029678 | 3300046681 | Bacteria | 2024 |
| 199 | Ga0495658_0021359 | 3300046683 | Bacteria | 3412 |
| 200 | Ga0495669_0390650 | 3300046684 | Bacteria | 674 |
| 201 | Ga0495669_0480832 | 3300046684 | Unclassified | 604 |
| 202 | Ga0495600_0283664 | 3300046809 | Bacteria | 1048 |
| 203 | Ga0495674_0477705 | 3300047319 | Bacteria | 999 |
| 204 | Ga0495602_1170391 | 3300048088 | Bacteria | 502 |
| 205 | Ga0496100_0202367 | 3300048903 | Bacteria | 1448 |
| 206 | Ga0496101_0228486 | 3300048904 | Bacteria | 1446 |
| 207 | Ga0496102_0463921 | 3300048905 | Bacteria | 1187 |
| 208 | Ga0496106_0178591 | 3300048909 | Bacteria | 1685 |
| 209 | Ga0496108_0757418 | 3300048911 | Bacteria | 840 |
| 210 | Ga0496108_0803763 | 3300048911 | Bacteria | 811 |
| 211 | Ga0496109_0152696 | 3300048912 | Bacteria | 2162 |
| 212 | Ga0496109_0455028 | 3300048912 | Bacteria | 1209 |
| 213 | Ga0496110_0284595 | 3300048913 | Bacteria | 1506 |
| 214 | Ga0496110_0856028 | 3300048913 | Bacteria | 814 |
| 215 | Ga0496111_0200549 | 3300048914 | Bacteria | 1483 |
| 216 | Ga0496111_0633694 | 3300048914 | Bacteria | 781 |
| 217 | Ga0496112_0022663 | 3300048915 | Bacteria | 5989 |
| 218 | Ga0496113_0937302 | 3300048916 | Bacteria | 684 |
| 219 | Ga0501040_0919356 | 3300049576 | Bacteria | 634 |
| 220 | Ga0501071_0264058 | 3300049587 | Bacteria | 1300 |
| 221 | Ga0501072_0058474 | 3300049588 | Bacteria | 3039 |
| 222 | Ga0501075_0412068 | 3300049591 | Bacteria | 1030 |
| 223 | Ga0501075_0438857 | 3300049591 | Bacteria | 996 |
| 224 | nmdc:mga05p37_1098915_c1 | 3300050507 | Bacteria | 833 |
| 225 | nmdc:mga05p37_9937_c1 | 3300050507 | Bacteria | 11297 |
| 226 | nmdc:mga08y16_79383_c1 | 3300050511 | Bacteria | 3420 |
| 227 | nmdc:mga0n895_190907_c1 | 3300050512 | Bacteria | 2079 |
| 228 | nmdc:mga0n895_1971553_c1 | 3300050512 | Bacteria | 542 |
| 229 | nmdc:mga0n895_664342_c1 | 3300050512 | Bacteria | 1040 |
| 230 | nmdc:mga0n895_755661_c1 | 3300050512 | Bacteria | 965 |
| 231 | nmdc:mga0rr50_682167_c1 | 3300050513 | Bacteria | 877 |
| 232 | nmdc:mga0a205_30717_c1 | 3300050515 | Bacteria | 5146 |
| 233 | Ga0495612_0098428 | 3300053078 | Bacteria | 1244 |
| 234 | Ga0495612_0567665 | 3300053078 | Bacteria | 523 |
| 235 | Ga0495595_0587066 | 3300053084 | Bacteria | 569 |
| 236 | Ga0495619_0098738 | 3300053085 | Bacteria | 1985 |
| 237 | Ga0500616_0002451 | 3300053153 | Bacteria | 15418 |
| 238 | Ga0500637_0133132 | 3300053178 | Bacteria | 1441 |
| 239 | Ga0587073_0048976 | 3300059492 | Bacteria | 951 |
| 240 | Ga0587082_073552 | 3300059504 | Bacteria | 699 |
| 241 | Ga0587083_0104078 | 3300059505 | Bacteria | 711 |
| 242 | Ga0587075_091992 | 3300059644 | Bacteria | 594 |
| 243 | Ga0530510_0892169 | 3300061734 | Bacteria | 679 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003322 | rootL2_10171375 | rootL2_101713756 | 74 |
| 2 | 3300007788 | Ga0099795_10300940 | Ga0099795_103009402 | 78 |
| 3 | iso_pu_bacteria | 2675903060 | 2676490892 | 80 |
| 4 | 3300005336 | Ga0070680_101513171 | Ga0070680_1015131712 | 82 |
| 5 | 3300005340 | Ga0070689_101473506 | Ga0070689_1014735061 | 82 |
| 6 | 3300005471 | Ga0070698_100212615 | Ga0070698_1002126151 | 82 |
| 7 | 3300005549 | Ga0070704_100064682 | Ga0070704_1000646824 | 82 |
| 8 | 3300006175 | Ga0070712_101484907 | Ga0070712_1014849072 | 82 |
| 9 | 3300025917 | Ga0207660_11658950 | Ga0207660_116589502 | 82 |
| 10 | 3300025921 | Ga0207652_11242744 | Ga0207652_112427442 | 82 |
| 11 | 3300050512 | nmdc:mga0n895_1971553_c1 | nmdc:mga0n895_1971553_c1_182_430 | 82 |
| 12 | 3300003203 | JGI25406J46586_10014452 | JGI25406J46586_100144523 | 83 |
| 13 | 3300005289 | Ga0065704_10301597 | Ga0065704_103015972 | 83 |
| 14 | 3300005295 | Ga0065707_10362308 | Ga0065707_103623082 | 83 |
| 15 | 3300005438 | Ga0070701_10267742 | Ga0070701_102677423 | 83 |
| 16 | 3300005441 | Ga0070700_100511090 | Ga0070700_1005110901 | 83 |
| 17 | 3300005985 | Ga0081539_10000788 | Ga0081539_1000078839 | 83 |
| 18 | 3300006844 | Ga0075428_100180506 | Ga0075428_1001805062 | 83 |
| 19 | 3300006844 | Ga0075428_101920797 | Ga0075428_1019207972 | 83 |
| 20 | 3300006846 | Ga0075430_100587738 | Ga0075430_1005877381 | 83 |
| 21 | 3300006847 | Ga0075431_100025033 | Ga0075431_1000250335 | 83 |
| 22 | 3300006847 | Ga0075431_100069284 | Ga0075431_1000692841 | 83 |
| 23 | 3300006880 | Ga0075429_100362941 | Ga0075429_1003629412 | 83 |
| 24 | 3300006914 | Ga0075436_100061722 | Ga0075436_1000617221 | 83 |
| 25 | 3300009147 | Ga0114129_10046605 | Ga0114129_100466055 | 83 |
| 26 | 3300009147 | Ga0114129_10506986 | Ga0114129_105069863 | 83 |
| 27 | 3300042436 | Ga0439435_0183745 | Ga0439435_0183745_408_659 | 83 |
| 28 | 3300050507 | nmdc:mga05p37_1098915_c1 | nmdc:mga05p37_1098915_c1_322_579 | 83 |
| 29 | 3300050507 | nmdc:mga05p37_9937_c1 | nmdc:mga05p37_9937_c1_10002_10253 | 83 |
| 30 | 3300050512 | nmdc:mga0n895_755661_c1 | nmdc:mga0n895_755661_c1_407_658 | 83 |
| 31 | 3300053078 | Ga0495612_0098428 | Ga0495612_0098428_260_511 | 83 |
| 32 | 3300053178 | Ga0500637_0133132 | Ga0500637_0133132_53_304 | 83 |
| 33 | 3300061734 | Ga0530510_0892169 | Ga0530510_0892169_165_416 | 83 |
| 34 | 3300002244 | JGI24742J22300_10025483 | JGI24742J22300_100254833 | 84 |
| 35 | 3300005329 | Ga0070683_101618152 | Ga0070683_1016181521 | 84 |
| 36 | 3300005330 | Ga0070690_100350680 | Ga0070690_1003506802 | 84 |
| 37 | 3300005330 | Ga0070690_100903533 | Ga0070690_1009035332 | 84 |
| 38 | 3300005331 | Ga0070670_100021992 | Ga0070670_1000219922 | 84 |
| 39 | 3300005333 | Ga0070677_10011382 | Ga0070677_100113825 | 84 |
| 40 | 3300005334 | Ga0068869_100715556 | Ga0068869_1007155561 | 84 |
| 41 | 3300005335 | Ga0070666_10206669 | Ga0070666_102066692 | 84 |
| 42 | 3300005335 | Ga0070666_10796213 | Ga0070666_107962131 | 84 |
| 43 | 3300005336 | Ga0070680_100902019 | Ga0070680_1009020192 | 84 |
| 44 | 3300005336 | Ga0070680_101006593 | Ga0070680_1010065932 | 84 |
| 45 | 3300005337 | Ga0070682_100007672 | Ga0070682_1000076728 | 84 |
| 46 | 3300005338 | Ga0068868_100306748 | Ga0068868_1003067482 | 84 |
| 47 | 3300005339 | Ga0070660_100008432 | Ga0070660_1000084325 | 84 |
| 48 | 3300005340 | Ga0070689_100478711 | Ga0070689_1004787112 | 84 |
| 49 | 3300005347 | Ga0070668_100086549 | Ga0070668_1000865492 | 84 |
| 50 | 3300005347 | Ga0070668_100399997 | Ga0070668_1003999973 | 84 |
| 51 | 3300005353 | Ga0070669_100039529 | Ga0070669_1000395291 | 84 |
| 52 | 3300005354 | Ga0070675_100019436 | Ga0070675_1000194363 | 84 |
| 53 | 3300005356 | Ga0070674_100116985 | Ga0070674_1001169852 | 84 |
| 54 | 3300005367 | Ga0070667_100174492 | Ga0070667_1001744922 | 84 |
| 55 | 3300005434 | Ga0070709_11573008 | Ga0070709_115730082 | 84 |
| 56 | 3300005441 | Ga0070700_100119064 | Ga0070700_1001190642 | 84 |
| 57 | 3300005441 | Ga0070700_100553642 | Ga0070700_1005536422 | 84 |
| 58 | 3300005455 | Ga0070663_100092015 | Ga0070663_1000920153 | 84 |
| 59 | 3300005456 | Ga0070678_100032212 | Ga0070678_1000322124 | 84 |
| 60 | 3300005457 | Ga0070662_100019644 | Ga0070662_1000196445 | 84 |
| 61 | 3300005458 | Ga0070681_10057015 | Ga0070681_100570155 | 84 |
| 62 | 3300005459 | Ga0068867_100030986 | Ga0068867_1000309861 | 84 |
| 63 | 3300005467 | Ga0070706_100001961 | Ga0070706_10000196112 | 84 |
| 64 | 3300005468 | Ga0070707_100930834 | Ga0070707_1009308342 | 84 |
| 65 | 3300005471 | Ga0070698_100281864 | Ga0070698_1002818642 | 84 |
| 66 | 3300005518 | Ga0070699_100070901 | Ga0070699_1000709012 | 84 |
| 67 | 3300005518 | Ga0070699_100833532 | Ga0070699_1008335322 | 84 |
| 68 | 3300005530 | Ga0070679_100317585 | Ga0070679_1003175852 | 84 |
| 69 | 3300005530 | Ga0070679_102040880 | Ga0070679_1020408801 | 84 |
| 70 | 3300005536 | Ga0070697_100001000 | Ga0070697_1000010008 | 84 |
| 71 | 3300005543 | Ga0070672_100022469 | Ga0070672_1000224694 | 84 |
| 72 | 3300005548 | Ga0070665_100014159 | Ga0070665_10001415910 | 84 |
| 73 | 3300005564 | Ga0070664_101708114 | Ga0070664_1017081142 | 84 |
| 74 | 3300005577 | Ga0068857_102530524 | Ga0068857_1025305242 | 84 |
| 75 | 3300005614 | Ga0068856_102481403 | Ga0068856_1024814032 | 84 |
| 76 | 3300005616 | Ga0068852_101805383 | Ga0068852_1018053832 | 84 |
| 77 | 3300005617 | Ga0068859_101758968 | Ga0068859_1017589682 | 84 |
| 78 | 3300005618 | Ga0068864_100038977 | Ga0068864_1000389772 | 84 |
| 79 | 3300005840 | Ga0068870_10136018 | Ga0068870_101360182 | 84 |
| 80 | 3300005841 | Ga0068863_100003787 | Ga0068863_10000378712 | 84 |
| 81 | 3300005844 | Ga0068862_100137278 | Ga0068862_1001372781 | 84 |
| 82 | 3300005844 | Ga0068862_101892003 | Ga0068862_1018920032 | 84 |
| 83 | 3300005985 | Ga0081539_10087308 | Ga0081539_100873083 | 84 |
| 84 | 3300006175 | Ga0070712_100801909 | Ga0070712_1008019092 | 84 |
| 85 | 3300006844 | Ga0075428_100439233 | Ga0075428_1004392332 | 84 |
| 86 | 3300006871 | Ga0075434_101919421 | Ga0075434_1019194212 | 84 |
| 87 | 3300006881 | Ga0068865_100044141 | Ga0068865_1000441415 | 84 |
| 88 | 3300006931 | Ga0097620_101758976 | Ga0097620_1017589762 | 84 |
| 89 | 3300007076 | Ga0075435_100705543 | Ga0075435_1007055432 | 84 |
| 90 | 3300007076 | Ga0075435_101723044 | Ga0075435_1017230441 | 84 |
| 91 | 3300009094 | Ga0111539_10143962 | Ga0111539_101439622 | 84 |
| 92 | 3300009098 | Ga0105245_10433290 | Ga0105245_104332902 | 84 |
| 93 | 3300009098 | Ga0105245_10673089 | Ga0105245_106730892 | 84 |
| 94 | 3300009101 | Ga0105247_10325612 | Ga0105247_103256122 | 84 |
| 95 | 3300009148 | Ga0105243_11539255 | Ga0105243_115392551 | 84 |
| 96 | 3300009551 | Ga0105238_12589153 | Ga0105238_125891532 | 84 |
| 97 | 3300009553 | Ga0105249_10181276 | Ga0105249_101812762 | 84 |
| 98 | 3300011119 | Ga0105246_10377838 | Ga0105246_103778382 | 84 |
| 99 | 3300013100 | Ga0157373_11417885 | Ga0157373_114178852 | 84 |
| 100 | 3300013105 | Ga0157369_10523983 | Ga0157369_105239831 | 84 |
| 101 | 3300013306 | Ga0163162_10157068 | Ga0163162_101570681 | 84 |
| 102 | 3300013307 | Ga0157372_12791187 | Ga0157372_127911872 | 84 |
| 103 | 3300013308 | Ga0157375_10002623 | Ga0157375_100026235 | 84 |
| 104 | 3300014325 | Ga0163163_10007072 | Ga0163163_100070722 | 84 |
| 105 | 3300014326 | Ga0157380_10027029 | Ga0157380_100270293 | 84 |
| 106 | 3300014745 | Ga0157377_10147223 | Ga0157377_101472233 | 84 |
| 107 | 3300014968 | Ga0157379_10493017 | Ga0157379_104930172 | 84 |
| 108 | 3300017792 | Ga0163161_10019272 | Ga0163161_100192725 | 84 |
| 109 | 3300022467 | Ga0224712_10514264 | Ga0224712_105142641 | 84 |
| 110 | 3300025321 | Ga0207656_10090925 | Ga0207656_100909252 | 84 |
| 111 | 3300025893 | Ga0207682_10001705 | Ga0207682_1000170511 | 84 |
| 112 | 3300025901 | Ga0207688_10282052 | Ga0207688_102820523 | 84 |
| 113 | 3300025901 | Ga0207688_10378149 | Ga0207688_103781492 | 84 |
| 114 | 3300025903 | Ga0207680_11152681 | Ga0207680_111526812 | 84 |
| 115 | 3300025904 | Ga0207647_10358916 | Ga0207647_103589162 | 84 |
| 116 | 3300025907 | Ga0207645_10057663 | Ga0207645_100576633 | 84 |
| 117 | 3300025909 | Ga0207705_10149124 | Ga0207705_101491242 | 84 |
| 118 | 3300025910 | Ga0207684_10006589 | Ga0207684_100065896 | 84 |
| 119 | 3300025911 | Ga0207654_10574044 | Ga0207654_105740442 | 84 |
| 120 | 3300025912 | Ga0207707_10231201 | Ga0207707_102312012 | 84 |
| 121 | 3300025912 | Ga0207707_10770477 | Ga0207707_107704772 | 84 |
| 122 | 3300025913 | Ga0207695_10182510 | Ga0207695_101825102 | 84 |
| 123 | 3300025914 | Ga0207671_10126816 | Ga0207671_101268163 | 84 |
| 124 | 3300025915 | Ga0207693_11382189 | Ga0207693_113821892 | 84 |
| 125 | 3300025919 | Ga0207657_10003235 | Ga0207657_1000323513 | 84 |
| 126 | 3300025919 | Ga0207657_10005688 | Ga0207657_1000568814 | 84 |
| 127 | 3300025919 | Ga0207657_10731755 | Ga0207657_107317551 | 84 |
| 128 | 3300025920 | Ga0207649_11046778 | Ga0207649_110467782 | 84 |
| 129 | 3300025921 | Ga0207652_10727350 | Ga0207652_107273501 | 84 |
| 130 | 3300025921 | Ga0207652_11542341 | Ga0207652_115423411 | 84 |
| 131 | 3300025922 | Ga0207646_11614454 | Ga0207646_116144541 | 84 |
| 132 | 3300025923 | Ga0207681_10114127 | Ga0207681_101141272 | 84 |
| 133 | 3300025924 | Ga0207694_10146809 | Ga0207694_101468092 | 84 |
| 134 | 3300025925 | Ga0207650_10022140 | Ga0207650_100221403 | 84 |
| 135 | 3300025925 | Ga0207650_10928281 | Ga0207650_109282811 | 84 |
| 136 | 3300025926 | Ga0207659_10008730 | Ga0207659_100087305 | 84 |
| 137 | 3300025929 | Ga0207664_11471377 | Ga0207664_114713772 | 84 |
| 138 | 3300025931 | Ga0207644_10570076 | Ga0207644_105700762 | 84 |
| 139 | 3300025932 | Ga0207690_10167919 | Ga0207690_101679191 | 84 |
| 140 | 3300025932 | Ga0207690_10492751 | Ga0207690_104927512 | 84 |
| 141 | 3300025932 | Ga0207690_10511368 | Ga0207690_105113682 | 84 |
| 142 | 3300025933 | Ga0207706_10050747 | Ga0207706_100507472 | 84 |
| 143 | 3300025933 | Ga0207706_10070633 | Ga0207706_100706332 | 84 |
| 144 | 3300025934 | Ga0207686_10562958 | Ga0207686_105629582 | 84 |
| 145 | 3300025935 | Ga0207709_11071097 | Ga0207709_110710971 | 84 |
| 146 | 3300025936 | Ga0207670_10212851 | Ga0207670_102128512 | 84 |
| 147 | 3300025936 | Ga0207670_10382748 | Ga0207670_103827482 | 84 |
| 148 | 3300025937 | Ga0207669_10226841 | Ga0207669_102268412 | 84 |
| 149 | 3300025937 | Ga0207669_10322512 | Ga0207669_103225122 | 84 |
| 150 | 3300025939 | Ga0207665_10178612 | Ga0207665_101786122 | 84 |
| 151 | 3300025940 | Ga0207691_10001286 | Ga0207691_1000128615 | 84 |
| 152 | 3300025942 | Ga0207689_10236787 | Ga0207689_102367873 | 84 |
| 153 | 3300025942 | Ga0207689_11702482 | Ga0207689_117024821 | 84 |
| 154 | 3300025944 | Ga0207661_10147872 | Ga0207661_101478722 | 84 |
| 155 | 3300025944 | Ga0207661_10594084 | Ga0207661_105940842 | 84 |
| 156 | 3300025945 | Ga0207679_10152891 | Ga0207679_101528913 | 84 |
| 157 | 3300025945 | Ga0207679_10431841 | Ga0207679_104318411 | 84 |
| 158 | 3300025945 | Ga0207679_11036169 | Ga0207679_110361691 | 84 |
| 159 | 3300025960 | Ga0207651_11699875 | Ga0207651_116998751 | 84 |
| 160 | 3300025972 | Ga0207668_10028308 | Ga0207668_100283082 | 84 |
| 161 | 3300025972 | Ga0207668_11277574 | Ga0207668_112775742 | 84 |
| 162 | 3300025981 | Ga0207640_10059033 | Ga0207640_100590333 | 84 |
| 163 | 3300025981 | Ga0207640_10277979 | Ga0207640_102779792 | 84 |
| 164 | 3300025981 | Ga0207640_10365059 | Ga0207640_103650592 | 84 |
| 165 | 3300025986 | Ga0207658_10014259 | Ga0207658_100142592 | 84 |
| 166 | 3300025986 | Ga0207658_10295432 | Ga0207658_102954322 | 84 |
| 167 | 3300026023 | Ga0207677_10330366 | Ga0207677_103303662 | 84 |
| 168 | 3300026023 | Ga0207677_10523931 | Ga0207677_105239312 | 84 |
| 169 | 3300026023 | Ga0207677_11610918 | Ga0207677_116109181 | 84 |
| 170 | 3300026035 | Ga0207703_12202137 | Ga0207703_122021371 | 84 |
| 171 | 3300026067 | Ga0207678_10116831 | Ga0207678_101168313 | 84 |
| 172 | 3300026075 | Ga0207708_10004525 | Ga0207708_100045254 | 84 |
| 173 | 3300026075 | Ga0207708_10335715 | Ga0207708_103357152 | 84 |
| 174 | 3300026078 | Ga0207702_10187998 | Ga0207702_101879982 | 84 |
| 175 | 3300026088 | Ga0207641_10548121 | Ga0207641_105481212 | 84 |
| 176 | 3300026088 | Ga0207641_10698284 | Ga0207641_106982841 | 84 |
| 177 | 3300026089 | Ga0207648_10125053 | Ga0207648_101250532 | 84 |
| 178 | 3300026095 | Ga0207676_10004523 | Ga0207676_100045238 | 84 |
| 179 | 3300026095 | Ga0207676_10185703 | Ga0207676_101857032 | 84 |
| 180 | 3300026116 | Ga0207674_10025504 | Ga0207674_100255047 | 84 |
| 181 | 3300026116 | Ga0207674_10028831 | Ga0207674_100288311 | 84 |
| 182 | 3300026116 | Ga0207674_10332525 | Ga0207674_103325252 | 84 |
| 183 | 3300026116 | Ga0207674_11050595 | Ga0207674_110505952 | 84 |
| 184 | 3300026118 | Ga0207675_100283608 | Ga0207675_1002836083 | 84 |
| 185 | 3300026121 | Ga0207683_10003401 | Ga0207683_100034017 | 84 |
| 186 | 3300027512 | Ga0209179_1029931 | Ga0209179_10299312 | 84 |
| 187 | 3300028381 | Ga0268264_10504692 | Ga0268264_105046921 | 84 |
| 188 | 3300031090 | Ga0265760_10027698 | Ga0265760_100276982 | 84 |
| 189 | 3300031903 | Ga0307407_11020693 | Ga0307407_110206932 | 84 |
| 190 | 3300034957 | Ga0373938_0168790 | Ga0373938_0168790_70_366 | 84 |
| 191 | 3300035114 | Ga0373939_0363599 | Ga0373939_0363599_77_346 | 84 |
| 192 | 3300036401 | Ga0373937_0527934 | Ga0373937_0527934_856_1110 | 84 |
| 193 | 3300037418 | Ga0395900_1794373 | Ga0395900_1794373_253_513 | 84 |
| 194 | 3300037471 | Ga0395905_0175221 | Ga0395905_0175221_1151_1405 | 84 |
| 195 | 3300038996 | Ga0242420_015565 | Ga0242420_015565_973_1242 | 84 |
| 196 | 3300039438 | Ga0436360_1208270 | Ga0436360_1208270_152_415 | 84 |
| 197 | 3300042876 | Ga0451577_1904154 | Ga0451577_1904154_40_300 | 84 |
| 198 | 3300046457 | Ga0495590_0357279 | Ga0495590_0357279_56_316 | 84 |
| 199 | 3300046472 | Ga0495580_0790115 | Ga0495580_0790115_318_587 | 84 |
| 200 | 3300046499 | Ga0495594_0419631 | Ga0495594_0419631_467_721 | 84 |
| 201 | 3300046511 | Ga0495608_0196157 | Ga0495608_0196157_439_693 | 84 |
| 202 | 3300046531 | Ga0495665_0506371 | Ga0495665_0506371_160_414 | 84 |
| 203 | 3300046536 | Ga0495587_0305779 | Ga0495587_0305779_32_286 | 84 |
| 204 | 3300046663 | Ga0495635_0087639 | Ga0495635_0087639_1614_1868 | 84 |
| 205 | 3300046675 | Ga0495657_0755399 | Ga0495657_0755399_114_368 | 84 |
| 206 | 3300046681 | Ga0495647_0029678 | Ga0495647_0029678_886_1140 | 84 |
| 207 | 3300046683 | Ga0495658_0021359 | Ga0495658_0021359_2904_3158 | 84 |
| 208 | 3300046684 | Ga0495669_0390650 | Ga0495669_0390650_283_537 | 84 |
| 209 | 3300046684 | Ga0495669_0480832 | Ga0495669_0480832_239_496 | 84 |
| 210 | 3300046809 | Ga0495600_0283664 | Ga0495600_0283664_613_867 | 84 |
| 211 | 3300047319 | Ga0495674_0477705 | Ga0495674_0477705_639_893 | 84 |
| 212 | 3300048088 | Ga0495602_1170391 | Ga0495602_1170391_125_379 | 84 |
| 213 | 3300048903 | Ga0496100_0202367 | Ga0496100_0202367_623_883 | 84 |
| 214 | 3300048904 | Ga0496101_0228486 | Ga0496101_0228486_1047_1307 | 84 |
| 215 | 3300048905 | Ga0496102_0463921 | Ga0496102_0463921_529_798 | 84 |
| 216 | 3300048909 | Ga0496106_0178591 | Ga0496106_0178591_326_595 | 84 |
| 217 | 3300048911 | Ga0496108_0757418 | Ga0496108_0757418_172_426 | 84 |
| 218 | 3300048911 | Ga0496108_0803763 | Ga0496108_0803763_232_495 | 84 |
| 219 | 3300048912 | Ga0496109_0152696 | Ga0496109_0152696_1686_1946 | 84 |
| 220 | 3300048912 | Ga0496109_0455028 | Ga0496109_0455028_80_346 | 84 |
| 221 | 3300048913 | Ga0496110_0284595 | Ga0496110_0284595_655_921 | 84 |
| 222 | 3300048913 | Ga0496110_0856028 | Ga0496110_0856028_161_424 | 84 |
| 223 | 3300048914 | Ga0496111_0200549 | Ga0496111_0200549_370_630 | 84 |
| 224 | 3300048914 | Ga0496111_0633694 | Ga0496111_0633694_298_561 | 84 |
| 225 | 3300048915 | Ga0496112_0022663 | Ga0496112_0022663_1648_1902 | 84 |
| 226 | 3300048916 | Ga0496113_0937302 | Ga0496113_0937302_310_579 | 84 |
| 227 | 3300049576 | Ga0501040_0919356 | Ga0501040_0919356_310_567 | 84 |
| 228 | 3300049587 | Ga0501071_0264058 | Ga0501071_0264058_952_1206 | 84 |
| 229 | 3300049588 | Ga0501072_0058474 | Ga0501072_0058474_1588_1842 | 84 |
| 230 | 3300049591 | Ga0501075_0412068 | Ga0501075_0412068_748_1002 | 84 |
| 231 | 3300049591 | Ga0501075_0438857 | Ga0501075_0438857_206_466 | 84 |
| 232 | 3300050511 | nmdc:mga08y16_79383_c1 | nmdc:mga08y16_79383_c1_290_544 | 84 |
| 233 | 3300050512 | nmdc:mga0n895_190907_c1 | nmdc:mga0n895_190907_c1_1708_1968 | 84 |
| 234 | 3300050512 | nmdc:mga0n895_664342_c1 | nmdc:mga0n895_664342_c1_710_979 | 84 |
| 235 | 3300050513 | nmdc:mga0rr50_682167_c1 | nmdc:mga0rr50_682167_c1_560_817 | 84 |
| 236 | 3300050515 | nmdc:mga0a205_30717_c1 | nmdc:mga0a205_30717_c1_3303_3560 | 84 |
| 237 | 3300053078 | Ga0495612_0567665 | Ga0495612_0567665_90_344 | 84 |
| 238 | 3300053084 | Ga0495595_0587066 | Ga0495595_0587066_118_372 | 84 |
| 239 | 3300053085 | Ga0495619_0098738 | Ga0495619_0098738_150_404 | 84 |
| 240 | 3300053153 | Ga0500616_0002451 | Ga0500616_0002451_2628_2888 | 84 |
| 241 | 3300059492 | Ga0587073_0048976 | Ga0587073_0048976_263_523 | 84 |
| 242 | 3300059504 | Ga0587082_073552 | Ga0587082_073552_410_670 | 84 |
| 243 | 3300059505 | Ga0587083_0104078 | Ga0587083_0104078_306_566 | 84 |
| 244 | 3300059644 | Ga0587075_091992 | Ga0587075_091992_276_536 | 84 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4zux-assembly1.cif.gz_Z | saga dub module ubp8/sgf11/sus1/sgf73 bound to ubiqitinated nucleosome | 0.7272 | 32 | 69 |
| 4w4u-assembly2.cif.gz_D | structure of yeast saga dubm with sgf73 y57a mutant at 2.8 angstroms resolution | 0.6871 | 32 | 69 |
| 4w4u-assembly1.cif.gz_A | structure of yeast saga dubm with sgf73 y57a mutant at 2.8 angstroms resolution | 0.6862 | 32 | 69 |
| 2ida-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.6658 | 3 | 82 |
| 3m99-assembly1.cif.gz_A | structure of the ubp8-sgf11-sgf73-sus1 saga dub module | 0.64 | 18 | 69 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q55AP9_45_203_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.8159 | 32 | 56 | 3.30.40.10 |
| af_Q5SMK9_168_245_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.8102 | 31 | 47 | 3.30.40.10 |
| af_D3ZTX7_17_139_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.7208 | 16 | 69 | 3.30.40.10 |
| af_Q7Z569_302_376_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.7126 | 11 | 71 | 3.30.40.10 |
| af_Q9VRP5_168_480_3.90.70.10 | Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases | 0.7006 | 31 | 43 | 3.90.70.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X6N9N0-F1-model_v4 | Uncharacterized protein | 0.9106 | 30 | 70 |
GO:0004843
GO:0008270 GO:0016579 |
| AF-A0A7C3KJV7-F1-model_v4 | C2H2-type domain-containing protein | 0.8422 | 21 | 73 |
GO:0008270
|
| AF-A0A7W4UQ82-F1-model_v4 | UBP-type domain-containing protein | 0.827 | 15 | 74 |
GO:0008270
|
| AF-A0A7K1TTA7-F1-model_v4 | UBP-type domain-containing protein | 0.8172 | 15 | 74 |
GO:0008270
|
| AF-A0A1Q4ZYX5-F1-model_v4 | deleted | 0.8149 | 15 | 74 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar