F356203

General Info

Members Datasets Scaffolds Average Seq Length
244 185 243 85

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10796213|Ga0070666_107962131
Length 98
Sequence MTDSPCAHLDTITDAAPSSNGCEDCLRIGGHWMHLRRCTSCGHVGCCDSSPNRHATAHFHETGHPIVQSFEPGEDWLWCYADDVGFEIDSMMHSPAHT

Samples

Sample ID Description Type Environment
1 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
135 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
140 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
141 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
151 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
177 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
180 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
181 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.13
Metatranscriptomes 2.46
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0
Rhizoplane 5.74
Rhizosphere 93.03
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10025483 3300002244 Bacteria 1022
2 JGI25406J46586_10014452 3300003203 Bacteria 3356
3 rootL2_10171375 3300003322 Bacteria 3983
4 Ga0065704_10301597 3300005289 Bacteria 884
5 Ga0065707_10362308 3300005295 Bacteria 902
6 Ga0070683_101618152 3300005329 Bacteria 623
7 Ga0070690_100350680 3300005330 Bacteria 1071
8 Ga0070690_100903533 3300005330 Bacteria 691
9 Ga0070670_100021992 3300005331 Bacteria 5487
10 Ga0070677_10011382 3300005333 Bacteria 3067
11 Ga0068869_100715556 3300005334 Bacteria 855
12 Ga0070666_10206669 3300005335 Bacteria 1382
13 Ga0070666_10796213 3300005335 Bacteria 696
14 Ga0070680_100902019 3300005336 Bacteria 763
15 Ga0070680_101006593 3300005336 Bacteria 720
16 Ga0070680_101513171 3300005336 Bacteria 581
17 Ga0070682_100007672 3300005337 Bacteria 6079
18 Ga0068868_100306748 3300005338 Bacteria 1349
19 Ga0070660_100008432 3300005339 Bacteria 7206
20 Ga0070689_100478711 3300005340 Bacteria 1063
21 Ga0070689_101473506 3300005340 Bacteria 616
22 Ga0070668_100086549 3300005347 Bacteria 2464
23 Ga0070668_100399997 3300005347 Bacteria 1172
24 Ga0070669_100039529 3300005353 Bacteria 3428
25 Ga0070675_100019436 3300005354 Bacteria 5414
26 Ga0070674_100116985 3300005356 Bacteria 1967
27 Ga0070667_100174492 3300005367 Bacteria 1899
28 Ga0070709_11573008 3300005434 Bacteria 535
29 Ga0070701_10267742 3300005438 Bacteria 1038
30 Ga0070700_100119064 3300005441 Bacteria 1767
31 Ga0070700_100511090 3300005441 Bacteria 926
32 Ga0070700_100553642 3300005441 Bacteria 894
33 Ga0070663_100092015 3300005455 Bacteria 2248
34 Ga0070678_100032212 3300005456 Bacteria 3626
35 Ga0070662_100019644 3300005457 Bacteria 4589
36 Ga0070681_10057015 3300005458 Bacteria 3887
37 Ga0068867_100030986 3300005459 Bacteria 3859
38 Ga0070706_100001961 3300005467 Bacteria 21200
39 Ga0070707_100930834 3300005468 Bacteria 834
40 Ga0070698_100212615 3300005471 Bacteria 1868
41 Ga0070698_100281864 3300005471 Bacteria 1593
42 Ga0070699_100070901 3300005518 Bacteria 3030
43 Ga0070699_100833532 3300005518 Bacteria 844
44 Ga0070679_100317585 3300005530 Bacteria 1507
45 Ga0070679_102040880 3300005530 Bacteria 523
46 Ga0070697_100001000 3300005536 Bacteria 21314
47 Ga0070672_100022469 3300005543 Bacteria 4634
48 Ga0070665_100014159 3300005548 Bacteria 8014
49 Ga0070704_100064682 3300005549 Bacteria 2630
50 Ga0070664_101708114 3300005564 Bacteria 597
51 Ga0068857_102530524 3300005577 Bacteria 504
52 Ga0068856_102481403 3300005614 Bacteria 525
53 Ga0068852_101805383 3300005616 Bacteria 634
54 Ga0068859_101758968 3300005617 Bacteria 685
55 Ga0068864_100038977 3300005618 Bacteria 4060
56 Ga0068870_10136018 3300005840 Bacteria 1433
57 Ga0068863_100003787 3300005841 Bacteria 14960
58 Ga0068862_100137278 3300005844 Bacteria 2168
59 Ga0068862_101892003 3300005844 Bacteria 606
60 Ga0081539_10000788 3300005985 Bacteria 61718
61 Ga0081539_10087308 3300005985 Bacteria 1621
62 Ga0070712_100801909 3300006175 Bacteria 808
63 Ga0070712_101484907 3300006175 Bacteria 592
64 Ga0075428_100180506 3300006844 Bacteria 2285
65 Ga0075428_100439233 3300006844 Bacteria 1398
66 Ga0075428_101920797 3300006844 Bacteria 615
67 Ga0075430_100587738 3300006846 Bacteria 919
68 Ga0075431_100025033 3300006847 Bacteria 6119
69 Ga0075431_100069284 3300006847 Bacteria 3639
70 Ga0075434_101919421 3300006871 Bacteria 598
71 Ga0075429_100362941 3300006880 Bacteria 1268
72 Ga0068865_100044141 3300006881 Bacteria 3050
73 Ga0075436_100061722 3300006914 Bacteria 2590
74 Ga0097620_101758976 3300006931 Bacteria 685
75 Ga0075435_100705543 3300007076 Bacteria 877
76 Ga0075435_101723044 3300007076 Bacteria 550
77 Ga0099795_10300940 3300007788 Bacteria 705
78 Ga0111539_10143962 3300009094 Bacteria 2790
79 Ga0105245_10433290 3300009098 Bacteria 1320
80 Ga0105245_10673089 3300009098 Bacteria 1066
81 Ga0105247_10325612 3300009101 Bacteria 1074
82 Ga0114129_10046605 3300009147 Bacteria 6091
83 Ga0114129_10506986 3300009147 Bacteria 1575
84 Ga0105243_11539255 3300009148 Bacteria 690
85 Ga0105238_12589153 3300009551 Bacteria 543
86 Ga0105249_10181276 3300009553 Bacteria 2049
87 Ga0105246_10377838 3300011119 Bacteria 1170
88 Ga0157373_11417885 3300013100 Bacteria 528
89 Ga0157369_10523983 3300013105 Bacteria 1226
90 Ga0163162_10157068 3300013306 Bacteria 2395
91 Ga0157372_12791187 3300013307 Bacteria 560
92 Ga0157375_10002623 3300013308 Bacteria 15585
93 Ga0163163_10007072 3300014325 Bacteria 9863
94 Ga0157380_10027029 3300014326 Bacteria 4360
95 Ga0157377_10147223 3300014745 Bacteria 1453
96 Ga0157379_10493017 3300014968 Bacteria 1135
97 Ga0163161_10019272 3300017792 Bacteria 4784
98 Ga0224712_10514264 3300022467 Bacteria 579
99 Ga0207656_10090925 3300025321 Bacteria 1385
100 Ga0207682_10001705 3300025893 Bacteria 10055
101 Ga0207688_10282052 3300025901 Bacteria 1012
102 Ga0207688_10378149 3300025901 Bacteria 876
103 Ga0207680_11152681 3300025903 Bacteria 553
104 Ga0207647_10358916 3300025904 Bacteria 825
105 Ga0207645_10057663 3300025907 Bacteria 2480
106 Ga0207705_10149124 3300025909 Bacteria 1751
107 Ga0207684_10006589 3300025910 Bacteria 10562
108 Ga0207654_10574044 3300025911 Bacteria 803
109 Ga0207707_10231201 3300025912 Bacteria 1609
110 Ga0207707_10770477 3300025912 Bacteria 803
111 Ga0207695_10182510 3300025913 Bacteria 2019
112 Ga0207671_10126816 3300025914 Bacteria 1956
113 Ga0207693_11382189 3300025915 Bacteria 523
114 Ga0207660_11658950 3300025917 Bacteria 515
115 Ga0207657_10003235 3300025919 Bacteria 17432
116 Ga0207657_10005688 3300025919 Bacteria 13006
117 Ga0207657_10731755 3300025919 Bacteria 767
118 Ga0207649_11046778 3300025920 Bacteria 643
119 Ga0207652_10727350 3300025921 Bacteria 884
120 Ga0207652_11242744 3300025921 Bacteria 647
121 Ga0207652_11542341 3300025921 Bacteria 568
122 Ga0207646_11614454 3300025922 Bacteria 559
123 Ga0207681_10114127 3300025923 Bacteria 1970
124 Ga0207694_10146809 3300025924 Unclassified 1899
125 Ga0207650_10022140 3300025925 Bacteria 4498
126 Ga0207650_10928281 3300025925 Bacteria 739
127 Ga0207659_10008730 3300025926 Bacteria 6308
128 Ga0207664_11471377 3300025929 Bacteria 602
129 Ga0207644_10570076 3300025931 Bacteria 938
130 Ga0207690_10167919 3300025932 Bacteria 1641
131 Ga0207690_10492751 3300025932 Bacteria 990
132 Ga0207690_10511368 3300025932 Bacteria 972
133 Ga0207706_10050747 3300025933 Unclassified 3666
134 Ga0207706_10070633 3300025933 Bacteria 3071
135 Ga0207686_10562958 3300025934 Bacteria 892
136 Ga0207709_11071097 3300025935 Bacteria 661
137 Ga0207670_10212851 3300025936 Bacteria 1475
138 Ga0207670_10382748 3300025936 Bacteria 1121
139 Ga0207669_10226841 3300025937 Bacteria 1375
140 Ga0207669_10322512 3300025937 Bacteria 1183
141 Ga0207665_10178612 3300025939 Bacteria 1536
142 Ga0207691_10001286 3300025940 Bacteria 25022
143 Ga0207689_10236787 3300025942 Bacteria 1509
144 Ga0207689_11702482 3300025942 Bacteria 522
145 Ga0207661_10147872 3300025944 Bacteria 2029
146 Ga0207661_10594084 3300025944 Bacteria 1016
147 Ga0207679_10152891 3300025945 Bacteria 1880
148 Ga0207679_10431841 3300025945 Bacteria 1164
149 Ga0207679_11036169 3300025945 Bacteria 752
150 Ga0207651_11699875 3300025960 Bacteria 568
151 Ga0207668_10028308 3300025972 Bacteria 3662
152 Ga0207668_11277574 3300025972 Bacteria 660
153 Ga0207640_10059033 3300025981 Bacteria 2530
154 Ga0207640_10277979 3300025981 Bacteria 1314
155 Ga0207640_10365059 3300025981 Bacteria 1165
156 Ga0207658_10014259 3300025986 Bacteria 5442
157 Ga0207658_10295432 3300025986 Bacteria 1394
158 Ga0207677_10330366 3300026023 Bacteria 1270
159 Ga0207677_10523931 3300026023 Bacteria 1028
160 Ga0207677_11610918 3300026023 Bacteria 601
161 Ga0207703_12202137 3300026035 Bacteria 527
162 Ga0207678_10116831 3300026067 Bacteria 2276
163 Ga0207708_10004525 3300026075 Bacteria 10228
164 Ga0207708_10335715 3300026075 Unclassified 1237
165 Ga0207702_10187998 3300026078 Bacteria 1906
166 Ga0207641_10548121 3300026088 Bacteria 1127
167 Ga0207641_10698284 3300026088 Bacteria 999
168 Ga0207648_10125053 3300026089 Bacteria 2262
169 Ga0207676_10004523 3300026095 Bacteria 9835
170 Ga0207676_10185703 3300026095 Bacteria 1825
171 Ga0207674_10025504 3300026116 Bacteria 6303
172 Ga0207674_10028831 3300026116 Bacteria 5852
173 Ga0207674_10332525 3300026116 Bacteria 1469
174 Ga0207674_11050595 3300026116 Bacteria 784
175 Ga0207675_100283608 3300026118 Bacteria 1610
176 Ga0207683_10003401 3300026121 Bacteria 13851
177 Ga0209179_1029931 3300027512 Bacteria 1111
178 Ga0268264_10504692 3300028381 Bacteria 1180
179 Ga0265760_10027698 3300031090 Bacteria 1661
180 Ga0307407_11020693 3300031903 Bacteria 640
181 Ga0373938_0168790 3300034957 Bacteria 592
182 Ga0373939_0363599 3300035114 Bacteria 592
183 Ga0373937_0527934 3300036401 Bacteria 1121
184 Ga0395900_1794373 3300037418 Bacteria 524
185 Ga0395905_0175221 3300037471 Bacteria 2014
186 Ga0242420_015565 3300038996 Bacteria 1316
187 Ga0436360_1208270 3300039438 Unclassified 985
188 Ga0439435_0183745 3300042436 Bacteria 684
189 Ga0451577_1904154 3300042876 Bacteria 521
190 Ga0495590_0357279 3300046457 Bacteria 556
191 Ga0495580_0790115 3300046472 Bacteria 616
192 Ga0495594_0419631 3300046499 Bacteria 761
193 Ga0495608_0196157 3300046511 Bacteria 1274
194 Ga0495665_0506371 3300046531 Bacteria 608
195 Ga0495587_0305779 3300046536 Bacteria 889
196 Ga0495635_0087639 3300046663 Bacteria 2130
197 Ga0495657_0755399 3300046675 Bacteria 557
198 Ga0495647_0029678 3300046681 Bacteria 2024
199 Ga0495658_0021359 3300046683 Bacteria 3412
200 Ga0495669_0390650 3300046684 Bacteria 674
201 Ga0495669_0480832 3300046684 Unclassified 604
202 Ga0495600_0283664 3300046809 Bacteria 1048
203 Ga0495674_0477705 3300047319 Bacteria 999
204 Ga0495602_1170391 3300048088 Bacteria 502
205 Ga0496100_0202367 3300048903 Bacteria 1448
206 Ga0496101_0228486 3300048904 Bacteria 1446
207 Ga0496102_0463921 3300048905 Bacteria 1187
208 Ga0496106_0178591 3300048909 Bacteria 1685
209 Ga0496108_0757418 3300048911 Bacteria 840
210 Ga0496108_0803763 3300048911 Bacteria 811
211 Ga0496109_0152696 3300048912 Bacteria 2162
212 Ga0496109_0455028 3300048912 Bacteria 1209
213 Ga0496110_0284595 3300048913 Bacteria 1506
214 Ga0496110_0856028 3300048913 Bacteria 814
215 Ga0496111_0200549 3300048914 Bacteria 1483
216 Ga0496111_0633694 3300048914 Bacteria 781
217 Ga0496112_0022663 3300048915 Bacteria 5989
218 Ga0496113_0937302 3300048916 Bacteria 684
219 Ga0501040_0919356 3300049576 Bacteria 634
220 Ga0501071_0264058 3300049587 Bacteria 1300
221 Ga0501072_0058474 3300049588 Bacteria 3039
222 Ga0501075_0412068 3300049591 Bacteria 1030
223 Ga0501075_0438857 3300049591 Bacteria 996
224 nmdc:mga05p37_1098915_c1 3300050507 Bacteria 833
225 nmdc:mga05p37_9937_c1 3300050507 Bacteria 11297
226 nmdc:mga08y16_79383_c1 3300050511 Bacteria 3420
227 nmdc:mga0n895_190907_c1 3300050512 Bacteria 2079
228 nmdc:mga0n895_1971553_c1 3300050512 Bacteria 542
229 nmdc:mga0n895_664342_c1 3300050512 Bacteria 1040
230 nmdc:mga0n895_755661_c1 3300050512 Bacteria 965
231 nmdc:mga0rr50_682167_c1 3300050513 Bacteria 877
232 nmdc:mga0a205_30717_c1 3300050515 Bacteria 5146
233 Ga0495612_0098428 3300053078 Bacteria 1244
234 Ga0495612_0567665 3300053078 Bacteria 523
235 Ga0495595_0587066 3300053084 Bacteria 569
236 Ga0495619_0098738 3300053085 Bacteria 1985
237 Ga0500616_0002451 3300053153 Bacteria 15418
238 Ga0500637_0133132 3300053178 Bacteria 1441
239 Ga0587073_0048976 3300059492 Bacteria 951
240 Ga0587082_073552 3300059504 Bacteria 699
241 Ga0587083_0104078 3300059505 Bacteria 711
242 Ga0587075_091992 3300059644 Bacteria 594
243 Ga0530510_0892169 3300061734 Bacteria 679

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10171375 rootL2_101713756 74
2 3300007788 Ga0099795_10300940 Ga0099795_103009402 78
3 iso_pu_bacteria 2675903060 2676490892 80
4 3300005336 Ga0070680_101513171 Ga0070680_1015131712 82
5 3300005340 Ga0070689_101473506 Ga0070689_1014735061 82
6 3300005471 Ga0070698_100212615 Ga0070698_1002126151 82
7 3300005549 Ga0070704_100064682 Ga0070704_1000646824 82
8 3300006175 Ga0070712_101484907 Ga0070712_1014849072 82
9 3300025917 Ga0207660_11658950 Ga0207660_116589502 82
10 3300025921 Ga0207652_11242744 Ga0207652_112427442 82
11 3300050512 nmdc:mga0n895_1971553_c1 nmdc:mga0n895_1971553_c1_182_430 82
12 3300003203 JGI25406J46586_10014452 JGI25406J46586_100144523 83
13 3300005289 Ga0065704_10301597 Ga0065704_103015972 83
14 3300005295 Ga0065707_10362308 Ga0065707_103623082 83
15 3300005438 Ga0070701_10267742 Ga0070701_102677423 83
16 3300005441 Ga0070700_100511090 Ga0070700_1005110901 83
17 3300005985 Ga0081539_10000788 Ga0081539_1000078839 83
18 3300006844 Ga0075428_100180506 Ga0075428_1001805062 83
19 3300006844 Ga0075428_101920797 Ga0075428_1019207972 83
20 3300006846 Ga0075430_100587738 Ga0075430_1005877381 83
21 3300006847 Ga0075431_100025033 Ga0075431_1000250335 83
22 3300006847 Ga0075431_100069284 Ga0075431_1000692841 83
23 3300006880 Ga0075429_100362941 Ga0075429_1003629412 83
24 3300006914 Ga0075436_100061722 Ga0075436_1000617221 83
25 3300009147 Ga0114129_10046605 Ga0114129_100466055 83
26 3300009147 Ga0114129_10506986 Ga0114129_105069863 83
27 3300042436 Ga0439435_0183745 Ga0439435_0183745_408_659 83
28 3300050507 nmdc:mga05p37_1098915_c1 nmdc:mga05p37_1098915_c1_322_579 83
29 3300050507 nmdc:mga05p37_9937_c1 nmdc:mga05p37_9937_c1_10002_10253 83
30 3300050512 nmdc:mga0n895_755661_c1 nmdc:mga0n895_755661_c1_407_658 83
31 3300053078 Ga0495612_0098428 Ga0495612_0098428_260_511 83
32 3300053178 Ga0500637_0133132 Ga0500637_0133132_53_304 83
33 3300061734 Ga0530510_0892169 Ga0530510_0892169_165_416 83
34 3300002244 JGI24742J22300_10025483 JGI24742J22300_100254833 84
35 3300005329 Ga0070683_101618152 Ga0070683_1016181521 84
36 3300005330 Ga0070690_100350680 Ga0070690_1003506802 84
37 3300005330 Ga0070690_100903533 Ga0070690_1009035332 84
38 3300005331 Ga0070670_100021992 Ga0070670_1000219922 84
39 3300005333 Ga0070677_10011382 Ga0070677_100113825 84
40 3300005334 Ga0068869_100715556 Ga0068869_1007155561 84
41 3300005335 Ga0070666_10206669 Ga0070666_102066692 84
42 3300005335 Ga0070666_10796213 Ga0070666_107962131 84
43 3300005336 Ga0070680_100902019 Ga0070680_1009020192 84
44 3300005336 Ga0070680_101006593 Ga0070680_1010065932 84
45 3300005337 Ga0070682_100007672 Ga0070682_1000076728 84
46 3300005338 Ga0068868_100306748 Ga0068868_1003067482 84
47 3300005339 Ga0070660_100008432 Ga0070660_1000084325 84
48 3300005340 Ga0070689_100478711 Ga0070689_1004787112 84
49 3300005347 Ga0070668_100086549 Ga0070668_1000865492 84
50 3300005347 Ga0070668_100399997 Ga0070668_1003999973 84
51 3300005353 Ga0070669_100039529 Ga0070669_1000395291 84
52 3300005354 Ga0070675_100019436 Ga0070675_1000194363 84
53 3300005356 Ga0070674_100116985 Ga0070674_1001169852 84
54 3300005367 Ga0070667_100174492 Ga0070667_1001744922 84
55 3300005434 Ga0070709_11573008 Ga0070709_115730082 84
56 3300005441 Ga0070700_100119064 Ga0070700_1001190642 84
57 3300005441 Ga0070700_100553642 Ga0070700_1005536422 84
58 3300005455 Ga0070663_100092015 Ga0070663_1000920153 84
59 3300005456 Ga0070678_100032212 Ga0070678_1000322124 84
60 3300005457 Ga0070662_100019644 Ga0070662_1000196445 84
61 3300005458 Ga0070681_10057015 Ga0070681_100570155 84
62 3300005459 Ga0068867_100030986 Ga0068867_1000309861 84
63 3300005467 Ga0070706_100001961 Ga0070706_10000196112 84
64 3300005468 Ga0070707_100930834 Ga0070707_1009308342 84
65 3300005471 Ga0070698_100281864 Ga0070698_1002818642 84
66 3300005518 Ga0070699_100070901 Ga0070699_1000709012 84
67 3300005518 Ga0070699_100833532 Ga0070699_1008335322 84
68 3300005530 Ga0070679_100317585 Ga0070679_1003175852 84
69 3300005530 Ga0070679_102040880 Ga0070679_1020408801 84
70 3300005536 Ga0070697_100001000 Ga0070697_1000010008 84
71 3300005543 Ga0070672_100022469 Ga0070672_1000224694 84
72 3300005548 Ga0070665_100014159 Ga0070665_10001415910 84
73 3300005564 Ga0070664_101708114 Ga0070664_1017081142 84
74 3300005577 Ga0068857_102530524 Ga0068857_1025305242 84
75 3300005614 Ga0068856_102481403 Ga0068856_1024814032 84
76 3300005616 Ga0068852_101805383 Ga0068852_1018053832 84
77 3300005617 Ga0068859_101758968 Ga0068859_1017589682 84
78 3300005618 Ga0068864_100038977 Ga0068864_1000389772 84
79 3300005840 Ga0068870_10136018 Ga0068870_101360182 84
80 3300005841 Ga0068863_100003787 Ga0068863_10000378712 84
81 3300005844 Ga0068862_100137278 Ga0068862_1001372781 84
82 3300005844 Ga0068862_101892003 Ga0068862_1018920032 84
83 3300005985 Ga0081539_10087308 Ga0081539_100873083 84
84 3300006175 Ga0070712_100801909 Ga0070712_1008019092 84
85 3300006844 Ga0075428_100439233 Ga0075428_1004392332 84
86 3300006871 Ga0075434_101919421 Ga0075434_1019194212 84
87 3300006881 Ga0068865_100044141 Ga0068865_1000441415 84
88 3300006931 Ga0097620_101758976 Ga0097620_1017589762 84
89 3300007076 Ga0075435_100705543 Ga0075435_1007055432 84
90 3300007076 Ga0075435_101723044 Ga0075435_1017230441 84
91 3300009094 Ga0111539_10143962 Ga0111539_101439622 84
92 3300009098 Ga0105245_10433290 Ga0105245_104332902 84
93 3300009098 Ga0105245_10673089 Ga0105245_106730892 84
94 3300009101 Ga0105247_10325612 Ga0105247_103256122 84
95 3300009148 Ga0105243_11539255 Ga0105243_115392551 84
96 3300009551 Ga0105238_12589153 Ga0105238_125891532 84
97 3300009553 Ga0105249_10181276 Ga0105249_101812762 84
98 3300011119 Ga0105246_10377838 Ga0105246_103778382 84
99 3300013100 Ga0157373_11417885 Ga0157373_114178852 84
100 3300013105 Ga0157369_10523983 Ga0157369_105239831 84
101 3300013306 Ga0163162_10157068 Ga0163162_101570681 84
102 3300013307 Ga0157372_12791187 Ga0157372_127911872 84
103 3300013308 Ga0157375_10002623 Ga0157375_100026235 84
104 3300014325 Ga0163163_10007072 Ga0163163_100070722 84
105 3300014326 Ga0157380_10027029 Ga0157380_100270293 84
106 3300014745 Ga0157377_10147223 Ga0157377_101472233 84
107 3300014968 Ga0157379_10493017 Ga0157379_104930172 84
108 3300017792 Ga0163161_10019272 Ga0163161_100192725 84
109 3300022467 Ga0224712_10514264 Ga0224712_105142641 84
110 3300025321 Ga0207656_10090925 Ga0207656_100909252 84
111 3300025893 Ga0207682_10001705 Ga0207682_1000170511 84
112 3300025901 Ga0207688_10282052 Ga0207688_102820523 84
113 3300025901 Ga0207688_10378149 Ga0207688_103781492 84
114 3300025903 Ga0207680_11152681 Ga0207680_111526812 84
115 3300025904 Ga0207647_10358916 Ga0207647_103589162 84
116 3300025907 Ga0207645_10057663 Ga0207645_100576633 84
117 3300025909 Ga0207705_10149124 Ga0207705_101491242 84
118 3300025910 Ga0207684_10006589 Ga0207684_100065896 84
119 3300025911 Ga0207654_10574044 Ga0207654_105740442 84
120 3300025912 Ga0207707_10231201 Ga0207707_102312012 84
121 3300025912 Ga0207707_10770477 Ga0207707_107704772 84
122 3300025913 Ga0207695_10182510 Ga0207695_101825102 84
123 3300025914 Ga0207671_10126816 Ga0207671_101268163 84
124 3300025915 Ga0207693_11382189 Ga0207693_113821892 84
125 3300025919 Ga0207657_10003235 Ga0207657_1000323513 84
126 3300025919 Ga0207657_10005688 Ga0207657_1000568814 84
127 3300025919 Ga0207657_10731755 Ga0207657_107317551 84
128 3300025920 Ga0207649_11046778 Ga0207649_110467782 84
129 3300025921 Ga0207652_10727350 Ga0207652_107273501 84
130 3300025921 Ga0207652_11542341 Ga0207652_115423411 84
131 3300025922 Ga0207646_11614454 Ga0207646_116144541 84
132 3300025923 Ga0207681_10114127 Ga0207681_101141272 84
133 3300025924 Ga0207694_10146809 Ga0207694_101468092 84
134 3300025925 Ga0207650_10022140 Ga0207650_100221403 84
135 3300025925 Ga0207650_10928281 Ga0207650_109282811 84
136 3300025926 Ga0207659_10008730 Ga0207659_100087305 84
137 3300025929 Ga0207664_11471377 Ga0207664_114713772 84
138 3300025931 Ga0207644_10570076 Ga0207644_105700762 84
139 3300025932 Ga0207690_10167919 Ga0207690_101679191 84
140 3300025932 Ga0207690_10492751 Ga0207690_104927512 84
141 3300025932 Ga0207690_10511368 Ga0207690_105113682 84
142 3300025933 Ga0207706_10050747 Ga0207706_100507472 84
143 3300025933 Ga0207706_10070633 Ga0207706_100706332 84
144 3300025934 Ga0207686_10562958 Ga0207686_105629582 84
145 3300025935 Ga0207709_11071097 Ga0207709_110710971 84
146 3300025936 Ga0207670_10212851 Ga0207670_102128512 84
147 3300025936 Ga0207670_10382748 Ga0207670_103827482 84
148 3300025937 Ga0207669_10226841 Ga0207669_102268412 84
149 3300025937 Ga0207669_10322512 Ga0207669_103225122 84
150 3300025939 Ga0207665_10178612 Ga0207665_101786122 84
151 3300025940 Ga0207691_10001286 Ga0207691_1000128615 84
152 3300025942 Ga0207689_10236787 Ga0207689_102367873 84
153 3300025942 Ga0207689_11702482 Ga0207689_117024821 84
154 3300025944 Ga0207661_10147872 Ga0207661_101478722 84
155 3300025944 Ga0207661_10594084 Ga0207661_105940842 84
156 3300025945 Ga0207679_10152891 Ga0207679_101528913 84
157 3300025945 Ga0207679_10431841 Ga0207679_104318411 84
158 3300025945 Ga0207679_11036169 Ga0207679_110361691 84
159 3300025960 Ga0207651_11699875 Ga0207651_116998751 84
160 3300025972 Ga0207668_10028308 Ga0207668_100283082 84
161 3300025972 Ga0207668_11277574 Ga0207668_112775742 84
162 3300025981 Ga0207640_10059033 Ga0207640_100590333 84
163 3300025981 Ga0207640_10277979 Ga0207640_102779792 84
164 3300025981 Ga0207640_10365059 Ga0207640_103650592 84
165 3300025986 Ga0207658_10014259 Ga0207658_100142592 84
166 3300025986 Ga0207658_10295432 Ga0207658_102954322 84
167 3300026023 Ga0207677_10330366 Ga0207677_103303662 84
168 3300026023 Ga0207677_10523931 Ga0207677_105239312 84
169 3300026023 Ga0207677_11610918 Ga0207677_116109181 84
170 3300026035 Ga0207703_12202137 Ga0207703_122021371 84
171 3300026067 Ga0207678_10116831 Ga0207678_101168313 84
172 3300026075 Ga0207708_10004525 Ga0207708_100045254 84
173 3300026075 Ga0207708_10335715 Ga0207708_103357152 84
174 3300026078 Ga0207702_10187998 Ga0207702_101879982 84
175 3300026088 Ga0207641_10548121 Ga0207641_105481212 84
176 3300026088 Ga0207641_10698284 Ga0207641_106982841 84
177 3300026089 Ga0207648_10125053 Ga0207648_101250532 84
178 3300026095 Ga0207676_10004523 Ga0207676_100045238 84
179 3300026095 Ga0207676_10185703 Ga0207676_101857032 84
180 3300026116 Ga0207674_10025504 Ga0207674_100255047 84
181 3300026116 Ga0207674_10028831 Ga0207674_100288311 84
182 3300026116 Ga0207674_10332525 Ga0207674_103325252 84
183 3300026116 Ga0207674_11050595 Ga0207674_110505952 84
184 3300026118 Ga0207675_100283608 Ga0207675_1002836083 84
185 3300026121 Ga0207683_10003401 Ga0207683_100034017 84
186 3300027512 Ga0209179_1029931 Ga0209179_10299312 84
187 3300028381 Ga0268264_10504692 Ga0268264_105046921 84
188 3300031090 Ga0265760_10027698 Ga0265760_100276982 84
189 3300031903 Ga0307407_11020693 Ga0307407_110206932 84
190 3300034957 Ga0373938_0168790 Ga0373938_0168790_70_366 84
191 3300035114 Ga0373939_0363599 Ga0373939_0363599_77_346 84
192 3300036401 Ga0373937_0527934 Ga0373937_0527934_856_1110 84
193 3300037418 Ga0395900_1794373 Ga0395900_1794373_253_513 84
194 3300037471 Ga0395905_0175221 Ga0395905_0175221_1151_1405 84
195 3300038996 Ga0242420_015565 Ga0242420_015565_973_1242 84
196 3300039438 Ga0436360_1208270 Ga0436360_1208270_152_415 84
197 3300042876 Ga0451577_1904154 Ga0451577_1904154_40_300 84
198 3300046457 Ga0495590_0357279 Ga0495590_0357279_56_316 84
199 3300046472 Ga0495580_0790115 Ga0495580_0790115_318_587 84
200 3300046499 Ga0495594_0419631 Ga0495594_0419631_467_721 84
201 3300046511 Ga0495608_0196157 Ga0495608_0196157_439_693 84
202 3300046531 Ga0495665_0506371 Ga0495665_0506371_160_414 84
203 3300046536 Ga0495587_0305779 Ga0495587_0305779_32_286 84
204 3300046663 Ga0495635_0087639 Ga0495635_0087639_1614_1868 84
205 3300046675 Ga0495657_0755399 Ga0495657_0755399_114_368 84
206 3300046681 Ga0495647_0029678 Ga0495647_0029678_886_1140 84
207 3300046683 Ga0495658_0021359 Ga0495658_0021359_2904_3158 84
208 3300046684 Ga0495669_0390650 Ga0495669_0390650_283_537 84
209 3300046684 Ga0495669_0480832 Ga0495669_0480832_239_496 84
210 3300046809 Ga0495600_0283664 Ga0495600_0283664_613_867 84
211 3300047319 Ga0495674_0477705 Ga0495674_0477705_639_893 84
212 3300048088 Ga0495602_1170391 Ga0495602_1170391_125_379 84
213 3300048903 Ga0496100_0202367 Ga0496100_0202367_623_883 84
214 3300048904 Ga0496101_0228486 Ga0496101_0228486_1047_1307 84
215 3300048905 Ga0496102_0463921 Ga0496102_0463921_529_798 84
216 3300048909 Ga0496106_0178591 Ga0496106_0178591_326_595 84
217 3300048911 Ga0496108_0757418 Ga0496108_0757418_172_426 84
218 3300048911 Ga0496108_0803763 Ga0496108_0803763_232_495 84
219 3300048912 Ga0496109_0152696 Ga0496109_0152696_1686_1946 84
220 3300048912 Ga0496109_0455028 Ga0496109_0455028_80_346 84
221 3300048913 Ga0496110_0284595 Ga0496110_0284595_655_921 84
222 3300048913 Ga0496110_0856028 Ga0496110_0856028_161_424 84
223 3300048914 Ga0496111_0200549 Ga0496111_0200549_370_630 84
224 3300048914 Ga0496111_0633694 Ga0496111_0633694_298_561 84
225 3300048915 Ga0496112_0022663 Ga0496112_0022663_1648_1902 84
226 3300048916 Ga0496113_0937302 Ga0496113_0937302_310_579 84
227 3300049576 Ga0501040_0919356 Ga0501040_0919356_310_567 84
228 3300049587 Ga0501071_0264058 Ga0501071_0264058_952_1206 84
229 3300049588 Ga0501072_0058474 Ga0501072_0058474_1588_1842 84
230 3300049591 Ga0501075_0412068 Ga0501075_0412068_748_1002 84
231 3300049591 Ga0501075_0438857 Ga0501075_0438857_206_466 84
232 3300050511 nmdc:mga08y16_79383_c1 nmdc:mga08y16_79383_c1_290_544 84
233 3300050512 nmdc:mga0n895_190907_c1 nmdc:mga0n895_190907_c1_1708_1968 84
234 3300050512 nmdc:mga0n895_664342_c1 nmdc:mga0n895_664342_c1_710_979 84
235 3300050513 nmdc:mga0rr50_682167_c1 nmdc:mga0rr50_682167_c1_560_817 84
236 3300050515 nmdc:mga0a205_30717_c1 nmdc:mga0a205_30717_c1_3303_3560 84
237 3300053078 Ga0495612_0567665 Ga0495612_0567665_90_344 84
238 3300053084 Ga0495595_0587066 Ga0495595_0587066_118_372 84
239 3300053085 Ga0495619_0098738 Ga0495619_0098738_150_404 84
240 3300053153 Ga0500616_0002451 Ga0500616_0002451_2628_2888 84
241 3300059492 Ga0587073_0048976 Ga0587073_0048976_263_523 84
242 3300059504 Ga0587082_073552 Ga0587082_073552_410_670 84
243 3300059505 Ga0587083_0104078 Ga0587083_0104078_306_566 84
244 3300059644 Ga0587075_091992 Ga0587075_091992_276_536 84

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02148

zf-UBP

Zn-finger in ubiquitin-hydrolases and other protein

22

91

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zux-assembly1.cif.gz_Z saga dub module ubp8/sgf11/sus1/sgf73 bound to ubiqitinated nucleosome 0.7272 32 69
4w4u-assembly2.cif.gz_D structure of yeast saga dubm with sgf73 y57a mutant at 2.8 angstroms resolution 0.6871 32 69
4w4u-assembly1.cif.gz_A structure of yeast saga dubm with sgf73 y57a mutant at 2.8 angstroms resolution 0.6862 32 69
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6658 3 82
3m99-assembly1.cif.gz_A structure of the ubp8-sgf11-sgf73-sus1 saga dub module 0.64 18 69
ID Description Score Start End Superfamily
af_Q55AP9_45_203_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8159 32 56 3.30.40.10
af_Q5SMK9_168_245_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8102 31 47 3.30.40.10
af_D3ZTX7_17_139_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7208 16 69 3.30.40.10
af_Q7Z569_302_376_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7126 11 71 3.30.40.10
af_Q9VRP5_168_480_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.7006 31 43 3.90.70.10
ID Description Score Start End GO Terms
AF-X6N9N0-F1-model_v4 Uncharacterized protein 0.9106 30 70 GO:0004843
GO:0008270
GO:0016579
AF-A0A7C3KJV7-F1-model_v4 C2H2-type domain-containing protein 0.8422 21 73 GO:0008270
AF-A0A7W4UQ82-F1-model_v4 UBP-type domain-containing protein 0.827 15 74 GO:0008270
AF-A0A7K1TTA7-F1-model_v4 UBP-type domain-containing protein 0.8172 15 74 GO:0008270
AF-A0A1Q4ZYX5-F1-model_v4 deleted 0.8149 15 74

Feature Viewer

pLDDT pTM Quality
64.66 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map