F356171

General Info

Members Datasets Scaffolds Average Seq Length
244 160 488 131

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10006437|Ga0070658_100064375
Length 153
Sequence MERIVLFDGVCNFCNGAVNWIIGHDPHGAFRFAPLQSEIGERLTRQYAVPENIDSIVLIEDGRAFTHSSAGLRIARGLGGIWKAGYAGILIPRPIRDALYRWFASNRXXXXGKQDACMIPTPEVRSRFLSEPTGIVAVKEAAGALIYLTRPGE

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
125 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
126 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
134 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
135 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
136 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
137 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
138 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
139 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
140 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
141 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
142 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
143 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
144 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
145 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
146 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
147 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
148 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
149 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
150 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
151 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
152 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
153 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
154 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
157 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
158 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
159 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
160 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.95
Metatranscriptomes 0
Isolates 2.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0
Rhizoplane 1.64
Rhizosphere 95.49
Stem 0
Stem Tuber 0
Unclassified 41.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10006437 3300005327 Bacteria 9518
2 JGI24033J26618_1075552 3300002155 Bacteria 511
3 JGI25151J46595_10000767 3300003187 Bacteria 26102
4 rootL2_10136250 3300003322 Bacteria 2380
5 Ga0065714_10070917 3300005288 Bacteria 3728
6 Ga0065704_10370295 3300005289 Bacteria 786
7 Ga0065712_10113496 3300005290 Unclassified 1782
8 Ga0070676_11051801 3300005328 Bacteria 613
9 Ga0070683_100276445 3300005329 Bacteria 1598
10 Ga0070690_100011280 3300005330 Bacteria 5224
11 Ga0070670_100053988 3300005331 Bacteria 3450
12 Ga0070670_100090085 3300005331 Bacteria 2636
13 Ga0070670_100266877 3300005331 Bacteria 1493
14 Ga0070677_10109934 3300005333 Unclassified 1229
15 Ga0070666_10598384 3300005335 Unclassified 804
16 Ga0070680_100483657 3300005336 Unclassified 1058
17 Ga0068868_100498150 3300005338 Bacteria 1067
18 Ga0070660_100147050 3300005339 Bacteria 1893
19 Ga0070661_100016508 3300005344 Bacteria 5221
20 Ga0070661_100110276 3300005344 Bacteria 2054
21 Ga0070661_100672271 3300005344 Bacteria 842
22 Ga0070661_101063071 3300005344 Bacteria 673
23 Ga0070668_101382613 3300005347 Unclassified 641
24 Ga0070669_100625335 3300005353 Unclassified 904
25 Ga0070675_100107028 3300005354 Unclassified 2361
26 Ga0070675_100606326 3300005354 Bacteria 993
27 Ga0070675_101144886 3300005354 Unclassified 716
28 Ga0070671_100155990 3300005355 Bacteria 1929
29 Ga0070671_102116047 3300005355 Bacteria 501
30 Ga0070674_100284325 3300005356 Unclassified 1312
31 Ga0070673_100444570 3300005364 Unclassified 1165
32 Ga0070688_100068181 3300005365 Unclassified 2268
33 Ga0070688_100545304 3300005365 Bacteria 881
34 Ga0070688_100931492 3300005365 Unclassified 687
35 Ga0070659_100089945 3300005366 Unclassified 2460
36 Ga0070667_100148644 3300005367 Bacteria 2056
37 Ga0070700_100611417 3300005441 Unclassified 855
38 Ga0070700_100776677 3300005441 Bacteria 769
39 Ga0070663_101038154 3300005455 Unclassified 714
40 Ga0070678_100254426 3300005456 Bacteria 1474
41 Ga0070662_100219262 3300005457 Bacteria 1517
42 Ga0070662_101164482 3300005457 Bacteria 662
43 Ga0070681_10127544 3300005458 Unclassified 2477
44 Ga0070681_10129091 3300005458 Bacteria 2460
45 Ga0068867_100907891 3300005459 Unclassified 793
46 Ga0068867_101426761 3300005459 Bacteria 643
47 Ga0070679_100232217 3300005530 Unclassified 1804
48 Ga0070684_100017492 3300005535 Bacteria 5887
49 Ga0070684_100241238 3300005535 Unclassified 1651
50 Ga0070684_100386465 3300005535 Unclassified 1289
51 Ga0070672_100284786 3300005543 Unclassified 1398
52 Ga0068855_100072869 3300005563 Bacteria 3991
53 Ga0070664_100025865 3300005564 Bacteria 4866
54 Ga0070664_100071747 3300005564 Bacteria 2968
55 Ga0070664_100310992 3300005564 Unclassified 1426
56 Ga0070664_100359285 3300005564 Bacteria 1326
57 Ga0068857_100008944 3300005577 Bacteria 8676
58 Ga0068857_100168459 3300005577 Bacteria 1990
59 Ga0068854_100582791 3300005578 Unclassified 953
60 Ga0068856_100657966 3300005614 Unclassified 1068
61 Ga0068852_100079393 3300005616 Bacteria 2907
62 Ga0068852_100544086 3300005616 Unclassified 1161
63 Ga0068852_101709550 3300005616 Unclassified 652
64 Ga0068859_100022005 3300005617 Bacteria 6393
65 Ga0068859_100068900 3300005617 Unclassified 3572
66 Ga0068864_100224239 3300005618 Unclassified 1735
67 Ga0068864_100391867 3300005618 Bacteria 1319
68 Ga0068861_101576697 3300005719 Unclassified 646
69 Ga0068851_10197134 3300005834 Unclassified 1122
70 Ga0068851_10242820 3300005834 Unclassified 1019
71 Ga0068870_10308353 3300005840 Unclassified 1001
72 Ga0068863_100409800 3300005841 Unclassified 1327
73 Ga0068863_100758383 3300005841 Bacteria 966
74 Ga0068858_100078018 3300005842 Unclassified 3077
75 Ga0068860_101005894 3300005843 Unclassified 852
76 Ga0097621_100083528 3300006237 Unclassified 2661
77 Ga0068871_100256200 3300006358 Bacteria 1525
78 Ga0097620_100022006 3300006931 Bacteria 6393
79 Ga0097620_100068898 3300006931 Unclassified 3572
80 Ga0105251_10475554 3300009011 Bacteria 581
81 Ga0105245_10457578 3300009098 Bacteria 1286
82 Ga0105245_11285613 3300009098 Unclassified 780
83 Ga0105247_10042720 3300009101 Bacteria 2776
84 Ga0105247_10059840 3300009101 Unclassified 2359
85 Ga0114129_10859078 3300009147 Bacteria 1153
86 Ga0105241_10146486 3300009174 Bacteria 1927
87 Ga0105241_11575414 3300009174 Bacteria 634
88 Ga0105242_10024324 3300009176 Unclassified 4783
89 Ga0105248_10558516 3300009177 Bacteria 1291
90 Ga0105237_10009196 3300009545 Bacteria 10606
91 Ga0105237_10308558 3300009545 Bacteria 1585
92 Ga0105249_11199188 3300009553 Unclassified 830
93 Ga0105239_11185532 3300010375 Bacteria 880
94 Ga0105239_11236288 3300010375 Unclassified 861
95 Ga0157373_10048308 3300013100 Bacteria 3034
96 Ga0157373_10050742 3300013100 Bacteria 2954
97 Ga0157371_10255236 3300013102 Bacteria 1263
98 Ga0157371_10336089 3300013102 Bacteria 1098
99 Ga0157370_11745081 3300013104 Bacteria 559
100 Ga0157369_10187182 3300013105 Unclassified 2177
101 Ga0157374_10040014 3300013296 Bacteria 4316
102 Ga0157374_10171338 3300013296 Bacteria 2117
103 Ga0157374_10725803 3300013296 Unclassified 1007
104 Ga0157378_10069864 3300013297 Bacteria 3152
105 Ga0157378_12232564 3300013297 Bacteria 599
106 Ga0163162_10200895 3300013306 Bacteria 2122
107 Ga0163162_10750091 3300013306 Bacteria 1095
108 Ga0157372_10658939 3300013307 Unclassified 1219
109 Ga0157372_10757329 3300013307 Bacteria 1129
110 Ga0157372_10973565 3300013307 Bacteria 983
111 Ga0157372_11146093 3300013307 Unclassified 899
112 Ga0157372_11672886 3300013307 Bacteria 732
113 Ga0157372_12596607 3300013307 Bacteria 581
114 Ga0157375_10475739 3300013308 Bacteria 1414
115 Ga0157380_10005749 3300014326 Bacteria 8676
116 Ga0157380_10274747 3300014326 Unclassified 1538
117 Ga0157380_11166774 3300014326 Bacteria 812
118 Ga0157379_10186310 3300014968 Bacteria 1876
119 Ga0157379_11146082 3300014968 Bacteria 746
120 Ga0157376_11638388 3300014969 Unclassified 678
121 Ga0163161_10002037 3300017792 Bacteria 14631
122 Ga0163161_10151424 3300017792 Unclassified 1763
123 Ga0209025_1000041 3300025294 Bacteria 373694
124 Ga0207656_10099260 3300025321 Bacteria 1333
125 Ga0207710_10206191 3300025900 Bacteria 972
126 Ga0207705_10055808 3300025909 Bacteria 2848
127 Ga0207707_10506356 3300025912 Unclassified 1029
128 Ga0207671_10000063 3300025914 Bacteria 170060
129 Ga0207671_10000857 3300025914 Bacteria 38575
130 Ga0207671_10118061 3300025914 Bacteria 2025
131 Ga0207649_10035002 3300025920 Bacteria 3014
132 Ga0207652_11026180 3300025921 Unclassified 724
133 Ga0207650_10000839 3300025925 Bacteria 23292
134 Ga0207650_10071979 3300025925 Unclassified 2602
135 Ga0207650_10880129 3300025925 Bacteria 760
136 Ga0207659_10023089 3300025926 Bacteria 4148
137 Ga0207659_10190989 3300025926 Bacteria 1630
138 Ga0207687_10873239 3300025927 Unclassified 769
139 Ga0207644_10108723 3300025931 Bacteria 2094
140 Ga0207644_11030736 3300025931 Bacteria 691
141 Ga0207644_11731163 3300025931 Bacteria 523
142 Ga0207706_11414421 3300025933 Unclassified 570
143 Ga0207704_10050941 3300025938 Unclassified 2500
144 Ga0207691_10234673 3300025940 Bacteria 1587
145 Ga0207691_10357132 3300025940 Unclassified 1250
146 Ga0207711_10067845 3300025941 Unclassified 3088
147 Ga0207661_10123746 3300025944 Bacteria 2206
148 Ga0207679_10028326 3300025945 Bacteria 3885
149 Ga0207679_10053203 3300025945 Bacteria 2973
150 Ga0207679_10640727 3300025945 Bacteria 960
151 Ga0207679_11271646 3300025945 Bacteria 675
152 Ga0207712_10009826 3300025961 Bacteria 6063
153 Ga0207712_10963176 3300025961 Unclassified 756
154 Ga0207640_10083672 3300025981 Bacteria 2188
155 Ga0207658_10517774 3300025986 Bacteria 1064
156 Ga0207658_10697363 3300025986 Bacteria 917
157 Ga0207677_10687625 3300026023 Bacteria 906
158 Ga0207703_11352109 3300026035 Bacteria 685
159 Ga0207639_10011671 3300026041 Bacteria 6105
160 Ga0207641_10551449 3300026088 Bacteria 1124
161 Ga0207648_10263365 3300026089 Bacteria 1539
162 Ga0207648_10286604 3300026089 Bacteria 1474
163 Ga0207676_10184068 3300026095 Bacteria 1832
164 Ga0207674_10022406 3300026116 Bacteria 6783
165 Ga0207674_10045763 3300026116 Bacteria 4498
166 Ga0207675_100952521 3300026118 Unclassified 876
167 Ga0207698_10440506 3300026142 Bacteria 1255
168 Ga0268265_10409730 3300028380 Bacteria 1255
169 Ga0268264_10028859 3300028381 Unclassified 4541
170 Ga0307408_100232057 3300031548 Bacteria 1512
171 Ga0307408_100388678 3300031548 Bacteria 1195
172 Ga0307408_100738896 3300031548 Bacteria 888
173 Ga0307408_101241730 3300031548 Unclassified 696
174 Ga0307408_101689439 3300031548 Bacteria 603
175 Ga0307516_10854873 3300031730 Unclassified 574
176 Ga0307405_10363135 3300031731 Unclassified 1121
177 Ga0307405_11546308 3300031731 Unclassified 584
178 Ga0307413_10223959 3300031824 Unclassified 1376
179 Ga0307410_10228000 3300031852 Unclassified 1437
180 Ga0307410_10247329 3300031852 Unclassified 1385
181 Ga0307410_10316150 3300031852 Unclassified 1237
182 Ga0307406_10086340 3300031901 Bacteria 2101
183 Ga0307406_10118037 3300031901 Unclassified 1839
184 Ga0307407_10112166 3300031903 Unclassified 1714
185 Ga0307412_10497477 3300031911 Unclassified 1014
186 Ga0307412_10733643 3300031911 Bacteria 851
187 Ga0307412_11023824 3300031911 Unclassified 731
188 Ga0307409_100395657 3300031995 Unclassified 1318
189 Ga0307416_100022388 3300032002 Bacteria 4561
190 Ga0307416_101988505 3300032002 Unclassified 684
191 Ga0307414_10749138 3300032004 Unclassified 888
192 Ga0307414_10790100 3300032004 Bacteria 865
193 Ga0307411_10220118 3300032005 Unclassified 1472
194 Ga0307411_11462139 3300032005 Bacteria 627
195 Ga0307415_100514384 3300032126 Bacteria 1049
196 Ga0307415_100603215 3300032126 Unclassified 977
197 Ga0307415_100743974 3300032126 Bacteria 889
198 Ga0395900_0733019 3300037418 Bacteria 920
199 Ga0395898_0658016 3300037466 Bacteria 990
200 Ga0395905_0128411 3300037471 Bacteria 2384
201 Ga0395905_0346641 3300037471 Bacteria 1377
202 Ga0451849_1006165 3300041505 Bacteria 1378
203 Ga0466972_0050895 3300044658 Bacteria 1999
204 Ga0453683_0400438 3300044673 Bacteria 885
205 Ga0453683_0584973 3300044673 Unclassified 727
206 Ga0453684_0052095 3300044712 Bacteria 5356
207 Ga0451576_0782130 3300045051 Bacteria 1002
208 Ga0451576_2114751 3300045051 Bacteria 579
209 Ga0496104_0463542 3300048907 Bacteria 1179
210 Ga0496105_0129903 3300048908 Bacteria 2077
211 Ga0496109_0093822 3300048912 Bacteria 2778
212 Ga0496110_1246977 3300048913 Unclassified 652
213 Ga0501298_080358 3300049521 Unclassified 716
214 Ga0501198_012795 3300049649 Unclassified 1264
215 Ga0501199_042424 3300049650 Unclassified 593
216 Ga0501201_014261 3300049651 Unclassified 802
217 Ga0501202_009156 3300049652 Bacteria 1815
218 Ga0501209_170079 3300049656 Unclassified 662
219 Ga0501216_021813 3300049660 Unclassified 1128
220 Ga0501217_023457 3300049661 Unclassified 1470
221 Ga0501217_318091 3300049661 Bacteria 517
222 Ga0501223_030257 3300049663 Unclassified 1053
223 Ga0501223_030634 3300049663 Unclassified 1046
224 Ga0501236_033215 3300049670 Unclassified 825
225 Ga0501250_043353 3300049680 Unclassified 668
226 Ga0501250_060760 3300049680 Unclassified 603
227 Ga0501253_153235 3300049683 Unclassified 583
228 Ga0501259_063910 3300049688 Unclassified 775
229 Ga0501261_128573 3300049690 Unclassified 509
230 Ga0501225_0053252 3300049705 Unclassified 1129
231 Ga0501234_008466 3300049707 Unclassified 1603
232 Ga0501245_011719 3300049708 Bacteria 1279
233 Ga0501245_158065 3300049708 Unclassified 506
234 Ga0501263_045914 3300049760 Unclassified 653
235 Ga0501270_131906 3300049767 Bacteria 554
236 Ga0501280_074047 3300049776 Unclassified 615
237 Ga0501204_074190 3300049850 Unclassified 566
238 Ga0501212_019376 3300049851 Unclassified 1042
239 nmdc:mga05p37_487903_c1 3300050507 Bacteria 1417
240 2586209387 2585427687 Bacteria 5544917
241 2817481451 2816332295 Bacteria 4352468
242 2857462072 2857460504 Bacteria 5194327
243 2945999196 2945997725 Bacteria 6404843
244 3006861878 3006858327 Bacteria 4317835
245 Ga0070658_10006437
246 JGI24033J26618_1075552
247 JGI25151J46595_10000767
248 rootL2_10136250
249 Ga0065714_10070917
250 Ga0065704_10370295
251 Ga0065712_10113496
252 Ga0070676_11051801
253 Ga0070683_100276445
254 Ga0070690_100011280
255 Ga0070670_100053988
256 Ga0070670_100090085
257 Ga0070670_100266877
258 Ga0070677_10109934
259 Ga0070666_10598384
260 Ga0070680_100483657
261 Ga0068868_100498150
262 Ga0070660_100147050
263 Ga0070661_100016508
264 Ga0070661_100110276
265 Ga0070661_100672271
266 Ga0070661_101063071
267 Ga0070668_101382613
268 Ga0070669_100625335
269 Ga0070675_100107028
270 Ga0070675_100606326
271 Ga0070675_101144886
272 Ga0070671_100155990
273 Ga0070671_102116047
274 Ga0070674_100284325
275 Ga0070673_100444570
276 Ga0070688_100068181
277 Ga0070688_100545304
278 Ga0070688_100931492
279 Ga0070659_100089945
280 Ga0070667_100148644
281 Ga0070700_100611417
282 Ga0070700_100776677
283 Ga0070663_101038154
284 Ga0070678_100254426
285 Ga0070662_100219262
286 Ga0070662_101164482
287 Ga0070681_10127544
288 Ga0070681_10129091
289 Ga0068867_100907891
290 Ga0068867_101426761
291 Ga0070679_100232217
292 Ga0070684_100017492
293 Ga0070684_100241238
294 Ga0070684_100386465
295 Ga0070672_100284786
296 Ga0068855_100072869
297 Ga0070664_100025865
298 Ga0070664_100071747
299 Ga0070664_100310992
300 Ga0070664_100359285
301 Ga0068857_100008944
302 Ga0068857_100168459
303 Ga0068854_100582791
304 Ga0068856_100657966
305 Ga0068852_100079393
306 Ga0068852_100544086
307 Ga0068852_101709550
308 Ga0068859_100022005
309 Ga0068859_100068900
310 Ga0068864_100224239
311 Ga0068864_100391867
312 Ga0068861_101576697
313 Ga0068851_10197134
314 Ga0068851_10242820
315 Ga0068870_10308353
316 Ga0068863_100409800
317 Ga0068863_100758383
318 Ga0068858_100078018
319 Ga0068860_101005894
320 Ga0097621_100083528
321 Ga0068871_100256200
322 Ga0097620_100022006
323 Ga0097620_100068898
324 Ga0105251_10475554
325 Ga0105245_10457578
326 Ga0105245_11285613
327 Ga0105247_10042720
328 Ga0105247_10059840
329 Ga0114129_10859078
330 Ga0105241_10146486
331 Ga0105241_11575414
332 Ga0105242_10024324
333 Ga0105248_10558516
334 Ga0105237_10009196
335 Ga0105237_10308558
336 Ga0105249_11199188
337 Ga0105239_11185532
338 Ga0105239_11236288
339 Ga0157373_10048308
340 Ga0157373_10050742
341 Ga0157371_10255236
342 Ga0157371_10336089
343 Ga0157370_11745081
344 Ga0157369_10187182
345 Ga0157374_10040014
346 Ga0157374_10171338
347 Ga0157374_10725803
348 Ga0157378_10069864
349 Ga0157378_12232564
350 Ga0163162_10200895
351 Ga0163162_10750091
352 Ga0157372_10658939
353 Ga0157372_10757329
354 Ga0157372_10973565
355 Ga0157372_11146093
356 Ga0157372_11672886
357 Ga0157372_12596607
358 Ga0157375_10475739
359 Ga0157380_10005749
360 Ga0157380_10274747
361 Ga0157380_11166774
362 Ga0157379_10186310
363 Ga0157379_11146082
364 Ga0157376_11638388
365 Ga0163161_10002037
366 Ga0163161_10151424
367 Ga0209025_1000041
368 Ga0207656_10099260
369 Ga0207710_10206191
370 Ga0207705_10055808
371 Ga0207707_10506356
372 Ga0207671_10000063
373 Ga0207671_10000857
374 Ga0207671_10118061
375 Ga0207649_10035002
376 Ga0207652_11026180
377 Ga0207650_10000839
378 Ga0207650_10071979
379 Ga0207650_10880129
380 Ga0207659_10023089
381 Ga0207659_10190989
382 Ga0207687_10873239
383 Ga0207644_10108723
384 Ga0207644_11030736
385 Ga0207644_11731163
386 Ga0207706_11414421
387 Ga0207704_10050941
388 Ga0207691_10234673
389 Ga0207691_10357132
390 Ga0207711_10067845
391 Ga0207661_10123746
392 Ga0207679_10028326
393 Ga0207679_10053203
394 Ga0207679_10640727
395 Ga0207679_11271646
396 Ga0207712_10009826
397 Ga0207712_10963176
398 Ga0207640_10083672
399 Ga0207658_10517774
400 Ga0207658_10697363
401 Ga0207677_10687625
402 Ga0207703_11352109
403 Ga0207639_10011671
404 Ga0207641_10551449
405 Ga0207648_10263365
406 Ga0207648_10286604
407 Ga0207676_10184068
408 Ga0207674_10022406
409 Ga0207674_10045763
410 Ga0207675_100952521
411 Ga0207698_10440506
412 Ga0268265_10409730
413 Ga0268264_10028859
414 Ga0307408_100232057
415 Ga0307408_100388678
416 Ga0307408_100738896
417 Ga0307408_101241730
418 Ga0307408_101689439
419 Ga0307516_10854873
420 Ga0307405_10363135
421 Ga0307405_11546308
422 Ga0307413_10223959
423 Ga0307410_10228000
424 Ga0307410_10247329
425 Ga0307410_10316150
426 Ga0307406_10086340
427 Ga0307406_10118037
428 Ga0307407_10112166
429 Ga0307412_10497477
430 Ga0307412_10733643
431 Ga0307412_11023824
432 Ga0307409_100395657
433 Ga0307416_100022388
434 Ga0307416_101988505
435 Ga0307414_10749138
436 Ga0307414_10790100
437 Ga0307411_10220118
438 Ga0307411_11462139
439 Ga0307415_100514384
440 Ga0307415_100603215
441 Ga0307415_100743974
442 Ga0395900_0733019
443 Ga0395898_0658016
444 Ga0395905_0128411
445 Ga0395905_0346641
446 Ga0451849_1006165
447 Ga0466972_0050895
448 Ga0453683_0400438
449 Ga0453683_0584973
450 Ga0453684_0052095
451 Ga0451576_0782130
452 Ga0451576_2114751
453 Ga0496104_0463542
454 Ga0496105_0129903
455 Ga0496109_0093822
456 Ga0496110_1246977
457 Ga0501298_080358
458 Ga0501198_012795
459 Ga0501199_042424
460 Ga0501201_014261
461 Ga0501202_009156
462 Ga0501209_170079
463 Ga0501216_021813
464 Ga0501217_023457
465 Ga0501217_318091
466 Ga0501223_030257
467 Ga0501223_030634
468 Ga0501236_033215
469 Ga0501250_043353
470 Ga0501250_060760
471 Ga0501253_153235
472 Ga0501259_063910
473 Ga0501261_128573
474 Ga0501225_0053252
475 Ga0501234_008466
476 Ga0501245_011719
477 Ga0501245_158065
478 Ga0501263_045914
479 Ga0501270_131906
480 Ga0501280_074047
481 Ga0501204_074190
482 Ga0501212_019376
483 nmdc:mga05p37_487903_c1
484 2586209387
485 2817481451
486 2857462072
487 2945999196
488 3006861878

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04134

DCC1-like

DCC1-like thiol-disulfide oxidoreductase

5

113

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mp4-assembly1.cif.gz_B crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.6678 3 80
3wzt-assembly5.cif.gz_E crystal structure of trx3 domain of uggt (detergent-unbound form) 0.6486 1 69
6sgb-assembly1.cif.gz_Fa mt-ssu assemblosome of trypanosoma brucei 0.6088 4 67
1a8y-assembly1.cif.gz_A-2 crystal structure of calsequestrin from rabbit skeletal muscle sarcoplasmic reticulum at 2.4 a resolution 0.6068 2 77
3ic8-assembly2.cif.gz_B the crystal structure of a gst-like protein from pseudomonas syringae to 2.4a 0.6057 1 80
ID Description Score Start End Superfamily
af_Q54M17_35_145_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8902 8 116 3.40.30.10
af_Q54M17_35_145_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8681 8 116 3.40.30.10
af_Q9LR85_76_187_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8656 8 116 3.40.30.10
af_A0A0R0FU59_17_124_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8635 11 115 3.40.30.10
af_Q2FWB6_4_113_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8564 8 124 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A836TQV5-F1-model_v4 DUF393 domain-containing protein 0.9547 1 133 GO:0015035
AF-A0A160DWF1-F1-model_v4 Thiol-disulfide oxidoreductase DCC 0.9529 1 133 GO:0015035
AF-A0A3M1NQ81-F1-model_v4 DUF393 domain-containing protein 0.9526 4 133 GO:0015035
AF-A0A348TPX5-F1-model_v4 Thiol-disulfide oxidoreductase DCC 0.9519 4 133 GO:0015035
AF-A0A2A5K5D1-F1-model_v4 deleted 0.9517 3 132

Map