F355826

General Info

Members Datasets Scaffolds Average Seq Length
243 162 486 229

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0165190|Ga0451577_0165190_340_1131
Length 263
Sequence MAERPISHVPPGALALLAIALAAQIGVHRWQGAPRVAAEDFPPPPRAEVIRLASLGEPIAAAKLLMLYVQAFDYRAGTEIGYRQLDYERVAGWLKRIVDLDPRSQYPLFLATRVYADVPDPAKARLMLELVHEEYLRDPDRRWPWMAEATLLAKHRLKDLPLARRYAVALQTHTKTKDAPLWVRQMEPFILEDMNELEAARVMLGGMIASGQVKDERDLQLLQRHLQDLEARQRFAPQNKASSPRRGIDNSDESPTENNRKTP

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
38 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
72 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
73 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
74 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
75 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
76 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
77 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
78 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
79 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
80 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
81 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
82 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
83 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
84 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
85 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
90 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
91 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
92 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
93 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
94 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
104 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
105 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
106 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
109 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
115 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
116 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
147 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
148 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
157 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 0
Rhizosphere 99.59
Stem 0
Stem Tuber 0
Unclassified 10.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0165190 3300042876 Bacteria 1994
2 Ga0070676_10273301 3300005328 Bacteria 1136
3 Ga0068869_100484211 3300005334 Bacteria 1031
4 Ga0070680_100046763 3300005336 Bacteria 3521
5 Ga0070691_10018405 3300005341 Bacteria 3221
6 Ga0070687_100065491 3300005343 Bacteria 1934
7 Ga0070692_10092389 3300005345 Bacteria 1647
8 Ga0070668_100101383 3300005347 Bacteria 2281
9 Ga0070673_100061551 3300005364 Bacteria 2978
10 Ga0070673_100330817 3300005364 Bacteria 1348
11 Ga0070688_100222358 3300005365 Unclassified 1331
12 Ga0070713_100510412 3300005436 Bacteria 1135
13 Ga0070705_100037900 3300005440 Bacteria 2723
14 Ga0070700_100003401 3300005441 Bacteria 8201
15 Ga0070694_100257968 3300005444 Bacteria 1321
16 Ga0070694_100393961 3300005444 Bacteria 1083
17 Ga0068867_100009044 3300005459 Bacteria 7029
18 Ga0070697_100045404 3300005536 Bacteria 3561
19 Ga0070697_100124771 3300005536 Bacteria 2156
20 Ga0070672_100431544 3300005543 Bacteria 1133
21 Ga0070695_100040300 3300005545 Bacteria 2957
22 Ga0070695_100157309 3300005545 Bacteria 1592
23 Ga0070696_100041856 3300005546 Bacteria 3166
24 Ga0070693_100218998 3300005547 Unclassified 1246
25 Ga0070704_100003075 3300005549 Bacteria 9505
26 Ga0070704_100003628 3300005549 Bacteria 8873
27 Ga0070704_100525338 3300005549 Bacteria 1031
28 Ga0068856_100152524 3300005614 Bacteria 2320
29 Ga0070702_100152148 3300005615 Bacteria 1486
30 Ga0068859_100944401 3300005617 Bacteria 946
31 Ga0068870_10026332 3300005840 Bacteria 2898
32 Ga0081539_10002798 3300005985 Bacteria 23335
33 Ga0070716_100003897 3300006173 Bacteria 7083
34 Ga0070716_100294302 3300006173 Unclassified 1126
35 Ga0068871_100321726 3300006358 Bacteria 1362
36 Ga0075430_100030420 3300006846 Bacteria 4586
37 Ga0075430_100317776 3300006846 Bacteria 1287
38 Ga0075430_100628830 3300006846 Bacteria 885
39 Ga0075431_100360453 3300006847 Bacteria 1460
40 Ga0075433_10036303 3300006852 Bacteria 4244
41 Ga0075433_10229920 3300006852 Bacteria 1647
42 Ga0075433_10462319 3300006852 Unclassified 1118
43 Ga0075434_100000125 3300006871 Bacteria 45534
44 Ga0068865_100048805 3300006881 Bacteria 2914
45 Ga0075436_100012498 3300006914 Bacteria 5819
46 Ga0075436_100014362 3300006914 Bacteria 5420
47 Ga0075436_100160073 3300006914 Bacteria 1587
48 Ga0097620_100944596 3300006931 Bacteria 946
49 Ga0075435_100000356 3300007076 Bacteria 28102
50 Ga0075435_100000550 3300007076 Bacteria 23021
51 Ga0099794_10007422 3300007265 Bacteria 4506
52 Ga0099794_10121320 3300007265 Bacteria 1315
53 Ga0099795_10016673 3300007788 Unclassified 2328
54 Ga0111539_10043043 3300009094 Bacteria 5417
55 Ga0111539_10206626 3300009094 Bacteria 2289
56 Ga0111539_10353353 3300009094 Bacteria 1710
57 Ga0105243_10097374 3300009148 Bacteria 2435
58 Ga0105249_10020869 3300009553 Bacteria 5858
59 Ga0157380_10043195 3300014326 Bacteria 3528
60 Ga0157380_10342885 3300014326 Bacteria 1394
61 Ga0207645_10216073 3300025907 Bacteria 1263
62 Ga0207643_10017248 3300025908 Bacteria 3946
63 Ga0207643_10074600 3300025908 Bacteria 1957
64 Ga0207660_10038746 3300025917 Bacteria 3328
65 Ga0207660_10371898 3300025917 Bacteria 1148
66 Ga0207681_10005305 3300025923 Bacteria 7920
67 Ga0207659_10011629 3300025926 Bacteria 5567
68 Ga0207700_10094887 3300025928 Bacteria 2365
69 Ga0207709_10013688 3300025935 Bacteria 4475
70 Ga0207669_10045594 3300025937 Bacteria 2584
71 Ga0207704_10017806 3300025938 Bacteria 3694
72 Ga0207704_10318288 3300025938 Bacteria 1199
73 Ga0207691_10123287 3300025940 Bacteria 2294
74 Ga0207691_10302711 3300025940 Bacteria 1373
75 Ga0207689_10091116 3300025942 Bacteria 2505
76 Ga0207651_10077030 3300025960 Bacteria 2386
77 Ga0207651_10226947 3300025960 Bacteria 1513
78 Ga0207712_10023675 3300025961 Bacteria 4057
79 Ga0207712_10519136 3300025961 Unclassified 1020
80 Ga0207668_10083197 3300025972 Bacteria 2328
81 Ga0207708_10003507 3300026075 Bacteria 11567
82 Ga0207708_10359698 3300026075 Bacteria 1196
83 Ga0207702_10117107 3300026078 Bacteria 2379
84 Ga0207648_10030706 3300026089 Bacteria 4756
85 Ga0207674_10090972 3300026116 Bacteria 3042
86 Ga0207675_100023572 3300026118 Bacteria 5726
87 Ga0209996_1006021 3300027395 Bacteria 1560
88 Ga0210000_1002563 3300027462 Bacteria 2592
89 Ga0209588_1000751 3300027671 Bacteria 8220
90 Ga0209966_1000643 3300027695 Bacteria 7834
91 Ga0209998_10055934 3300027717 Bacteria 921
92 Ga0207428_10027544 3300027907 Bacteria 4731
93 Ga0307408_100227064 3300031548 Bacteria 1527
94 Ga0307412_10689858 3300031911 Bacteria 875
95 Ga0307416_100095555 3300032002 Bacteria 2567
96 Ga0307411_10034790 3300032005 Bacteria 3139
97 Ga0373932_0022059 3300035112 Bacteria 1688
98 Ga0373936_0002633 3300035113 Bacteria 6716
99 Ga0373939_0209316 3300035114 Unclassified 741
100 Ga0373953_0000218 3300035117 Bacteria 15633
101 Ga0373954_0000088 3300035118 Bacteria 31362
102 Ga0373954_0002616 3300035118 Bacteria 7574
103 Ga0373954_0016586 3300035118 Bacteria 3299
104 Ga0373956_0000812 3300035119 Bacteria 13007
105 Ga0373957_0000703 3300035120 Bacteria 8673
106 Ga0373957_0148193 3300035120 Unclassified 962
107 Ga0373946_0019153 3300035171 Unclassified 2635
108 Ga0373955_0000850 3300035172 Bacteria 13073
109 Ga0373942_0028866 3300035207 Bacteria 1452
110 Ga0373961_0003169 3300035241 Bacteria 4104
111 Ga0373962_0071462 3300035242 Bacteria 1038
112 Ga0373924_0094820 3300035410 Unclassified 1279
113 Ga0373931_0253941 3300035691 Bacteria 1070
114 Ga0373935_0016882 3300035692 Bacteria 4420
115 Ga0373933_0019887 3300035724 Bacteria 3800
116 Ga0373933_0224432 3300035724 Unclassified 1206
117 Ga0373937_0000707 3300036401 Bacteria 29090
118 Ga0373937_0013232 3300036401 Bacteria 7267
119 Ga0373937_0288128 3300036401 Bacteria 1551
120 Ga0439441_003577 3300042001 Bacteria 2300
121 Ga0439441_046365 3300042001 Unclassified 884
122 Ga0439443_024148 3300042003 Unclassified 973
123 Ga0439435_0036899 3300042436 Unclassified 1352
124 Ga0439444_0028205 3300042437 Unclassified 1038
125 Ga0439460_0002872 3300042461 Bacteria 4148
126 Ga0439460_0022470 3300042461 Bacteria 1730
127 Ga0451577_0425535 3300042876 Unclassified 1206
128 Ga0466964_0013075 3300044706 Bacteria 3146
129 Ga0451576_0234550 3300045051 Bacteria 1916
130 Ga0451576_0544092 3300045051 Bacteria 1220
131 Ga0451576_1153775 3300045051 Bacteria 810
132 Ga0466967_0004645 3300045976 Bacteria 9315
133 Ga0495592_0018036 3300046454 Bacteria 5361
134 Ga0495629_0169015 3300046459 Bacteria 1518
135 Ga0495651_0021165 3300046462 Bacteria 5052
136 Ga0495653_0003554 3300046463 Bacteria 12560
137 Ga0495580_0018473 3300046472 Bacteria 5191
138 Ga0495662_0043520 3300046476 Bacteria 2167
139 Ga0495594_0095408 3300046499 Bacteria 1670
140 Ga0495606_0000087 3300046507 Bacteria 156407
141 Ga0495608_0001593 3300046511 Bacteria 16235
142 Ga0495618_0005338 3300046514 Bacteria 7840
143 Ga0495630_0006447 3300046517 Bacteria 8347
144 Ga0495666_0001897 3300046526 Bacteria 10319
145 Ga0495640_0015567 3300046533 Bacteria 5719
146 Ga0495640_0022950 3300046533 Bacteria 4557
147 Ga0495587_0004286 3300046536 Bacteria 9420
148 Ga0495667_0015220 3300046559 Bacteria 5192
149 Ga0495667_0152360 3300046559 Unclassified 1488
150 Ga0495634_0011351 3300046642 Bacteria 6488
151 Ga0495635_0285773 3300046663 Bacteria 1107
152 Ga0495657_0006018 3300046675 Bacteria 9528
153 Ga0495599_0025963 3300046678 Bacteria 3669
154 Ga0495647_0012627 3300046681 Bacteria 2912
155 Ga0495658_0053209 3300046683 Bacteria 2298
156 Ga0495669_0032385 3300046684 Bacteria 2298
157 Ga0495613_0017100 3300046689 Bacteria 5399
158 Ga0495624_0119128 3300046690 Bacteria 1622
159 Ga0495600_0000823 3300046809 Bacteria 16463
160 Ga0495581_0603080 3300047315 Bacteria 636
161 Ga0495604_0001318 3300047317 Bacteria 20265
162 Ga0495636_0010050 3300047318 Bacteria 3732
163 Ga0495636_0142302 3300047318 Bacteria 1072
164 Ga0495674_0004528 3300047319 Bacteria 13370
165 Ga0495684_0005050 3300047471 Bacteria 10302
166 Ga0501031_0132187 3300049568 Bacteria 1630
167 Ga0501036_0024903 3300049572 Bacteria 5048
168 Ga0501036_0815144 3300049572 Bacteria 768
169 Ga0501037_0063154 3300049573 Unclassified 2700
170 Ga0501037_0290565 3300049573 Unclassified 1137
171 Ga0501038_0044349 3300049574 Bacteria 3865
172 Ga0501038_0063807 3300049574 Bacteria 3143
173 Ga0501039_0006950 3300049575 Bacteria 8613
174 Ga0501039_0008164 3300049575 Bacteria 7978
175 Ga0501039_0083590 3300049575 Bacteria 2486
176 Ga0501039_0090070 3300049575 Bacteria 2391
177 Ga0501040_0048601 3300049576 Bacteria 2899
178 Ga0501040_0066433 3300049576 Bacteria 2485
179 Ga0501041_0006818 3300049577 Bacteria 6692
180 Ga0501041_0056117 3300049577 Bacteria 2406
181 Ga0501041_0082523 3300049577 Bacteria 1980
182 Ga0501041_0094449 3300049577 Bacteria 1847
183 Ga0501041_0119857 3300049577 Bacteria 1635
184 Ga0501041_0432234 3300049577 Unclassified 835
185 Ga0501042_0001226 3300049578 Bacteria 14916
186 Ga0501042_0028318 3300049578 Bacteria 3946
187 Ga0501042_0178734 3300049578 Bacteria 1531
188 Ga0501043_0266798 3300049579 Unclassified 1315
189 Ga0501046_0109346 3300049580 Bacteria 2113
190 Ga0501046_0357200 3300049580 Bacteria 1060
191 Ga0501048_0012944 3300049582 Bacteria 6198
192 Ga0501048_0166109 3300049582 Bacteria 1563
193 Ga0501068_0027743 3300049584 Unclassified 3345
194 Ga0501071_0000477 3300049587 Bacteria 20202
195 Ga0501071_0014170 3300049587 Bacteria 5451
196 Ga0501071_0038609 3300049587 Bacteria 3412
197 Ga0501072_0000954 3300049588 Bacteria 21313
198 Ga0501072_0036965 3300049588 Bacteria 3830
199 Ga0501072_0104467 3300049588 Bacteria 2252
200 Ga0501072_0231127 3300049588 Bacteria 1473
201 Ga0501074_0102591 3300049590 Bacteria 2048
202 Ga0501075_0001149 3300049591 Bacteria 17099
203 Ga0501075_0015283 3300049591 Bacteria 5507
204 Ga0501075_0064401 3300049591 Bacteria 2765
205 Ga0501076_0000899 3300049592 Bacteria 19343
206 Ga0501076_0021752 3300049592 Bacteria 4923
207 Ga0501076_0108695 3300049592 Unclassified 2240
208 Ga0501079_0001584 3300049741 Bacteria 16172
209 Ga0501079_0165649 3300049741 Bacteria 1724
210 Ga0501080_0035342 3300049742 Bacteria 4663
211 Ga0501080_0045150 3300049742 Bacteria 4102
212 Ga0501080_0078672 3300049742 Bacteria 3066
213 Ga0501080_0378220 3300049742 Bacteria 1276
214 Ga0501081_0001112 3300049743 Bacteria 16157
215 Ga0501081_0008960 3300049743 Bacteria 6503
216 Ga0501081_0093506 3300049743 Bacteria 2117
217 Ga0501081_0358720 3300049743 Unclassified 1075
218 Ga0501083_0081636 3300049744 Bacteria 2143
219 Ga0501035_0884540 3300049822 Bacteria 708
220 Ga0501045_0005347 3300049824 Bacteria 8894
221 nmdc:mga0k408_93951_c1 3300050493 Bacteria 1763
222 nmdc:mga09592_378205_c1 3300050508 Bacteria 1225
223 nmdc:mga0qj67_118235_c1 3300050509 Bacteria 2143
224 nmdc:mga0qj67_25957_c1 3300050509 Bacteria 4532
225 nmdc:mga0qj67_5039_c1 3300050509 Bacteria 9601
226 nmdc:mga06r32_197393_c1 3300050510 Bacteria 2000
227 nmdc:mga08y16_27975_c1 3300050511 Bacteria 5944
228 nmdc:mga08y16_282932_c1 3300050511 Bacteria 1710
229 nmdc:mga0n895_196_c1 3300050512 Bacteria 37551
230 nmdc:mga0rr50_1167_c1 3300050513 Bacteria 14294
231 nmdc:mga08x19_295856_c1 3300050514 Unclassified 1124
232 nmdc:mga08x19_64845_c1 3300050514 Bacteria 2371
233 nmdc:mga08x19_75938_c1 3300050514 Bacteria 2198
234 nmdc:mga08x19_9584_c1 3300050514 Bacteria 5797
235 nmdc:mga0a205_26384_c1 3300050515 Bacteria 5539
236 nmdc:mga0a205_356657_c1 3300050515 Unclassified 1329
237 nmdc:mga0a205_367817_c1 3300050515 Bacteria 1304
238 Ga0495595_0012029 3300053084 Bacteria 3629
239 Ga0501084_0129842 3300054114 Bacteria 2121
240 Ga0501082_0003220 3300060353 Bacteria 14228
241 Ga0501082_0020801 3300060353 Bacteria 5659
242 Ga0530510_0000245 3300061734 Bacteria 34065
243 Ga0530510_0000942 3300061734 Bacteria 19199
244 Ga0451577_0165190
245 Ga0070676_10273301
246 Ga0068869_100484211
247 Ga0070680_100046763
248 Ga0070691_10018405
249 Ga0070687_100065491
250 Ga0070692_10092389
251 Ga0070668_100101383
252 Ga0070673_100061551
253 Ga0070673_100330817
254 Ga0070688_100222358
255 Ga0070713_100510412
256 Ga0070705_100037900
257 Ga0070700_100003401
258 Ga0070694_100257968
259 Ga0070694_100393961
260 Ga0068867_100009044
261 Ga0070697_100045404
262 Ga0070697_100124771
263 Ga0070672_100431544
264 Ga0070695_100040300
265 Ga0070695_100157309
266 Ga0070696_100041856
267 Ga0070693_100218998
268 Ga0070704_100003075
269 Ga0070704_100003628
270 Ga0070704_100525338
271 Ga0068856_100152524
272 Ga0070702_100152148
273 Ga0068859_100944401
274 Ga0068870_10026332
275 Ga0081539_10002798
276 Ga0070716_100003897
277 Ga0070716_100294302
278 Ga0068871_100321726
279 Ga0075430_100030420
280 Ga0075430_100317776
281 Ga0075430_100628830
282 Ga0075431_100360453
283 Ga0075433_10036303
284 Ga0075433_10229920
285 Ga0075433_10462319
286 Ga0075434_100000125
287 Ga0068865_100048805
288 Ga0075436_100012498
289 Ga0075436_100014362
290 Ga0075436_100160073
291 Ga0097620_100944596
292 Ga0075435_100000356
293 Ga0075435_100000550
294 Ga0099794_10007422
295 Ga0099794_10121320
296 Ga0099795_10016673
297 Ga0111539_10043043
298 Ga0111539_10206626
299 Ga0111539_10353353
300 Ga0105243_10097374
301 Ga0105249_10020869
302 Ga0157380_10043195
303 Ga0157380_10342885
304 Ga0207645_10216073
305 Ga0207643_10017248
306 Ga0207643_10074600
307 Ga0207660_10038746
308 Ga0207660_10371898
309 Ga0207681_10005305
310 Ga0207659_10011629
311 Ga0207700_10094887
312 Ga0207709_10013688
313 Ga0207669_10045594
314 Ga0207704_10017806
315 Ga0207704_10318288
316 Ga0207691_10123287
317 Ga0207691_10302711
318 Ga0207689_10091116
319 Ga0207651_10077030
320 Ga0207651_10226947
321 Ga0207712_10023675
322 Ga0207712_10519136
323 Ga0207668_10083197
324 Ga0207708_10003507
325 Ga0207708_10359698
326 Ga0207702_10117107
327 Ga0207648_10030706
328 Ga0207674_10090972
329 Ga0207675_100023572
330 Ga0209996_1006021
331 Ga0210000_1002563
332 Ga0209588_1000751
333 Ga0209966_1000643
334 Ga0209998_10055934
335 Ga0207428_10027544
336 Ga0307408_100227064
337 Ga0307412_10689858
338 Ga0307416_100095555
339 Ga0307411_10034790
340 Ga0373932_0022059
341 Ga0373936_0002633
342 Ga0373939_0209316
343 Ga0373953_0000218
344 Ga0373954_0000088
345 Ga0373954_0002616
346 Ga0373954_0016586
347 Ga0373956_0000812
348 Ga0373957_0000703
349 Ga0373957_0148193
350 Ga0373946_0019153
351 Ga0373955_0000850
352 Ga0373942_0028866
353 Ga0373961_0003169
354 Ga0373962_0071462
355 Ga0373924_0094820
356 Ga0373931_0253941
357 Ga0373935_0016882
358 Ga0373933_0019887
359 Ga0373933_0224432
360 Ga0373937_0000707
361 Ga0373937_0013232
362 Ga0373937_0288128
363 Ga0439441_003577
364 Ga0439441_046365
365 Ga0439443_024148
366 Ga0439435_0036899
367 Ga0439444_0028205
368 Ga0439460_0002872
369 Ga0439460_0022470
370 Ga0451577_0425535
371 Ga0466964_0013075
372 Ga0451576_0234550
373 Ga0451576_0544092
374 Ga0451576_1153775
375 Ga0466967_0004645
376 Ga0495592_0018036
377 Ga0495629_0169015
378 Ga0495651_0021165
379 Ga0495653_0003554
380 Ga0495580_0018473
381 Ga0495662_0043520
382 Ga0495594_0095408
383 Ga0495606_0000087
384 Ga0495608_0001593
385 Ga0495618_0005338
386 Ga0495630_0006447
387 Ga0495666_0001897
388 Ga0495640_0015567
389 Ga0495640_0022950
390 Ga0495587_0004286
391 Ga0495667_0015220
392 Ga0495667_0152360
393 Ga0495634_0011351
394 Ga0495635_0285773
395 Ga0495657_0006018
396 Ga0495599_0025963
397 Ga0495647_0012627
398 Ga0495658_0053209
399 Ga0495669_0032385
400 Ga0495613_0017100
401 Ga0495624_0119128
402 Ga0495600_0000823
403 Ga0495581_0603080
404 Ga0495604_0001318
405 Ga0495636_0010050
406 Ga0495636_0142302
407 Ga0495674_0004528
408 Ga0495684_0005050
409 Ga0501031_0132187
410 Ga0501036_0024903
411 Ga0501036_0815144
412 Ga0501037_0063154
413 Ga0501037_0290565
414 Ga0501038_0044349
415 Ga0501038_0063807
416 Ga0501039_0006950
417 Ga0501039_0008164
418 Ga0501039_0083590
419 Ga0501039_0090070
420 Ga0501040_0048601
421 Ga0501040_0066433
422 Ga0501041_0006818
423 Ga0501041_0056117
424 Ga0501041_0082523
425 Ga0501041_0094449
426 Ga0501041_0119857
427 Ga0501041_0432234
428 Ga0501042_0001226
429 Ga0501042_0028318
430 Ga0501042_0178734
431 Ga0501043_0266798
432 Ga0501046_0109346
433 Ga0501046_0357200
434 Ga0501048_0012944
435 Ga0501048_0166109
436 Ga0501068_0027743
437 Ga0501071_0000477
438 Ga0501071_0014170
439 Ga0501071_0038609
440 Ga0501072_0000954
441 Ga0501072_0036965
442 Ga0501072_0104467
443 Ga0501072_0231127
444 Ga0501074_0102591
445 Ga0501075_0001149
446 Ga0501075_0015283
447 Ga0501075_0064401
448 Ga0501076_0000899
449 Ga0501076_0021752
450 Ga0501076_0108695
451 Ga0501079_0001584
452 Ga0501079_0165649
453 Ga0501080_0035342
454 Ga0501080_0045150
455 Ga0501080_0078672
456 Ga0501080_0378220
457 Ga0501081_0001112
458 Ga0501081_0008960
459 Ga0501081_0093506
460 Ga0501081_0358720
461 Ga0501083_0081636
462 Ga0501035_0884540
463 Ga0501045_0005347
464 nmdc:mga0k408_93951_c1
465 nmdc:mga09592_378205_c1
466 nmdc:mga0qj67_118235_c1
467 nmdc:mga0qj67_25957_c1
468 nmdc:mga0qj67_5039_c1
469 nmdc:mga06r32_197393_c1
470 nmdc:mga08y16_27975_c1
471 nmdc:mga08y16_282932_c1
472 nmdc:mga0n895_196_c1
473 nmdc:mga0rr50_1167_c1
474 nmdc:mga08x19_295856_c1
475 nmdc:mga08x19_64845_c1
476 nmdc:mga08x19_75938_c1
477 nmdc:mga08x19_9584_c1
478 nmdc:mga0a205_26384_c1
479 nmdc:mga0a205_356657_c1
480 nmdc:mga0a205_367817_c1
481 Ga0495595_0012029
482 Ga0501084_0129842
483 Ga0501082_0003220
484 Ga0501082_0020801
485 Ga0530510_0000245
486 Ga0530510_0000942

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pc2-assembly1.cif.gz_A solution structure of human mitochondria fission protein fis1 0.6619 92 182
1iyg-assembly1.cif.gz_A solution structure of rsgi ruh-001, a fis1p-like and cgi-135 homologous domain from a mouse cdna 0.6027 92 182
6vk3-assembly1.cif.gz_A cryoem structure of hrd3/yos9 complex 0.5923 73 181
3cvq-assembly1.cif.gz_A structure of peroxisomal targeting signal 1 (pts1) binding domain of trypanosoma brucei peroxin 5 (tbpex5)complexed to pts1 peptide (7-skl) 0.5895 74 184
8fwd-assembly1.cif.gz_P fast and versatile sequence- independent protein docking for nanomaterials design using rpxdock 0.5812 53 160
ID Description Score Start End Superfamily
1pc2A00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6619 92 182 1.25.40.10
af_B3DIC4_390_476_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6403 116 184 1.25.40.10
af_A0A0P0X1V3_1_149_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.6252 74 204 1.25.10.10
af_F4HSZ1_1_345_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.621 54 207 1.25.10.10
af_Q6YPH2_56_247_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.613 75 203 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A0U2Z0T9-F1-model_v4 Tetratricopeptide repeat protein 0.8575 70 169
AF-A0A845GB65-F1-model_v4 Uncharacterized protein 0.814 34 215
AF-A0A1F4F1B0-F1-model_v4 Uncharacterized protein 0.8008 1 160
AF-A0A536X7G8-F1-model_v4 Uncharacterized protein 0.7891 2 195
AF-A0A838RYT7-F1-model_v4 Uncharacterized protein 0.788 34 220

Map