F355739

General Info

Members Datasets Scaffolds Average Seq Length
243 169 486 100

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10081611|Ga0307406_100816114
Length 118
Sequence MANVQDRPGTVGPSCLADPVIVEFDADLWIWAARKGESWTFVTLPVDASEEIRELTDGLRRGFGSVRVRAAIGGSTWTTSIFPDSGRNAYVLPVKRAIRKAESLDTGDVATVTVEILD

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
80 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
81 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
82 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
87 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
96 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
97 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
98 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
99 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
103 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
104 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
105 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
106 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
107 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
108 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
109 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
110 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
111 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
112 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
113 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
114 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
115 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
143 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
144 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
145 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
146 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
147 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
148 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
149 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
150 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
151 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
152 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
153 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 2506783011 Frankia datiscae Dg1 Isolate Nodule
156 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
157 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
158 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
159 2643221711 Terrabacter sp. Root85 Isolate Unclassified
160 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
161 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
162 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
163 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
164 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
165 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
166 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
167 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
168 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
169 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.59
Metatranscriptomes 1.23
Isolates 6.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.58
Nodule 0.41
Rhizoplane 17.7
Rhizosphere 60.91
Stem 0
Stem Tuber 0
Unclassified 8.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_10081611 3300031901 Bacteria 2151
2 JGI25406J46586_10001819 3300003203 Bacteria 10008
3 JGI25406J46586_10030859 3300003203 Unclassified 2012
4 rootH1_10016009 3300003323 Bacteria 1772
5 Ga0006562J51391_1037239 3300003578 Bacteria 1153
6 Ga0006562J51391_1037240 3300003578 Bacteria 1700
7 Ga0070683_100000601 3300005329 Bacteria 25788
8 Ga0070683_100011755 3300005329 Bacteria 7580
9 Ga0070683_101025783 3300005329 Bacteria 792
10 Ga0070670_101065131 3300005331 Bacteria 737
11 Ga0068869_100049325 3300005334 Bacteria 3047
12 Ga0070666_10319396 3300005335 Bacteria 1108
13 Ga0070680_100480115 3300005336 Bacteria 1062
14 Ga0068868_100008153 3300005338 Bacteria 7497
15 Ga0070660_100043541 3300005339 Bacteria 3431
16 Ga0070691_10236461 3300005341 Bacteria 974
17 Ga0070687_100071356 3300005343 Bacteria 1866
18 Ga0070661_100014983 3300005344 Bacteria 5470
19 Ga0070668_100040591 3300005347 Bacteria 3561
20 Ga0070675_100014230 3300005354 Bacteria 6272
21 Ga0070659_100017359 3300005366 Bacteria 5414
22 Ga0070659_101388477 3300005366 Bacteria 624
23 Ga0070714_100742504 3300005435 Bacteria 948
24 Ga0070713_100222178 3300005436 Bacteria 1714
25 Ga0070711_100966330 3300005439 Bacteria 730
26 Ga0070700_100001884 3300005441 Bacteria 10598
27 Ga0070663_100222883 3300005455 Bacteria 1481
28 Ga0068867_100673122 3300005459 Bacteria 910
29 Ga0070685_10841376 3300005466 Bacteria 679
30 Ga0070684_100096905 3300005535 Bacteria 2630
31 Ga0070684_101018359 3300005535 Archaea 777
32 Ga0070696_101632943 3300005546 Bacteria 554
33 Ga0068855_100267613 3300005563 Bacteria 1902
34 Ga0068855_101481316 3300005563 Bacteria 697
35 Ga0070664_100000704 3300005564 Bacteria 25537
36 Ga0070664_100945339 3300005564 Bacteria 809
37 Ga0068854_100257788 3300005578 Bacteria 1395
38 Ga0068856_100433893 3300005614 Bacteria 1334
39 Ga0070702_100232773 3300005615 Bacteria 1239
40 Ga0068852_100039036 3300005616 Bacteria 3995
41 Ga0068859_100973392 3300005617 Bacteria 931
42 Ga0068861_100223182 3300005719 Bacteria 1594
43 Ga0068858_100316297 3300005842 Bacteria 1491
44 Ga0081539_10000031 3300005985 Bacteria 313232
45 Ga0081539_10002933 3300005985 Bacteria 22478
46 Ga0081539_10011184 3300005985 Bacteria 7146
47 Ga0081539_10113907 3300005985 Bacteria 1356
48 Ga0075428_101583630 3300006844 Bacteria 685
49 Ga0075431_100109146 3300006847 Bacteria 2856
50 Ga0075429_100894591 3300006880 Bacteria 777
51 Ga0068865_100213137 3300006881 Bacteria 1506
52 Ga0097620_100973395 3300006931 Bacteria 931
53 Ga0105240_10233660 3300009093 Bacteria 2135
54 Ga0111539_10006074 3300009094 Bacteria 15593
55 Ga0105245_10001004 3300009098 Bacteria 25627
56 Ga0105245_12911464 3300009098 Bacteria 531
57 Ga0114129_10001242 3300009147 Bacteria 33950
58 Ga0114129_10119140 3300009147 Bacteria 3636
59 Ga0105243_10513809 3300009148 Bacteria 1138
60 Ga0105237_10529643 3300009545 Unclassified 1185
61 Ga0105249_10166973 3300009553 Bacteria 2131
62 Ga0105239_10581253 3300010375 Unclassified 1277
63 Ga0157369_10315176 3300013105 Bacteria 1626
64 Ga0163162_10337072 3300013306 Bacteria 1640
65 Ga0163162_10725103 3300013306 Bacteria 1115
66 Ga0157372_10824890 3300013307 Bacteria 1077
67 Ga0157375_10292216 3300013308 Bacteria 1793
68 Ga0157375_10942029 3300013308 Bacteria 1006
69 Ga0157380_10480862 3300014326 Bacteria 1201
70 Ga0157380_12011328 3300014326 Bacteria 640
71 Ga0182008_10980414 3300014497 Unclassified 503
72 Ga0157379_10815200 3300014968 Bacteria 881
73 Ga0157376_11155420 3300014969 Unclassified 801
74 Ga0163161_10985282 3300017792 Bacteria 719
75 Ga0163161_11826694 3300017792 Unclassified 541
76 Ga0207680_10790900 3300025903 Bacteria 680
77 Ga0207657_10301657 3300025919 Bacteria 1269
78 Ga0207649_10070734 3300025920 Bacteria 2226
79 Ga0207659_10389102 3300025926 Bacteria 1164
80 Ga0207687_10491829 3300025927 Bacteria 1023
81 Ga0207700_10441505 3300025928 Bacteria 1146
82 Ga0207664_10080641 3300025929 Bacteria 2645
83 Ga0207691_10371383 3300025940 Bacteria 1222
84 Ga0207689_10067916 3300025942 Bacteria 2929
85 Ga0207661_10002330 3300025944 Bacteria 13077
86 Ga0207661_10292489 3300025944 Bacteria 1458
87 Ga0207679_10040548 3300025945 Bacteria 3334
88 Ga0207679_10121023 3300025945 Bacteria 2084
89 Ga0207667_10379172 3300025949 Bacteria 1441
90 Ga0207712_10647936 3300025961 Bacteria 918
91 Ga0207668_10046693 3300025972 Bacteria 2961
92 Ga0207708_10021780 3300026075 Bacteria 4836
93 Ga0207702_11172870 3300026078 Bacteria 762
94 Ga0207641_10369154 3300026088 Bacteria 1372
95 Ga0207675_100255085 3300026118 Bacteria 1698
96 Ga0207683_10034087 3300026121 Bacteria 4424
97 Ga0268264_10559253 3300028381 Bacteria 1123
98 Ga0307517_10070197 3300028786 Bacteria 3160
99 Ga0307515_10001340 3300028794 Bacteria 55728
100 Ga0307512_10002114 3300030522 Bacteria 26081
101 Ga0307512_10007874 3300030522 Bacteria 10476
102 Ga0307512_10031947 3300030522 Bacteria 4553
103 Ga0307513_10000041 3300031456 Bacteria 169674
104 Ga0307513_10010903 3300031456 Bacteria 11351
105 Ga0307408_101287262 3300031548 Bacteria 685
106 Ga0307408_101708487 3300031548 Unclassified 600
107 Ga0307408_102390816 3300031548 Bacteria 513
108 Ga0307508_10097040 3300031616 Bacteria 2539
109 Ga0307405_10990169 3300031731 Bacteria 717
110 Ga0307413_11322003 3300031824 Bacteria 631
111 Ga0307518_10000723 3300031838 Bacteria 24815
112 Ga0307410_11933157 3300031852 Unclassified 526
113 Ga0307406_11892574 3300031901 Unclassified 532
114 Ga0307407_10627074 3300031903 Bacteria 803
115 Ga0307407_11030513 3300031903 Unclassified 637
116 Ga0307407_11089273 3300031903 Bacteria 621
117 Ga0307407_11222312 3300031903 Unclassified 588
118 Ga0307409_100041277 3300031995 Bacteria 3444
119 Ga0307409_100089046 3300031995 Bacteria 2522
120 Ga0307409_100153354 3300031995 Bacteria 2004
121 Ga0307409_100739830 3300031995 Bacteria 986
122 Ga0307409_102953707 3300031995 Bacteria 502
123 Ga0307416_100076502 3300032002 Bacteria 2806
124 Ga0307416_100342876 3300032002 Bacteria 1508
125 Ga0307416_100710919 3300032002 Bacteria 1095
126 Ga0307416_100774822 3300032002 Bacteria 1053
127 Ga0307414_10135923 3300032004 Bacteria 1917
128 Ga0307414_10595478 3300032004 Bacteria 991
129 Ga0307411_10129302 3300032005 Bacteria 1843
130 Ga0307415_100022730 3300032126 Bacteria 3877
131 Ga0307415_100049883 3300032126 Bacteria 2833
132 Ga0307415_100090665 3300032126 Bacteria 2212
133 Ga0307415_100314485 3300032126 Bacteria 1303
134 Ga0307415_101427263 3300032126 Bacteria 660
135 Ga0307510_10249819 3300033180 Bacteria 1262
136 Ga0316214_1022463 3300033545 Bacteria 886
137 Ga0316212_1001541 3300033547 Bacteria 3157
138 Ga0373934_0081679 3300035086 Bacteria 1299
139 Ga0372808_009730 3300036459 Bacteria 1345
140 Ga0395898_0079868 3300037466 Bacteria 3155
141 Ga0395901_2166944 3300038443 Unclassified 500
142 Ga0439466_0263930 3300041411 Bacteria 521
143 Ga0451789_0653531 3300041443 Unclassified 1129
144 Ga0451789_1191497 3300041443 Bacteria 731
145 Ga0451791_0098737 3300041451 Bacteria 508
146 Ga0451791_0220123 3300041451 Bacteria 2360
147 Ga0451791_0922830 3300041451 Bacteria 2292
148 Ga0451793_0445695 3300041452 Unclassified 1427
149 Ga0451793_0904520 3300041452 Bacteria 717
150 Ga0451793_1660414 3300041452 Bacteria 668
151 Ga0451797_0704767 3300041453 Bacteria 802
152 Ga0451797_0980272 3300041453 Unclassified 504
153 Ga0451797_1374845 3300041453 Bacteria 1211
154 Ga0451797_1587052 3300041453 Bacteria 663
155 Ga0451802_1525870 3300041460 Bacteria 649
156 Ga0451802_1859682 3300041460 Bacteria 604
157 Ga0451807_0009072 3300041486 Bacteria 571
158 Ga0451807_0931510 3300041486 Bacteria 654
159 Ga0451833_0399894 3300041491 Bacteria 1038
160 Ga0451833_0710646 3300041491 Bacteria 583
161 Ga0451837_0991006 3300041494 Bacteria 1109
162 Ga0451841_0444915 3300041498 Bacteria 550
163 Ga0451843_1680745 3300041509 Bacteria 957
164 Ga0451853_1376307 3300041512 Bacteria 967
165 Ga0451853_4007189 3300041512 Bacteria 615
166 Ga0439442_037106 3300042002 Bacteria 1021
167 Ga0439449_0123636 3300042007 Bacteria 961
168 Ga0495638_0057638 3300046460 Bacteria 2409
169 Ga0495638_0075041 3300046460 Bacteria 2061
170 Ga0495638_0429603 3300046460 Unclassified 679
171 Ga0495645_0345068 3300046543 Bacteria 961
172 Ga0495613_0565345 3300046689 Bacteria 760
173 Ga0496100_0071160 3300048903 Bacteria 2321
174 Ga0496100_0139606 3300048903 Bacteria 1716
175 Ga0496101_0005020 3300048904 Bacteria 8410
176 Ga0496102_0401531 3300048905 Bacteria 1288
177 Ga0496102_0783946 3300048905 Bacteria 876
178 Ga0496103_0002447 3300048906 Bacteria 11676
179 Ga0496104_0004149 3300048907 Bacteria 12580
180 Ga0496104_0344720 3300048907 Bacteria 1402
181 Ga0496104_1010731 3300048907 Unclassified 735
182 Ga0496105_0006959 3300048908 Bacteria 8712
183 Ga0496105_0181293 3300048908 Bacteria 1724
184 Ga0496105_0423025 3300048908 Bacteria 1054
185 Ga0496105_0517278 3300048908 Unclassified 935
186 Ga0496106_0282571 3300048909 Bacteria 1330
187 Ga0496107_0106988 3300048910 Bacteria 2055
188 Ga0496108_0053333 3300048911 Bacteria 3391
189 Ga0496108_0855127 3300048911 Bacteria 783
190 Ga0496108_1155472 3300048911 Bacteria 656
191 Ga0496109_0340402 3300048912 Bacteria 1416
192 Ga0496110_0064302 3300048913 Bacteria 3242
193 Ga0496110_0228524 3300048913 Bacteria 1692
194 Ga0496111_0081165 3300048914 Bacteria 2367
195 Ga0496112_1714586 3300048915 Bacteria 541
196 Ga0496114_0116969 3300048917 Bacteria 2289
197 Ga0496114_0194650 3300048917 Bacteria 1774
198 Ga0496114_0275133 3300048917 Bacteria 1484
199 Ga0496114_1515145 3300048917 Unclassified 558
200 Ga0496124_0314157 3300048927 Bacteria 1125
201 Ga0501039_0823767 3300049575 Bacteria 724
202 Ga0501041_0102918 3300049577 Bacteria 1769
203 Ga0501041_0513609 3300049577 Bacteria 763
204 Ga0501067_0133501 3300049583 Bacteria 1382
205 Ga0501067_0229316 3300049583 Unclassified 1034
206 Ga0501071_0596894 3300049587 Bacteria 849
207 Ga0501072_1393603 3300049588 Bacteria 542
208 nmdc:mga05p37_5022_c1 3300050507 Bacteria 15506
209 nmdc:mga05p37_60261_c2 3300050507 Unclassified 1859
210 nmdc:mga06r32_4119_c1 3300050510 Bacteria 13015
211 nmdc:mga08y16_670169_c1 3300050511 Bacteria 1040
212 Ga0500646_0137905 3300053090 Bacteria 798
213 Ga0500651_0039594 3300053093 Bacteria 2968
214 Ga0500594_0006879 3300053118 Bacteria 2563
215 Ga0500614_138691 3300053123 Bacteria 726
216 Ga0500652_048156 3300053131 Bacteria 1734
217 Ga0500559_0380777 3300053136 Bacteria 658
218 Ga0500573_0000483 3300053140 Bacteria 17183
219 Ga0500573_0048527 3300053140 Bacteria 2443
220 Ga0500573_0226617 3300053140 Bacteria 977
221 Ga0500573_0430708 3300053140 Bacteria 616
222 Ga0500577_0115499 3300053142 Bacteria 1112
223 Ga0500577_0125149 3300053142 Bacteria 1073
224 Ga0500616_0001132 3300053153 Bacteria 27437
225 Ga0500622_0191020 3300053156 Bacteria 939
226 Ga0500630_270316 3300053159 Bacteria 581
227 Ga0500633_0290459 3300053160 Bacteria 603
228 Ga0501082_0755256 3300060353 Bacteria 851
229 2506867240 2506783011 Bacteria 5323186
230 2586060832 2585427649 Bacteria 9053857
231 2644506235 2643221690 Bacteria 4654705
232 2644526225 2643221694 Bacteria 4392972
233 2644607940 2643221711 Bacteria 4865335
234 2644670900 2643221722 Bacteria 4247614
235 2809590155 2808606522 Bacteria 9488490
236 2819664931 2818991458 Bacteria 4794049
237 2831939022 2831935698 Bacteria 5963223
238 2870625135 2870622029 Bacteria 3643329
239 2915769921 2915768154 Bacteria 8424322
240 2919445358 2919443155 Bacteria 4072969
241 2939659907 2939657138 Bacteria 3740283
242 8003317580 8003314358 Bacteria 10575343
243 8055180275 8055172936 Bacteria 9305943
244 Ga0307406_10081611
245 JGI25406J46586_10001819
246 JGI25406J46586_10030859
247 rootH1_10016009
248 Ga0006562J51391_1037239
249 Ga0006562J51391_1037240
250 Ga0070683_100000601
251 Ga0070683_100011755
252 Ga0070683_101025783
253 Ga0070670_101065131
254 Ga0068869_100049325
255 Ga0070666_10319396
256 Ga0070680_100480115
257 Ga0068868_100008153
258 Ga0070660_100043541
259 Ga0070691_10236461
260 Ga0070687_100071356
261 Ga0070661_100014983
262 Ga0070668_100040591
263 Ga0070675_100014230
264 Ga0070659_100017359
265 Ga0070659_101388477
266 Ga0070714_100742504
267 Ga0070713_100222178
268 Ga0070711_100966330
269 Ga0070700_100001884
270 Ga0070663_100222883
271 Ga0068867_100673122
272 Ga0070685_10841376
273 Ga0070684_100096905
274 Ga0070684_101018359
275 Ga0070696_101632943
276 Ga0068855_100267613
277 Ga0068855_101481316
278 Ga0070664_100000704
279 Ga0070664_100945339
280 Ga0068854_100257788
281 Ga0068856_100433893
282 Ga0070702_100232773
283 Ga0068852_100039036
284 Ga0068859_100973392
285 Ga0068861_100223182
286 Ga0068858_100316297
287 Ga0081539_10000031
288 Ga0081539_10002933
289 Ga0081539_10011184
290 Ga0081539_10113907
291 Ga0075428_101583630
292 Ga0075431_100109146
293 Ga0075429_100894591
294 Ga0068865_100213137
295 Ga0097620_100973395
296 Ga0105240_10233660
297 Ga0111539_10006074
298 Ga0105245_10001004
299 Ga0105245_12911464
300 Ga0114129_10001242
301 Ga0114129_10119140
302 Ga0105243_10513809
303 Ga0105237_10529643
304 Ga0105249_10166973
305 Ga0105239_10581253
306 Ga0157369_10315176
307 Ga0163162_10337072
308 Ga0163162_10725103
309 Ga0157372_10824890
310 Ga0157375_10292216
311 Ga0157375_10942029
312 Ga0157380_10480862
313 Ga0157380_12011328
314 Ga0182008_10980414
315 Ga0157379_10815200
316 Ga0157376_11155420
317 Ga0163161_10985282
318 Ga0163161_11826694
319 Ga0207680_10790900
320 Ga0207657_10301657
321 Ga0207649_10070734
322 Ga0207659_10389102
323 Ga0207687_10491829
324 Ga0207700_10441505
325 Ga0207664_10080641
326 Ga0207691_10371383
327 Ga0207689_10067916
328 Ga0207661_10002330
329 Ga0207661_10292489
330 Ga0207679_10040548
331 Ga0207679_10121023
332 Ga0207667_10379172
333 Ga0207712_10647936
334 Ga0207668_10046693
335 Ga0207708_10021780
336 Ga0207702_11172870
337 Ga0207641_10369154
338 Ga0207675_100255085
339 Ga0207683_10034087
340 Ga0268264_10559253
341 Ga0307517_10070197
342 Ga0307515_10001340
343 Ga0307512_10002114
344 Ga0307512_10007874
345 Ga0307512_10031947
346 Ga0307513_10000041
347 Ga0307513_10010903
348 Ga0307408_101287262
349 Ga0307408_101708487
350 Ga0307408_102390816
351 Ga0307508_10097040
352 Ga0307405_10990169
353 Ga0307413_11322003
354 Ga0307518_10000723
355 Ga0307410_11933157
356 Ga0307406_11892574
357 Ga0307407_10627074
358 Ga0307407_11030513
359 Ga0307407_11089273
360 Ga0307407_11222312
361 Ga0307409_100041277
362 Ga0307409_100089046
363 Ga0307409_100153354
364 Ga0307409_100739830
365 Ga0307409_102953707
366 Ga0307416_100076502
367 Ga0307416_100342876
368 Ga0307416_100710919
369 Ga0307416_100774822
370 Ga0307414_10135923
371 Ga0307414_10595478
372 Ga0307411_10129302
373 Ga0307415_100022730
374 Ga0307415_100049883
375 Ga0307415_100090665
376 Ga0307415_100314485
377 Ga0307415_101427263
378 Ga0307510_10249819
379 Ga0316214_1022463
380 Ga0316212_1001541
381 Ga0373934_0081679
382 Ga0372808_009730
383 Ga0395898_0079868
384 Ga0395901_2166944
385 Ga0439466_0263930
386 Ga0451789_0653531
387 Ga0451789_1191497
388 Ga0451791_0098737
389 Ga0451791_0220123
390 Ga0451791_0922830
391 Ga0451793_0445695
392 Ga0451793_0904520
393 Ga0451793_1660414
394 Ga0451797_0704767
395 Ga0451797_0980272
396 Ga0451797_1374845
397 Ga0451797_1587052
398 Ga0451802_1525870
399 Ga0451802_1859682
400 Ga0451807_0009072
401 Ga0451807_0931510
402 Ga0451833_0399894
403 Ga0451833_0710646
404 Ga0451837_0991006
405 Ga0451841_0444915
406 Ga0451843_1680745
407 Ga0451853_1376307
408 Ga0451853_4007189
409 Ga0439442_037106
410 Ga0439449_0123636
411 Ga0495638_0057638
412 Ga0495638_0075041
413 Ga0495638_0429603
414 Ga0495645_0345068
415 Ga0495613_0565345
416 Ga0496100_0071160
417 Ga0496100_0139606
418 Ga0496101_0005020
419 Ga0496102_0401531
420 Ga0496102_0783946
421 Ga0496103_0002447
422 Ga0496104_0004149
423 Ga0496104_0344720
424 Ga0496104_1010731
425 Ga0496105_0006959
426 Ga0496105_0181293
427 Ga0496105_0423025
428 Ga0496105_0517278
429 Ga0496106_0282571
430 Ga0496107_0106988
431 Ga0496108_0053333
432 Ga0496108_0855127
433 Ga0496108_1155472
434 Ga0496109_0340402
435 Ga0496110_0064302
436 Ga0496110_0228524
437 Ga0496111_0081165
438 Ga0496112_1714586
439 Ga0496114_0116969
440 Ga0496114_0194650
441 Ga0496114_0275133
442 Ga0496114_1515145
443 Ga0496124_0314157
444 Ga0501039_0823767
445 Ga0501041_0102918
446 Ga0501041_0513609
447 Ga0501067_0133501
448 Ga0501067_0229316
449 Ga0501071_0596894
450 Ga0501072_1393603
451 nmdc:mga05p37_5022_c1
452 nmdc:mga05p37_60261_c2
453 nmdc:mga06r32_4119_c1
454 nmdc:mga08y16_670169_c1
455 Ga0500646_0137905
456 Ga0500651_0039594
457 Ga0500594_0006879
458 Ga0500614_138691
459 Ga0500652_048156
460 Ga0500559_0380777
461 Ga0500573_0000483
462 Ga0500573_0048527
463 Ga0500573_0226617
464 Ga0500573_0430708
465 Ga0500577_0115499
466 Ga0500577_0125149
467 Ga0500616_0001132
468 Ga0500622_0191020
469 Ga0500630_270316
470 Ga0500633_0290459
471 Ga0501082_0755256
472 2506867240
473 2586060832
474 2644506235
475 2644526225
476 2644607940
477 2644670900
478 2809590155
479 2819664931
480 2831939022
481 2870625135
482 2915769921
483 2919445358
484 2939659907
485 8003317580
486 8055180275

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08922

DUF1905

Domain of unknown function (DUF1905)

24

114

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d9r-assembly1.cif.gz_A structure of conserved protein of unknown function pg0164 from porphyromonas gingivalis [w83] 0.8325 5 104
2d9r-assembly1.cif.gz_A structure of conserved protein of unknown function pg0164 from porphyromonas gingivalis [w83] 0.8235 5 104
2glw-assembly1.cif.gz_A the solution structure of phs018 from pyrococcus horikoshii 0.6157 8 104
5trd-assembly1.cif.gz_B structure of rbkr (riboflavin kinase) from thermoplasma acidophilum determined in complex with ctp and its cognate dna operator 0.5831 3 102
7et6-assembly1.cif.gz_D crystal structure of arabidopsis tem1 b3-dna complex 0.5619 6 100
ID Description Score Start End Superfamily
2d9rA00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;AF2212/PG0164-like 0.8211 5 104 2.40.30.100
2d9rA00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;AF2212/PG0164-like 0.812 5 104 2.40.30.100
af_Q8RYD1_204_322_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.6428 26 96 2.40.330.10
af_Q851V5_911_1029_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.6343 26 98 2.40.330.10
af_Q851V5_317_412_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.6339 26 95 2.40.330.10
ID Description Score Start End GO Terms
AF-A0A429FFU9-F1-model_v4 DUF1905 domain-containing protein 0.9827 5 106
AF-A0A0M9YZ05-F1-model_v4 deleted 0.9748 5 106
AF-A0A429FFU9-F1-model_v4 DUF1905 domain-containing protein 0.9731 5 106
AF-A0A3C1DPU1-F1-model_v4 DUF1905 domain-containing protein 0.9712 5 103
AF-A0A0T0MKH4-F1-model_v4 DUF1905 domain-containing protein 0.9679 5 106

Map