F355663

General Info

Members Datasets Scaffolds Average Seq Length
243 113 486 308

Family's Representative Sequence

Representative Sequence 3300025927|Ga0207687_10169152|Ga0207687_101691522
Length 351
Sequence MRNPCSAKGSVKHIDTSTVSCPESAMARKVRVQYPGAIYHIMNRGDRRESIFEDDEDRRLFLATLGEACAKTQWQMHAFCLMSNHFHFVMETPQPTLVDGMKWFLCTYTSRVNRRHKVFGHLFSGRYKALIVDGSGNGYLKTVCDYVHLNPVRAQLITPEDPLETYPWSSYPLYLREPSRRPCWLRVDRLLGEWGIPKDSAAGREHFSAFVEARRQGELEGEFKSVRRGWCLGSGQFRKELLAQVDQKRGRWHYGAELQESAVDKAERLITDELKARGWTEQDLQAGRKGEPLKVELALKLRAETTMTLRWIAERLGAGTRGHLAHLLYCHGKASLPKAEPNNDAQINMFD

Samples

Sample ID Description Type Environment
1 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
56 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
57 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
58 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
59 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
62 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
63 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
64 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
68 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
69 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
70 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
71 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
72 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
83 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
84 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
85 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
86 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
87 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
90 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
91 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
92 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
93 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
94 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
95 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
96 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
97 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
98 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
99 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
100 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
103 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
106 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
107 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
108 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.41
Rhizosphere 99.18
Stem 0
Stem Tuber 0
Unclassified 40.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207687_10169152 3300025927 Bacteria 1684
2 rootH2_10198486 3300003320 Bacteria 1409
3 Ga0070683_100324817 3300005329 Unclassified 1465
4 Ga0070690_100161024 3300005330 Bacteria 1538
5 Ga0070680_100447608 3300005336 Bacteria 1103
6 Ga0070689_100003920 3300005340 Bacteria 9978
7 Ga0070689_100007574 3300005340 Bacteria 7603
8 Ga0070689_100026937 3300005340 Unclassified 4331
9 Ga0070689_100031878 3300005340 Unclassified 4006
10 Ga0070689_100048098 3300005340 Bacteria 3289
11 Ga0070689_100056998 3300005340 Bacteria 3031
12 Ga0070689_100059850 3300005340 Unclassified 2960
13 Ga0070689_100061025 3300005340 Unclassified 2932
14 Ga0070689_100084308 3300005340 Unclassified 2497
15 Ga0070688_100337610 3300005365 Bacteria 1099
16 Ga0070709_10237677 3300005434 Bacteria 1307
17 Ga0070705_100295393 3300005440 Unclassified 1158
18 Ga0070708_100084776 3300005445 Unclassified 2874
19 Ga0070681_10463993 3300005458 Unclassified 1179
20 Ga0070706_100143580 3300005467 Unclassified 2229
21 Ga0070706_100297650 3300005467 Unclassified 1505
22 Ga0070706_100536522 3300005467 Bacteria 1088
23 Ga0070707_100235345 3300005468 Unclassified 1783
24 Ga0070707_100538294 3300005468 Unclassified 1130
25 Ga0070698_100320864 3300005471 Bacteria 1480
26 Ga0070699_100449832 3300005518 Unclassified 1168
27 Ga0070679_100194583 3300005530 Unclassified 1995
28 Ga0070684_100246540 3300005535 Unclassified 1632
29 Ga0070686_100021074 3300005544 Unclassified 3868
30 Ga0070686_100107985 3300005544 Unclassified 1891
31 Ga0070665_100000027 3300005548 Bacteria 359314
32 Ga0068856_100586511 3300005614 Bacteria 1136
33 Ga0070702_100082568 3300005615 Unclassified 1928
34 Ga0068859_100031822 3300005617 Bacteria 5299
35 Ga0068863_100013094 3300005841 Bacteria 8001
36 Ga0068863_100027948 3300005841 Bacteria 5384
37 Ga0068863_100215443 3300005841 Unclassified 1849
38 Ga0068863_100434628 3300005841 Bacteria 1287
39 Ga0068858_100436510 3300005842 Bacteria 1261
40 Ga0068860_100273597 3300005843 Bacteria 1649
41 Ga0081539_10016915 3300005985 Bacteria 5168
42 Ga0081539_10141820 3300005985 Unclassified 1167
43 Ga0075429_100383136 3300006880 Bacteria 1231
44 Ga0097620_100031822 3300006931 Bacteria 5299
45 Ga0105240_10206262 3300009093 Bacteria 2300
46 Ga0105240_10334672 3300009093 Bacteria 1721
47 Ga0111539_10178437 3300009094 Unclassified 2481
48 Ga0105245_10139902 3300009098 Bacteria 2278
49 Ga0105245_10444996 3300009098 Unclassified 1303
50 Ga0114129_10717905 3300009147 Bacteria 1283
51 Ga0105237_10492463 3300009545 Unclassified 1232
52 Ga0105238_10013637 3300009551 Bacteria 8207
53 Ga0105238_10126008 3300009551 Unclassified 2539
54 Ga0105238_10271384 3300009551 Bacteria 1677
55 Ga0105249_10445224 3300009553 Bacteria 1333
56 Ga0157369_10721093 3300013105 Unclassified 1026
57 Ga0157374_10172620 3300013296 Unclassified 2109
58 Ga0157378_10300221 3300013297 Bacteria 1554
59 Ga0157372_10273187 3300013307 Bacteria 1964
60 Ga0163163_10115137 3300014325 Unclassified 2720
61 Ga0163163_10214422 3300014325 Bacteria 1974
62 Ga0157380_10486675 3300014326 Bacteria 1195
63 Ga0157376_10356913 3300014969 Bacteria 1401
64 Ga0207695_10358289 3300025913 Bacteria 1345
65 Ga0207646_10332128 3300025922 Unclassified 1373
66 Ga0207670_10000896 3300025936 Bacteria 15698
67 Ga0207670_10001890 3300025936 Bacteria 10938
68 Ga0207670_10005417 3300025936 Bacteria 7002
69 Ga0207670_10006781 3300025936 Bacteria 6369
70 Ga0207670_10039342 3300025936 Unclassified 3096
71 Ga0207670_10047967 3300025936 Bacteria 2847
72 Ga0207670_10165204 3300025936 Bacteria 1656
73 Ga0207670_10312168 3300025936 Unclassified 1235
74 Ga0207661_10129810 3300025944 Bacteria 2157
75 Ga0207667_10157471 3300025949 Bacteria 2337
76 Ga0207639_10153522 3300026041 Unclassified 1931
77 Ga0207708_10341338 3300026075 Bacteria 1227
78 Ga0207641_10020490 3300026088 Bacteria 5431
79 Ga0207641_10099278 3300026088 Unclassified 2561
80 Ga0207641_10387137 3300026088 Bacteria 1340
81 Ga0207641_10414713 3300026088 Bacteria 1295
82 Ga0207698_10347338 3300026142 Bacteria 1400
83 Ga0268266_10000050 3300028379 Bacteria 302778
84 Ga0268265_10114146 3300028380 Unclassified 2212
85 Ga0268264_10308935 3300028381 Bacteria 1491
86 Ga0265337_1000030 3300028556 Bacteria 65531
87 Ga0265337_1000635 3300028556 Bacteria 18555
88 Ga0265337_1008835 3300028556 Bacteria 3631
89 Ga0265319_1070083 3300028563 Unclassified 1125
90 Ga0265334_10020556 3300028573 Bacteria 2702
91 Ga0265323_10061596 3300028653 Bacteria 1304
92 Ga0265323_10075974 3300028653 Bacteria 1140
93 Ga0265336_10000370 3300028666 Bacteria 28851
94 Ga0265336_10006203 3300028666 Unclassified 4329
95 Ga0265338_10000433 3300028800 Bacteria 75181
96 Ga0265338_10001201 3300028800 Bacteria 42815
97 Ga0265338_10001595 3300028800 Bacteria 36398
98 Ga0265338_10001631 3300028800 Bacteria 35890
99 Ga0265338_10008930 3300028800 Bacteria 12060
100 Ga0265338_10010602 3300028800 Bacteria 10778
101 Ga0265338_10011485 3300028800 Bacteria 10225
102 Ga0265338_10011773 3300028800 Bacteria 10058
103 Ga0265338_10037814 3300028800 Bacteria 4584
104 Ga0265338_10057874 3300028800 Unclassified 3426
105 Ga0265338_10133605 3300028800 Bacteria 1955
106 Ga0265338_10158043 3300028800 Bacteria 1753
107 Ga0265338_10356396 3300028800 Unclassified 1050
108 Ga0265324_10000590 3300029957 Bacteria 24867
109 Ga0265324_10016779 3300029957 Bacteria 2666
110 Ga0265324_10038154 3300029957 Bacteria 1667
111 Ga0265324_10053171 3300029957 Unclassified 1390
112 Ga0265320_10000792 3300031240 Bacteria 24069
113 Ga0265320_10001493 3300031240 Bacteria 17059
114 Ga0265320_10015493 3300031240 Bacteria 4308
115 Ga0265320_10018672 3300031240 Unclassified 3811
116 Ga0265320_10024357 3300031240 Bacteria 3202
117 Ga0265339_10010167 3300031249 Bacteria 5858
118 Ga0265339_10014691 3300031249 Unclassified 4714
119 Ga0265327_10009516 3300031251 Bacteria 6997
120 Ga0265316_10210943 3300031344 Bacteria 1436
121 Ga0265316_10281090 3300031344 Bacteria 1216
122 Ga0265342_10174518 3300031712 Unclassified 1180
123 Ga0307406_10451144 3300031901 Unclassified 1032
124 Ga0373926_0008797 3300035083 Unclassified 3361
125 Ga0373954_0047729 3300035118 Bacteria 2005
126 Ga0373954_0052556 3300035118 Unclassified 1914
127 Ga0373956_0044258 3300035119 Bacteria 1984
128 Ga0373956_0125758 3300035119 Bacteria 1199
129 Ga0373946_0007145 3300035171 Unclassified 4078
130 Ga0373931_0091298 3300035691 Bacteria 1697
131 Ga0373935_0013744 3300035692 Unclassified 4888
132 Ga0373935_0282095 3300035692 Unclassified 1170
133 Ga0373935_0287092 3300035692 Unclassified 1160
134 Ga0373947_0270329 3300035725 Bacteria 1128
135 Ga0373937_0144800 3300036401 Bacteria 2224
136 Ga0373925_0081902 3300037068 Unclassified 2455
137 Ga0373925_0124544 3300037068 Bacteria 2004
138 Ga0373925_0219715 3300037068 Bacteria 1516
139 Ga0373925_0396922 3300037068 Bacteria 1125
140 Ga0373925_0443226 3300037068 Unclassified 1063
141 Ga0395900_0252625 3300037418 Bacteria 1764
142 Ga0395901_0654676 3300038443 Unclassified 1053
143 Ga0451577_0005070 3300042876 Bacteria 13596
144 Ga0451577_0057248 3300042876 Bacteria 3475
145 Ga0451577_0135147 3300042876 Bacteria 2214
146 Ga0453684_0000192 3300044712 Bacteria 266757
147 Ga0453684_0231140 3300044712 Unclassified 2135
148 Ga0453684_0726028 3300044712 Unclassified 1077
149 Ga0451576_0040765 3300045051 Unclassified 4912
150 Ga0451576_0125617 3300045051 Bacteria 2673
151 Ga0451576_0129407 3300045051 Bacteria 2631
152 Ga0451576_0133122 3300045051 Bacteria 2592
153 Ga0451576_0319971 3300045051 Unclassified 1623
154 Ga0495592_0000035 3300046454 Bacteria 125802
155 Ga0495592_0257207 3300046454 Unclassified 1151
156 Ga0495582_0284657 3300046473 Unclassified 949
157 Ga0495639_0012419 3300046475 Bacteria 3673
158 Ga0495662_0110912 3300046476 Bacteria 1344
159 Ga0495662_0116783 3300046476 Unclassified 1308
160 Ga0495662_0156978 3300046476 Unclassified 1120
161 Ga0495664_0004047 3300046477 Bacteria 7996
162 Ga0495664_0008617 3300046477 Bacteria 5690
163 Ga0495664_0192820 3300046477 Unclassified 1235
164 Ga0495618_0008782 3300046514 Bacteria 6101
165 Ga0495618_0027649 3300046514 Unclassified 3531
166 Ga0495618_0057321 3300046514 Bacteria 2466
167 Ga0495618_0066177 3300046514 Bacteria 2297
168 Ga0495618_0177849 3300046514 Unclassified 1352
169 Ga0495618_0206769 3300046514 Unclassified 1241
170 Ga0495628_0000465 3300046516 Bacteria 37158
171 Ga0495628_0000510 3300046516 Bacteria 35585
172 Ga0495628_0000570 3300046516 Bacteria 33848
173 Ga0495630_0007221 3300046517 Bacteria 7923
174 Ga0495630_0053991 3300046517 Unclassified 3010
175 Ga0495630_0076041 3300046517 Unclassified 2529
176 Ga0495630_0091582 3300046517 Bacteria 2297
177 Ga0495630_0213357 3300046517 Unclassified 1473
178 Ga0495630_0269310 3300046517 Unclassified 1301
179 Ga0495630_0289554 3300046517 Unclassified 1251
180 Ga0495630_0359389 3300046517 Bacteria 1115
181 Ga0495630_0384913 3300046517 Bacteria 1074
182 Ga0495666_0105003 3300046526 Bacteria 1329
183 Ga0495666_0152688 3300046526 Unclassified 1073
184 Ga0495652_0142260 3300046529 Bacteria 1885
185 Ga0495652_0286968 3300046529 Unclassified 1202
186 Ga0495640_0014527 3300046533 Bacteria 5952
187 Ga0495640_0056558 3300046533 Unclassified 2680
188 Ga0495640_0068043 3300046533 Unclassified 2397
189 Ga0495640_0074841 3300046533 Bacteria 2263
190 Ga0495640_0258585 3300046533 Unclassified 1088
191 Ga0495586_0000255 3300046535 Bacteria 34953
192 Ga0495586_0003382 3300046535 Bacteria 8558
193 Ga0495586_0004032 3300046535 Bacteria 7871
194 Ga0495586_0015967 3300046535 Unclassified 3995
195 Ga0495586_0020296 3300046535 Bacteria 3539
196 Ga0495586_0040647 3300046535 Bacteria 2503
197 Ga0495586_0045107 3300046535 Unclassified 2375
198 Ga0495586_0161611 3300046535 Unclassified 1263
199 Ga0495586_0170595 3300046535 Unclassified 1229
200 Ga0495598_0050864 3300046537 Bacteria 1247
201 Ga0495645_0000711 3300046543 Bacteria 22852
202 Ga0495645_0029783 3300046543 Bacteria 3973
203 Ga0495645_0123043 3300046543 Unclassified 1825
204 Ga0495667_0019628 3300046559 Bacteria 4560
205 Ga0495634_0005262 3300046642 Bacteria 9995
206 Ga0495634_0059735 3300046642 Eukaryota 2539
207 Ga0495634_0133336 3300046642 Unclassified 1582
208 Ga0495634_0174829 3300046642 Unclassified 1348
209 Ga0495634_0226285 3300046642 Unclassified 1152
210 Ga0495599_0009743 3300046678 Bacteria 5880
211 Ga0495646_0063101 3300046680 Unclassified 2201
212 Ga0495658_0051029 3300046683 Unclassified 2342
213 Ga0495658_0262911 3300046683 Bacteria 1086
214 Ga0495658_0277336 3300046683 Unclassified 1057
215 Ga0495658_0364192 3300046683 Bacteria 919
216 Ga0495613_0008142 3300046689 Bacteria 7798
217 Ga0495613_0028936 3300046689 Bacteria 4120
218 Ga0495613_0035550 3300046689 Bacteria 3696
219 Ga0495613_0073319 3300046689 Bacteria 2494
220 Ga0495613_0357552 3300046689 Unclassified 1002
221 Ga0495624_0037382 3300046690 Bacteria 3124
222 Ga0495624_0192884 3300046690 Unclassified 1239
223 Ga0495581_0051262 3300047315 Unclassified 2383
224 Ga0495674_0003975 3300047319 Bacteria 14336
225 Ga0495674_0012664 3300047319 Bacteria 7949
226 Ga0495674_0062206 3300047319 Bacteria 3251
227 Ga0495674_0292241 3300047319 Bacteria 1332
228 Ga0495674_0316464 3300047319 Unclassified 1272
229 Ga0495674_0345046 3300047319 Unclassified 1209
230 Ga0495674_0485726 3300047319 Unclassified 989
231 Ga0495676_0009897 3300047321 Bacteria 8664
232 Ga0495676_0230619 3300047321 Unclassified 1272
233 Ga0495676_0303426 3300047321 Unclassified 1076
234 Ga0495680_0074147 3300047322 Unclassified 2585
235 Ga0495684_0119933 3300047471 Unclassified 1982
236 Ga0495684_0247856 3300047471 Unclassified 1297
237 Ga0495684_0260618 3300047471 Bacteria 1258
238 Ga0495614_0041163 3300048089 Unclassified 1982
239 Ga0496115_0052479 3300048918 Bacteria 3271
240 Ga0501034_0304763 3300049571 Unclassified 1529
241 Ga0501070_0437925 3300049586 Unclassified 1055
242 Ga0501044_0057577 3300049823 Bacteria 3988
243 nmdc:mga08y16_328591_c1 3300050511 Bacteria 1573
244 Ga0207687_10169152
245 rootH2_10198486
246 Ga0070683_100324817
247 Ga0070690_100161024
248 Ga0070680_100447608
249 Ga0070689_100003920
250 Ga0070689_100007574
251 Ga0070689_100026937
252 Ga0070689_100031878
253 Ga0070689_100048098
254 Ga0070689_100056998
255 Ga0070689_100059850
256 Ga0070689_100061025
257 Ga0070689_100084308
258 Ga0070688_100337610
259 Ga0070709_10237677
260 Ga0070705_100295393
261 Ga0070708_100084776
262 Ga0070681_10463993
263 Ga0070706_100143580
264 Ga0070706_100297650
265 Ga0070706_100536522
266 Ga0070707_100235345
267 Ga0070707_100538294
268 Ga0070698_100320864
269 Ga0070699_100449832
270 Ga0070679_100194583
271 Ga0070684_100246540
272 Ga0070686_100021074
273 Ga0070686_100107985
274 Ga0070665_100000027
275 Ga0068856_100586511
276 Ga0070702_100082568
277 Ga0068859_100031822
278 Ga0068863_100013094
279 Ga0068863_100027948
280 Ga0068863_100215443
281 Ga0068863_100434628
282 Ga0068858_100436510
283 Ga0068860_100273597
284 Ga0081539_10016915
285 Ga0081539_10141820
286 Ga0075429_100383136
287 Ga0097620_100031822
288 Ga0105240_10206262
289 Ga0105240_10334672
290 Ga0111539_10178437
291 Ga0105245_10139902
292 Ga0105245_10444996
293 Ga0114129_10717905
294 Ga0105237_10492463
295 Ga0105238_10013637
296 Ga0105238_10126008
297 Ga0105238_10271384
298 Ga0105249_10445224
299 Ga0157369_10721093
300 Ga0157374_10172620
301 Ga0157378_10300221
302 Ga0157372_10273187
303 Ga0163163_10115137
304 Ga0163163_10214422
305 Ga0157380_10486675
306 Ga0157376_10356913
307 Ga0207695_10358289
308 Ga0207646_10332128
309 Ga0207670_10000896
310 Ga0207670_10001890
311 Ga0207670_10005417
312 Ga0207670_10006781
313 Ga0207670_10039342
314 Ga0207670_10047967
315 Ga0207670_10165204
316 Ga0207670_10312168
317 Ga0207661_10129810
318 Ga0207667_10157471
319 Ga0207639_10153522
320 Ga0207708_10341338
321 Ga0207641_10020490
322 Ga0207641_10099278
323 Ga0207641_10387137
324 Ga0207641_10414713
325 Ga0207698_10347338
326 Ga0268266_10000050
327 Ga0268265_10114146
328 Ga0268264_10308935
329 Ga0265337_1000030
330 Ga0265337_1000635
331 Ga0265337_1008835
332 Ga0265319_1070083
333 Ga0265334_10020556
334 Ga0265323_10061596
335 Ga0265323_10075974
336 Ga0265336_10000370
337 Ga0265336_10006203
338 Ga0265338_10000433
339 Ga0265338_10001201
340 Ga0265338_10001595
341 Ga0265338_10001631
342 Ga0265338_10008930
343 Ga0265338_10010602
344 Ga0265338_10011485
345 Ga0265338_10011773
346 Ga0265338_10037814
347 Ga0265338_10057874
348 Ga0265338_10133605
349 Ga0265338_10158043
350 Ga0265338_10356396
351 Ga0265324_10000590
352 Ga0265324_10016779
353 Ga0265324_10038154
354 Ga0265324_10053171
355 Ga0265320_10000792
356 Ga0265320_10001493
357 Ga0265320_10015493
358 Ga0265320_10018672
359 Ga0265320_10024357
360 Ga0265339_10010167
361 Ga0265339_10014691
362 Ga0265327_10009516
363 Ga0265316_10210943
364 Ga0265316_10281090
365 Ga0265342_10174518
366 Ga0307406_10451144
367 Ga0373926_0008797
368 Ga0373954_0047729
369 Ga0373954_0052556
370 Ga0373956_0044258
371 Ga0373956_0125758
372 Ga0373946_0007145
373 Ga0373931_0091298
374 Ga0373935_0013744
375 Ga0373935_0282095
376 Ga0373935_0287092
377 Ga0373947_0270329
378 Ga0373937_0144800
379 Ga0373925_0081902
380 Ga0373925_0124544
381 Ga0373925_0219715
382 Ga0373925_0396922
383 Ga0373925_0443226
384 Ga0395900_0252625
385 Ga0395901_0654676
386 Ga0451577_0005070
387 Ga0451577_0057248
388 Ga0451577_0135147
389 Ga0453684_0000192
390 Ga0453684_0231140
391 Ga0453684_0726028
392 Ga0451576_0040765
393 Ga0451576_0125617
394 Ga0451576_0129407
395 Ga0451576_0133122
396 Ga0451576_0319971
397 Ga0495592_0000035
398 Ga0495592_0257207
399 Ga0495582_0284657
400 Ga0495639_0012419
401 Ga0495662_0110912
402 Ga0495662_0116783
403 Ga0495662_0156978
404 Ga0495664_0004047
405 Ga0495664_0008617
406 Ga0495664_0192820
407 Ga0495618_0008782
408 Ga0495618_0027649
409 Ga0495618_0057321
410 Ga0495618_0066177
411 Ga0495618_0177849
412 Ga0495618_0206769
413 Ga0495628_0000465
414 Ga0495628_0000510
415 Ga0495628_0000570
416 Ga0495630_0007221
417 Ga0495630_0053991
418 Ga0495630_0076041
419 Ga0495630_0091582
420 Ga0495630_0213357
421 Ga0495630_0269310
422 Ga0495630_0289554
423 Ga0495630_0359389
424 Ga0495630_0384913
425 Ga0495666_0105003
426 Ga0495666_0152688
427 Ga0495652_0142260
428 Ga0495652_0286968
429 Ga0495640_0014527
430 Ga0495640_0056558
431 Ga0495640_0068043
432 Ga0495640_0074841
433 Ga0495640_0258585
434 Ga0495586_0000255
435 Ga0495586_0003382
436 Ga0495586_0004032
437 Ga0495586_0015967
438 Ga0495586_0020296
439 Ga0495586_0040647
440 Ga0495586_0045107
441 Ga0495586_0161611
442 Ga0495586_0170595
443 Ga0495598_0050864
444 Ga0495645_0000711
445 Ga0495645_0029783
446 Ga0495645_0123043
447 Ga0495667_0019628
448 Ga0495634_0005262
449 Ga0495634_0059735
450 Ga0495634_0133336
451 Ga0495634_0174829
452 Ga0495634_0226285
453 Ga0495599_0009743
454 Ga0495646_0063101
455 Ga0495658_0051029
456 Ga0495658_0262911
457 Ga0495658_0277336
458 Ga0495658_0364192
459 Ga0495613_0008142
460 Ga0495613_0028936
461 Ga0495613_0035550
462 Ga0495613_0073319
463 Ga0495613_0357552
464 Ga0495624_0037382
465 Ga0495624_0192884
466 Ga0495581_0051262
467 Ga0495674_0003975
468 Ga0495674_0012664
469 Ga0495674_0062206
470 Ga0495674_0292241
471 Ga0495674_0316464
472 Ga0495674_0345046
473 Ga0495674_0485726
474 Ga0495676_0009897
475 Ga0495676_0230619
476 Ga0495676_0303426
477 Ga0495680_0074147
478 Ga0495684_0119933
479 Ga0495684_0247856
480 Ga0495684_0260618
481 Ga0495614_0041163
482 Ga0496115_0052479
483 Ga0501034_0304763
484 Ga0501070_0437925
485 Ga0501044_0057577
486 nmdc:mga08y16_328591_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01797

Y1_Tnp

Transposase IS200 like

33

150

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4er8-assembly1.cif.gz_A structure of the rep associates tyrosine transposase bound to a rep hairpin 0.8424 1 147
2xo6-assembly1.cif.gz_D deinococcus radiodurans isdra2 transposase y132f mutant complexed with left end recognition and cleavage site 0.7827 11 118
2xma-assembly1.cif.gz_B deinococcus radiodurans isdra2 transposase right end dna complex 0.7666 11 121
2a6m-assembly2.cif.gz_A-2 crystal structure of the ishp608 transposase 0.7585 11 121
2xqc-assembly1.cif.gz_A deinococcus radiodurans isdra2 transposase complexed with left end recognition and cleavage site and zn 0.7561 11 121
ID Description Score Start End Superfamily
4er8A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.8424 1 147 3.30.70.1290
af_Q2G2H5_351_453_1.10.1750.10 Mainly Alpha;Orthogonal Bundle;Chromosomal Replication Initiator Protein Dnaa; Chain: A;;DnaA protein, C-terminal DNA-binding domain 0.7825 245 313 1.10.1750.10
2vjvB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.7776 11 122 3.30.70.1290
2a6mB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.7753 12 122 3.30.70.1290
2xm3E00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.769 12 122 3.30.70.1290
ID Description Score Start End GO Terms
AF-A0A101HZK1-F1-model_v4 Chromosomal replication initiator DnaA domain protein 0.989 7 93 GO:0003677
GO:0004803
GO:0006313
AF-A0A250KV92-F1-model_v4 Transposase 0.9816 17 111 GO:0003677
GO:0004803
GO:0006313
AF-A0A524ITG0-F1-model_v4 Transposase IS200-like domain-containing protein 0.9788 1 84 GO:0003677
GO:0004803
GO:0006313
AF-A0A101HZK1-F1-model_v4 Chromosomal replication initiator DnaA domain protein 0.9779 7 93 GO:0003677
GO:0004803
GO:0006313
AF-A0A2M7FIT5-F1-model_v4 Addiction module toxin RelE 0.9778 1 88 GO:0003677
GO:0004803
GO:0006313

Map