F355484

General Info

Members Datasets Scaffolds Average Seq Length
243 157 241 159

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100440803|Ga0068871_1004408032
Length 192
Sequence MTGNMATAPANRDRNPGIIDKDTPISREHKEHTNVKPKNTICLWFDKDAQEAAIFYAATFPDSKVTAVHEAPGDFPGGKKGDVLTVEFTVVGIPCLGLNGGPAFRQSEAFSFQIATDNQEETDRYWNAIVGNGGTESACGWCKDRWGLSWQITPRALTDALAAGGSEAKRAFEVMMTMKKIDVAAIEAARRG

Samples

Sample ID Description Type Environment
1 2818991467 Bosea vestrisii 3192 Isolate Unclassified
2 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
78 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
79 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
90 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
91 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
92 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
93 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
94 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
105 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
106 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
109 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
110 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
111 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
112 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
118 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
124 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
125 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
126 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
143 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
154 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
155 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0
Isolates 0.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.88
Nodule 0.82
Rhizoplane 7
Rhizosphere 84.77
Stem 0
Stem Tuber 0
Unclassified 4.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1003061 3300002774 Bacteria 4003
2 Ga0065712_10069397 3300005290 Bacteria 7383
3 Ga0065712_10256491 3300005290 Bacteria 947
4 Ga0065715_10745206 3300005293 Bacteria 611
5 Ga0070658_10174233 3300005327 Bacteria 1808
6 Ga0070683_100139563 3300005329 Bacteria 2296
7 Ga0070683_100279589 3300005329 Bacteria 1588
8 Ga0070680_100240502 3300005336 Bacteria 1530
9 Ga0070680_100319896 3300005336 Bacteria 1317
10 Ga0070682_100163545 3300005337 Bacteria 1539
11 Ga0068868_100033648 3300005338 Bacteria 3952
12 Ga0070671_100064098 3300005355 Bacteria 3061
13 Ga0070671_100138745 3300005355 Bacteria 2051
14 Ga0070671_100146983 3300005355 Bacteria 1990
15 Ga0070671_100196150 3300005355 Bacteria 1712
16 Ga0070673_100051604 3300005364 Bacteria 3223
17 Ga0070673_100059853 3300005364 Bacteria 3016
18 Ga0070673_100210596 3300005364 Bacteria 1679
19 Ga0070659_100834219 3300005366 Bacteria 803
20 Ga0070667_100296314 3300005367 Bacteria 1455
21 Ga0070663_100206322 3300005455 Bacteria 1537
22 Ga0070678_100012064 3300005456 Bacteria 5355
23 Ga0070678_100089261 3300005456 Bacteria 2359
24 Ga0070662_100022414 3300005457 Bacteria 4324
25 Ga0070681_10023881 3300005458 Bacteria 6155
26 Ga0070681_10304604 3300005458 Bacteria 1503
27 Ga0068853_100369471 3300005539 Bacteria 1338
28 Ga0068853_100440943 3300005539 Bacteria 1224
29 Ga0070672_100177719 3300005543 Bacteria 1773
30 Ga0070665_100451779 3300005548 Bacteria 1295
31 Ga0068855_101595819 3300005563 Bacteria 668
32 Ga0070664_100808819 3300005564 Bacteria 877
33 Ga0068857_100187772 3300005577 Bacteria 1882
34 Ga0068863_100164815 3300005841 Bacteria 2125
35 Ga0068863_101499757 3300005841 Bacteria 683
36 Ga0068858_100054725 3300005842 Bacteria 3690
37 Ga0081455_10662302 3300005937 Bacteria 670
38 Ga0075365_10055373 3300006038 Bacteria 2632
39 Ga0075369_10049123 3300006186 Bacteria 1822
40 Ga0097621_100024917 3300006237 Bacteria 4677
41 Ga0068871_100065015 3300006358 Bacteria 2987
42 Ga0068871_100307470 3300006358 Bacteria 1393
43 Ga0068871_100440803 3300006358 Bacteria 1166
44 Ga0075430_100105807 3300006846 Bacteria 2348
45 Ga0075431_100261589 3300006847 Bacteria 1755
46 Ga0075431_100638663 3300006847 Bacteria 1046
47 Ga0068865_100088782 3300006881 Bacteria 2237
48 Ga0099826_10030416 3300006948 Bacteria 3922
49 Ga0111539_10005464 3300009094 Bacteria 16439
50 Ga0111539_10064555 3300009094 Bacteria 4330
51 Ga0105245_10251822 3300009098 Bacteria 1716
52 Ga0105245_10367274 3300009098 Bacteria 1430
53 Ga0105245_10484412 3300009098 Bacteria 1251
54 Ga0105241_10052416 3300009174 Bacteria 3115
55 Ga0105242_10584142 3300009176 Bacteria 1076
56 Ga0105242_11191944 3300009176 Bacteria 780
57 Ga0105248_10029540 3300009177 Bacteria 6115
58 Ga0105248_10080823 3300009177 Bacteria 3654
59 Ga0105248_11667119 3300009177 Bacteria 723
60 Ga0105249_10612775 3300009553 Bacteria 1144
61 Ga0105239_10120128 3300010375 Bacteria 2917
62 Ga0157373_10055191 3300013100 Bacteria 2822
63 Ga0157369_10113635 3300013105 Bacteria 2876
64 Ga0157374_10112241 3300013296 Bacteria 2623
65 Ga0157374_10265665 3300013296 Bacteria 1691
66 Ga0157374_10467417 3300013296 Bacteria 1264
67 Ga0163162_10014358 3300013306 Bacteria 7741
68 Ga0163162_10185308 3300013306 Bacteria 2208
69 Ga0163162_10437821 3300013306 Bacteria 1439
70 Ga0163162_10496287 3300013306 Bacteria 1351
71 Ga0157375_10704935 3300013308 Bacteria 1163
72 Ga0163163_10187116 3300014325 Bacteria 2118
73 Ga0163163_10357396 3300014325 Bacteria 1517
74 Ga0157380_10832751 3300014326 Bacteria 943
75 Ga0157379_10276608 3300014968 Bacteria 1527
76 Ga0157376_10121735 3300014969 Bacteria 2314
77 Ga0157376_10404891 3300014969 Bacteria 1320
78 Ga0157376_10774937 3300014969 Bacteria 970
79 Ga0157376_10857751 3300014969 Bacteria 924
80 Ga0163161_10274698 3300017792 Bacteria 1320
81 Ga0163161_12033424 3300017792 Bacteria 511
82 Ga0207705_10169190 3300025909 Bacteria 1645
83 Ga0207707_10155572 3300025912 Bacteria 1999
84 Ga0207707_10248050 3300025912 Bacteria 1547
85 Ga0207660_10136238 3300025917 Bacteria 1874
86 Ga0207652_10193630 3300025921 Bacteria 1829
87 Ga0207659_10400783 3300025926 Bacteria 1147
88 Ga0207687_10317307 3300025927 Bacteria 1260
89 Ga0207644_10054872 3300025931 Bacteria 2870
90 Ga0207644_10078694 3300025931 Bacteria 2431
91 Ga0207644_10340483 3300025931 Bacteria 1216
92 Ga0207706_10229493 3300025933 Bacteria 1625
93 Ga0207669_10744069 3300025937 Bacteria 809
94 Ga0207711_10633971 3300025941 Bacteria 997
95 Ga0207711_10687907 3300025941 Bacteria 954
96 Ga0207661_10909400 3300025944 Bacteria 810
97 Ga0207679_10089075 3300025945 Bacteria 2381
98 Ga0207651_10017281 3300025960 Bacteria 4257
99 Ga0207651_10043919 3300025960 Bacteria 2987
100 Ga0207658_10634181 3300025986 Bacteria 962
101 Ga0207677_10053450 3300026023 Bacteria 2749
102 Ga0207639_10231508 3300026041 Bacteria 1602
103 Ga0207639_10339905 3300026041 Bacteria 1338
104 Ga0207678_10794349 3300026067 Bacteria 835
105 Ga0207702_10922805 3300026078 Bacteria 865
106 Ga0207641_10029919 3300026088 Bacteria 4506
107 Ga0207641_10146504 3300026088 Bacteria 2135
108 Ga0207641_11875520 3300026088 Bacteria 601
109 Ga0207676_10332919 3300026095 Bacteria 1398
110 Ga0207683_10118720 3300026121 Bacteria 2373
111 Ga0209974_10114219 3300027876 Bacteria 952
112 Ga0207428_10110762 3300027907 Bacteria 2113
113 Ga0268264_10212882 3300028381 Bacteria 1775
114 Ga0307515_10109372 3300028794 Bacteria 3246
115 Ga0265339_10101314 3300031249 Bacteria 1498
116 Ga0307516_10355050 3300031730 Bacteria 1131
117 Ga0307413_10392540 3300031824 Bacteria 1085
118 Ga0307413_10526807 3300031824 Bacteria 954
119 Ga0307412_10225721 3300031911 Bacteria 1439
120 Ga0307415_100363469 3300032126 Bacteria 1223
121 Ga0307415_101045157 3300032126 Bacteria 762
122 Ga0307415_101821661 3300032126 Bacteria 589
123 Ga0373946_0518290 3300035171 Bacteria 613
124 Ga0373927_0594133 3300035695 Bacteria 732
125 Ga0373933_0195212 3300035724 Bacteria 1294
126 Ga0373937_0201588 3300036401 Bacteria 1870
127 Ga0395900_0090173 3300037418 Bacteria 3151
128 Ga0395901_0076964 3300038443 Bacteria 3481
129 Ga0451807_1493573 3300041486 Bacteria 1017
130 Ga0451833_0471330 3300041491 Bacteria 621
131 Ga0451837_1296518 3300041494 Bacteria 540
132 Ga0451839_0165818 3300041496 Bacteria 612
133 Ga0439433_0057899 3300041999 Bacteria 921
134 Ga0450901_002990 3300042533 Bacteria 1784
135 Ga0451577_0000595 3300042876 Bacteria 58048
136 Ga0451577_0056316 3300042876 Bacteria 3506
137 Ga0451577_0297263 3300042876 Bacteria 1463
138 Ga0466965_0286310 3300044683 Bacteria 891
139 Ga0453684_0000327 3300044712 Bacteria 200341
140 Ga0453684_0073019 3300044712 Bacteria 4327
141 Ga0453684_0181663 3300044712 Bacteria 2469
142 Ga0451576_0051431 3300045051 Bacteria 4320
143 Ga0466967_0051328 3300045976 Bacteria 3614
144 Ga0495629_0011949 3300046459 Bacteria 6297
145 Ga0495651_0221473 3300046462 Bacteria 1309
146 Ga0495652_0092652 3300046529 Bacteria 2468
147 Ga0495587_0033911 3300046536 Bacteria 3080
148 Ga0495645_0037819 3300046543 Bacteria 3518
149 Ga0495613_0156906 3300046689 Bacteria 1621
150 Ga0495600_0159154 3300046809 Bacteria 1460
151 Ga0495674_0202178 3300047319 Bacteria 1648
152 Ga0495672_0000242 3300047320 Bacteria 76766
153 Ga0495676_0657590 3300047321 Bacteria 680
154 Ga0495684_0675583 3300047471 Bacteria 688
155 Ga0495686_0000007 3300047472 Bacteria 732622
156 Ga0496101_0072698 3300048904 Bacteria 2525
157 Ga0496101_0101149 3300048904 Bacteria 2158
158 Ga0496101_0755444 3300048904 Bacteria 767
159 Ga0496102_0014891 3300048905 Bacteria 6766
160 Ga0496104_0142071 3300048907 Bacteria 2306
161 Ga0496104_0285761 3300048907 Bacteria 1562
162 Ga0496105_0039758 3300048908 Bacteria 3878
163 Ga0496105_0277244 3300048908 Bacteria 1353
164 Ga0496106_0499786 3300048909 Bacteria 977
165 Ga0496107_0394231 3300048910 Bacteria 1030
166 Ga0496108_0228588 3300048911 Bacteria 1617
167 Ga0496109_0133248 3300048912 Bacteria 2321
168 Ga0496112_0082744 3300048915 Bacteria 3174
169 Ga0496112_0087329 3300048915 Bacteria 3085
170 Ga0496113_0019304 3300048916 Bacteria 4766
171 Ga0496114_0000004 3300048917 Bacteria 591126
172 Ga0496117_0095097 3300048920 Bacteria 1905
173 Ga0496117_0552674 3300048920 Bacteria 548
174 Ga0496122_0138891 3300048925 Bacteria 1524
175 Ga0496123_0039712 3300048926 Bacteria 3288
176 Ga0496126_0377478 3300048929 Bacteria 1155
177 Ga0501032_0032809 3300049569 Bacteria 3558
178 Ga0501032_0035206 3300049569 Bacteria 3425
179 Ga0501032_0223361 3300049569 Bacteria 1225
180 Ga0501032_0477707 3300049569 Bacteria 797
181 Ga0501033_0047571 3300049570 Bacteria 3189
182 Ga0501033_0066532 3300049570 Bacteria 2650
183 Ga0501034_0000071 3300049571 Bacteria 180636
184 Ga0501034_0000104 3300049571 Bacteria 155848
185 Ga0501034_0004999 3300049571 Bacteria 14589
186 Ga0501034_0126984 3300049571 Bacteria 2535
187 Ga0501034_0667244 3300049571 Bacteria 940
188 Ga0501036_0095566 3300049572 Bacteria 2512
189 Ga0501036_0512631 3300049572 Bacteria 998
190 Ga0501037_0000712 3300049573 Bacteria 25281
191 Ga0501037_0018150 3300049573 Bacteria 5183
192 Ga0501037_0419355 3300049573 Bacteria 916
193 Ga0501042_0049785 3300049578 Bacteria 2990
194 Ga0501043_0199050 3300049579 Bacteria 1556
195 Ga0501043_0251052 3300049579 Bacteria 1362
196 Ga0501046_0138733 3300049580 Bacteria 1841
197 Ga0501047_0000824 3300049581 Bacteria 32137
198 Ga0501047_0001794 3300049581 Bacteria 20777
199 Ga0501047_0081453 3300049581 Bacteria 3111
200 Ga0501047_0288168 3300049581 Bacteria 1486
201 Ga0501047_0311213 3300049581 Bacteria 1415
202 Ga0501047_0506713 3300049581 Bacteria 1033
203 Ga0501047_0631235 3300049581 Bacteria 891
204 Ga0501047_0714880 3300049581 Bacteria 819
205 Ga0501048_0048857 3300049582 Bacteria 3017
206 Ga0501067_0000875 3300049583 Bacteria 16166
207 Ga0501067_0130937 3300049583 Bacteria 1396
208 Ga0501070_0807807 3300049586 Bacteria 736
209 Ga0501072_1290578 3300049588 Bacteria 566
210 Ga0501073_0000001 3300049589 Bacteria 677932
211 Ga0501073_0044136 3300049589 Bacteria 3141
212 Ga0501073_0331626 3300049589 Bacteria 1050
213 Ga0501074_0245008 3300049590 Bacteria 1275
214 Ga0501076_0126296 3300049592 Bacteria 2073
215 Ga0501077_0056684 3300049593 Bacteria 2487
216 Ga0501080_0009674 3300049742 Bacteria 8801
217 Ga0501083_0075917 3300049744 Bacteria 2231
218 Ga0501035_0000506 3300049822 Bacteria 43989
219 Ga0501035_0044490 3300049822 Bacteria 3998
220 Ga0501035_0267440 3300049822 Bacteria 1448
221 Ga0501035_0675300 3300049822 Bacteria 835
222 Ga0501044_0012788 3300049823 Bacteria 9090
223 Ga0501044_0013200 3300049823 Bacteria 8946
224 nmdc:mga0k408_865640_c1 3300050493 Bacteria 525
225 nmdc:mga0qj67_112833_c1 3300050509 Bacteria 2194
226 nmdc:mga06r32_172040_c1 3300050510 Bacteria 2150
227 nmdc:mga06r32_488248_c1 3300050510 Bacteria 1209
228 nmdc:mga08y16_36165_c1 3300050511 Bacteria 5186
229 nmdc:mga08y16_56757_c1 3300050511 Bacteria 4092
230 nmdc:mga08x19_925376_c1 3300050514 Bacteria 619
231 Ga0495595_0148977 3300053084 Bacteria 1151
232 Ga0495595_0444424 3300053084 Bacteria 659
233 Ga0500604_0178426 3300053151 Bacteria 727
234 Ga0500616_0087727 3300053153 Bacteria 1548
235 Ga0500616_0164231 3300053153 Bacteria 1015
236 Ga0501084_0059326 3300054114 Bacteria 3202
237 Ga0501084_0195803 3300054114 Bacteria 1705
238 Ga0501084_0280057 3300054114 Bacteria 1408
239 Ga0501084_0765589 3300054114 Bacteria 813
240 Ga0501082_0001140 3300060353 Bacteria 23441
241 Ga0501082_0153516 3300060353 Bacteria 2000

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049583 Ga0501067_0130937 Ga0501067_0130937_89_556 154
2 iso_pu_bacteria 2818991467 2819716901 155
3 iso_pu_bacteria 2869162929 2869167491 155
4 3300028794 Ga0307515_10109372 Ga0307515_101093724 156
5 3300042533 Ga0450901_002990 Ga0450901_002990_77_553 156
6 3300002774 JGI25150J39212_1003061 JGI25150J39212_10030614 157
7 3300005290 Ga0065712_10069397 Ga0065712_100693973 157
8 3300005290 Ga0065712_10256491 Ga0065712_102564912 157
9 3300005293 Ga0065715_10745206 Ga0065715_107452061 157
10 3300005327 Ga0070658_10174233 Ga0070658_101742332 157
11 3300005329 Ga0070683_100139563 Ga0070683_1001395633 157
12 3300005329 Ga0070683_100279589 Ga0070683_1002795892 157
13 3300005336 Ga0070680_100240502 Ga0070680_1002405022 157
14 3300005336 Ga0070680_100319896 Ga0070680_1003198962 157
15 3300005337 Ga0070682_100163545 Ga0070682_1001635452 157
16 3300005338 Ga0068868_100033648 Ga0068868_1000336481 157
17 3300005355 Ga0070671_100064098 Ga0070671_1000640981 157
18 3300005355 Ga0070671_100138745 Ga0070671_1001387453 157
19 3300005355 Ga0070671_100146983 Ga0070671_1001469832 157
20 3300005355 Ga0070671_100196150 Ga0070671_1001961502 157
21 3300005364 Ga0070673_100051604 Ga0070673_1000516042 157
22 3300005364 Ga0070673_100059853 Ga0070673_1000598533 157
23 3300005364 Ga0070673_100210596 Ga0070673_1002105962 157
24 3300005366 Ga0070659_100834219 Ga0070659_1008342191 157
25 3300005367 Ga0070667_100296314 Ga0070667_1002963141 157
26 3300005455 Ga0070663_100206322 Ga0070663_1002063222 157
27 3300005456 Ga0070678_100012064 Ga0070678_1000120646 157
28 3300005456 Ga0070678_100089261 Ga0070678_1000892614 157
29 3300005457 Ga0070662_100022414 Ga0070662_1000224144 157
30 3300005458 Ga0070681_10023881 Ga0070681_100238817 157
31 3300005458 Ga0070681_10304604 Ga0070681_103046042 157
32 3300005539 Ga0068853_100369471 Ga0068853_1003694711 157
33 3300005539 Ga0068853_100440943 Ga0068853_1004409432 157
34 3300005543 Ga0070672_100177719 Ga0070672_1001777193 157
35 3300005548 Ga0070665_100451779 Ga0070665_1004517791 157
36 3300005563 Ga0068855_101595819 Ga0068855_1015958192 157
37 3300005564 Ga0070664_100808819 Ga0070664_1008088192 157
38 3300005577 Ga0068857_100187772 Ga0068857_1001877721 157
39 3300005841 Ga0068863_100164815 Ga0068863_1001648152 157
40 3300005841 Ga0068863_101499757 Ga0068863_1014997571 157
41 3300005842 Ga0068858_100054725 Ga0068858_1000547254 157
42 3300005937 Ga0081455_10662302 Ga0081455_106623021 157
43 3300006038 Ga0075365_10055373 Ga0075365_100553733 157
44 3300006186 Ga0075369_10049123 Ga0075369_100491231 157
45 3300006237 Ga0097621_100024917 Ga0097621_1000249174 157
46 3300006358 Ga0068871_100065015 Ga0068871_1000650151 157
47 3300006358 Ga0068871_100307470 Ga0068871_1003074702 157
48 3300006358 Ga0068871_100440803 Ga0068871_1004408032 157
49 3300006846 Ga0075430_100105807 Ga0075430_1001058074 157
50 3300006847 Ga0075431_100261589 Ga0075431_1002615892 157
51 3300006847 Ga0075431_100638663 Ga0075431_1006386632 157
52 3300006881 Ga0068865_100088782 Ga0068865_1000887822 157
53 3300006948 Ga0099826_10030416 Ga0099826_100304162 157
54 3300009094 Ga0111539_10005464 Ga0111539_1000546411 157
55 3300009094 Ga0111539_10064555 Ga0111539_100645553 157
56 3300009098 Ga0105245_10251822 Ga0105245_102518222 157
57 3300009098 Ga0105245_10367274 Ga0105245_103672743 157
58 3300009098 Ga0105245_10484412 Ga0105245_104844122 157
59 3300009174 Ga0105241_10052416 Ga0105241_100524163 157
60 3300009176 Ga0105242_10584142 Ga0105242_105841422 157
61 3300009176 Ga0105242_11191944 Ga0105242_111919442 157
62 3300009177 Ga0105248_10029540 Ga0105248_100295405 157
63 3300009177 Ga0105248_10080823 Ga0105248_100808232 157
64 3300009177 Ga0105248_11667119 Ga0105248_116671191 157
65 3300009553 Ga0105249_10612775 Ga0105249_106127752 157
66 3300010375 Ga0105239_10120128 Ga0105239_101201284 157
67 3300013100 Ga0157373_10055191 Ga0157373_100551913 157
68 3300013105 Ga0157369_10113635 Ga0157369_101136353 157
69 3300013296 Ga0157374_10112241 Ga0157374_101122413 157
70 3300013296 Ga0157374_10265665 Ga0157374_102656652 157
71 3300013296 Ga0157374_10467417 Ga0157374_104674172 157
72 3300013306 Ga0163162_10014358 Ga0163162_100143584 157
73 3300013306 Ga0163162_10185308 Ga0163162_101853083 157
74 3300013306 Ga0163162_10437821 Ga0163162_104378213 157
75 3300013306 Ga0163162_10496287 Ga0163162_104962872 157
76 3300013308 Ga0157375_10704935 Ga0157375_107049352 157
77 3300014325 Ga0163163_10187116 Ga0163163_101871162 157
78 3300014325 Ga0163163_10357396 Ga0163163_103573961 157
79 3300014326 Ga0157380_10832751 Ga0157380_108327511 157
80 3300014968 Ga0157379_10276608 Ga0157379_102766082 157
81 3300014969 Ga0157376_10121735 Ga0157376_101217352 157
82 3300014969 Ga0157376_10404891 Ga0157376_104048912 157
83 3300014969 Ga0157376_10774937 Ga0157376_107749372 157
84 3300014969 Ga0157376_10857751 Ga0157376_108577512 157
85 3300017792 Ga0163161_10274698 Ga0163161_102746982 157
86 3300017792 Ga0163161_12033424 Ga0163161_120334241 157
87 3300025909 Ga0207705_10169190 Ga0207705_101691903 157
88 3300025912 Ga0207707_10155572 Ga0207707_101555722 157
89 3300025912 Ga0207707_10248050 Ga0207707_102480502 157
90 3300025917 Ga0207660_10136238 Ga0207660_101362383 157
91 3300025921 Ga0207652_10193630 Ga0207652_101936303 157
92 3300025926 Ga0207659_10400783 Ga0207659_104007832 157
93 3300025927 Ga0207687_10317307 Ga0207687_103173071 157
94 3300025931 Ga0207644_10054872 Ga0207644_100548723 157
95 3300025931 Ga0207644_10078694 Ga0207644_100786942 157
96 3300025931 Ga0207644_10340483 Ga0207644_103404831 157
97 3300025933 Ga0207706_10229493 Ga0207706_102294932 157
98 3300025937 Ga0207669_10744069 Ga0207669_107440691 157
99 3300025941 Ga0207711_10633971 Ga0207711_106339712 157
100 3300025941 Ga0207711_10687907 Ga0207711_106879072 157
101 3300025944 Ga0207661_10909400 Ga0207661_109094002 157
102 3300025945 Ga0207679_10089075 Ga0207679_100890752 157
103 3300025960 Ga0207651_10017281 Ga0207651_100172815 157
104 3300025960 Ga0207651_10043919 Ga0207651_100439193 157
105 3300025986 Ga0207658_10634181 Ga0207658_106341811 157
106 3300026023 Ga0207677_10053450 Ga0207677_100534502 157
107 3300026041 Ga0207639_10231508 Ga0207639_102315082 157
108 3300026041 Ga0207639_10339905 Ga0207639_103399052 157
109 3300026067 Ga0207678_10794349 Ga0207678_107943491 157
110 3300026078 Ga0207702_10922805 Ga0207702_109228051 157
111 3300026088 Ga0207641_10029919 Ga0207641_100299192 157
112 3300026088 Ga0207641_10146504 Ga0207641_101465043 157
113 3300026088 Ga0207641_11875520 Ga0207641_118755201 157
114 3300026095 Ga0207676_10332919 Ga0207676_103329192 157
115 3300026121 Ga0207683_10118720 Ga0207683_101187202 157
116 3300027876 Ga0209974_10114219 Ga0209974_101142192 157
117 3300027907 Ga0207428_10110762 Ga0207428_101107622 157
118 3300028381 Ga0268264_10212882 Ga0268264_102128823 157
119 3300031249 Ga0265339_10101314 Ga0265339_101013143 157
120 3300031730 Ga0307516_10355050 Ga0307516_103550502 157
121 3300031824 Ga0307413_10392540 Ga0307413_103925401 157
122 3300031824 Ga0307413_10526807 Ga0307413_105268072 157
123 3300031911 Ga0307412_10225721 Ga0307412_102257212 157
124 3300032126 Ga0307415_100363469 Ga0307415_1003634692 157
125 3300032126 Ga0307415_101045157 Ga0307415_1010451571 157
126 3300032126 Ga0307415_101821661 Ga0307415_1018216611 157
127 3300035171 Ga0373946_0518290 Ga0373946_0518290_115_594 157
128 3300035695 Ga0373927_0594133 Ga0373927_0594133_28_510 157
129 3300035724 Ga0373933_0195212 Ga0373933_0195212_731_1207 157
130 3300036401 Ga0373937_0201588 Ga0373937_0201588_1154_1630 157
131 3300037418 Ga0395900_0090173 Ga0395900_0090173_1919_2392 157
132 3300038443 Ga0395901_0076964 Ga0395901_0076964_169_642 157
133 3300041486 Ga0451807_1493573 Ga0451807_1493573_398_877 157
134 3300041491 Ga0451833_0471330 Ga0451833_0471330_85_561 157
135 3300041494 Ga0451837_1296518 Ga0451837_1296518_28_507 157
136 3300041496 Ga0451839_0165818 Ga0451839_0165818_31_507 157
137 3300041999 Ga0439433_0057899 Ga0439433_0057899_380_856 157
138 3300042876 Ga0451577_0000595 Ga0451577_0000595_14716_15201 157
139 3300042876 Ga0451577_0056316 Ga0451577_0056316_1567_2091 157
140 3300042876 Ga0451577_0297263 Ga0451577_0297263_523_1008 157
141 3300044683 Ga0466965_0286310 Ga0466965_0286310_167_649 157
142 3300044712 Ga0453684_0000327 Ga0453684_0000327_117874_118359 157
143 3300044712 Ga0453684_0073019 Ga0453684_0073019_2668_3192 157
144 3300044712 Ga0453684_0181663 Ga0453684_0181663_858_1343 157
145 3300045051 Ga0451576_0051431 Ga0451576_0051431_1386_1862 157
146 3300045976 Ga0466967_0051328 Ga0466967_0051328_561_1037 157
147 3300046459 Ga0495629_0011949 Ga0495629_0011949_4253_4729 157
148 3300046462 Ga0495651_0221473 Ga0495651_0221473_224_700 157
149 3300046529 Ga0495652_0092652 Ga0495652_0092652_165_641 157
150 3300046536 Ga0495587_0033911 Ga0495587_0033911_2569_3045 157
151 3300046543 Ga0495645_0037819 Ga0495645_0037819_1951_2427 157
152 3300046689 Ga0495613_0156906 Ga0495613_0156906_799_1275 157
153 3300046809 Ga0495600_0159154 Ga0495600_0159154_389_865 157
154 3300047319 Ga0495674_0202178 Ga0495674_0202178_1058_1534 157
155 3300047320 Ga0495672_0000242 Ga0495672_0000242_20152_20679 157
156 3300047321 Ga0495676_0657590 Ga0495676_0657590_31_510 157
157 3300047471 Ga0495684_0675583 Ga0495684_0675583_149_625 157
158 3300047472 Ga0495686_0000007 Ga0495686_0000007_310810_311283 157
159 3300048904 Ga0496101_0072698 Ga0496101_0072698_27_503 157
160 3300048904 Ga0496101_0101149 Ga0496101_0101149_1195_1671 157
161 3300048904 Ga0496101_0755444 Ga0496101_0755444_220_693 157
162 3300048905 Ga0496102_0014891 Ga0496102_0014891_2156_2629 157
163 3300048907 Ga0496104_0142071 Ga0496104_0142071_1400_1885 157
164 3300048907 Ga0496104_0285761 Ga0496104_0285761_201_677 157
165 3300048908 Ga0496105_0039758 Ga0496105_0039758_2482_2958 157
166 3300048908 Ga0496105_0277244 Ga0496105_0277244_56_541 157
167 3300048909 Ga0496106_0499786 Ga0496106_0499786_28_504 157
168 3300048910 Ga0496107_0394231 Ga0496107_0394231_434_910 157
169 3300048911 Ga0496108_0228588 Ga0496108_0228588_266_751 157
170 3300048912 Ga0496109_0133248 Ga0496109_0133248_481_954 157
171 3300048915 Ga0496112_0082744 Ga0496112_0082744_2529_3002 157
172 3300048915 Ga0496112_0087329 Ga0496112_0087329_2099_2572 157
173 3300048916 Ga0496113_0019304 Ga0496113_0019304_2464_2943 157
174 3300048917 Ga0496114_0000004 Ga0496114_0000004_219576_220061 157
175 3300048920 Ga0496117_0095097 Ga0496117_0095097_185_673 157
176 3300048920 Ga0496117_0552674 Ga0496117_0552674_48_527 157
177 3300048925 Ga0496122_0138891 Ga0496122_0138891_375_854 157
178 3300048926 Ga0496123_0039712 Ga0496123_0039712_547_1026 157
179 3300048929 Ga0496126_0377478 Ga0496126_0377478_634_1113 157
180 3300049569 Ga0501032_0032809 Ga0501032_0032809_2595_3071 157
181 3300049569 Ga0501032_0035206 Ga0501032_0035206_2031_2504 157
182 3300049569 Ga0501032_0223361 Ga0501032_0223361_677_1153 157
183 3300049569 Ga0501032_0477707 Ga0501032_0477707_36_518 157
184 3300049570 Ga0501033_0047571 Ga0501033_0047571_1616_2095 157
185 3300049570 Ga0501033_0066532 Ga0501033_0066532_499_990 157
186 3300049571 Ga0501034_0000071 Ga0501034_0000071_8535_9017 157
187 3300049571 Ga0501034_0000104 Ga0501034_0000104_93627_94103 157
188 3300049571 Ga0501034_0004999 Ga0501034_0004999_2272_2748 157
189 3300049571 Ga0501034_0126984 Ga0501034_0126984_1504_1977 157
190 3300049571 Ga0501034_0667244 Ga0501034_0667244_47_562 157
191 3300049572 Ga0501036_0095566 Ga0501036_0095566_1417_1890 157
192 3300049572 Ga0501036_0512631 Ga0501036_0512631_190_672 157
193 3300049573 Ga0501037_0000712 Ga0501037_0000712_9212_9688 157
194 3300049573 Ga0501037_0018150 Ga0501037_0018150_3609_4091 157
195 3300049573 Ga0501037_0419355 Ga0501037_0419355_246_737 157
196 3300049578 Ga0501042_0049785 Ga0501042_0049785_1850_2326 157
197 3300049579 Ga0501043_0199050 Ga0501043_0199050_348_824 157
198 3300049579 Ga0501043_0251052 Ga0501043_0251052_51_524 157
199 3300049580 Ga0501046_0138733 Ga0501046_0138733_225_698 157
200 3300049581 Ga0501047_0000824 Ga0501047_0000824_6289_6765 157
201 3300049581 Ga0501047_0001794 Ga0501047_0001794_19826_20308 157
202 3300049581 Ga0501047_0081453 Ga0501047_0081453_2294_2785 157
203 3300049581 Ga0501047_0288168 Ga0501047_0288168_640_1119 157
204 3300049581 Ga0501047_0311213 Ga0501047_0311213_417_890 157
205 3300049581 Ga0501047_0506713 Ga0501047_0506713_417_890 157
206 3300049581 Ga0501047_0631235 Ga0501047_0631235_342_818 157
207 3300049581 Ga0501047_0714880 Ga0501047_0714880_40_519 157
208 3300049582 Ga0501048_0048857 Ga0501048_0048857_778_1251 157
209 3300049583 Ga0501067_0000875 Ga0501067_0000875_10971_11453 157
210 3300049586 Ga0501070_0807807 Ga0501070_0807807_215_691 157
211 3300049588 Ga0501072_1290578 Ga0501072_1290578_27_503 157
212 3300049589 Ga0501073_0000001 Ga0501073_0000001_488607_489089 157
213 3300049589 Ga0501073_0044136 Ga0501073_0044136_87_563 157
214 3300049589 Ga0501073_0331626 Ga0501073_0331626_86_571 157
215 3300049590 Ga0501074_0245008 Ga0501074_0245008_515_994 157
216 3300049592 Ga0501076_0126296 Ga0501076_0126296_197_679 157
217 3300049593 Ga0501077_0056684 Ga0501077_0056684_1758_2240 157
218 3300049742 Ga0501080_0009674 Ga0501080_0009674_3706_4188 157
219 3300049744 Ga0501083_0075917 Ga0501083_0075917_1698_2180 157
220 3300049822 Ga0501035_0000506 Ga0501035_0000506_25529_26005 157
221 3300049822 Ga0501035_0044490 Ga0501035_0044490_1304_1783 157
222 3300049822 Ga0501035_0267440 Ga0501035_0267440_271_762 157
223 3300049822 Ga0501035_0675300 Ga0501035_0675300_46_525 157
224 3300049823 Ga0501044_0012788 Ga0501044_0012788_2919_3395 157
225 3300049823 Ga0501044_0013200 Ga0501044_0013200_7633_8124 157
226 3300050493 nmdc:mga0k408_865640_c1 nmdc:mga0k408_865640_c1_17_493 157
227 3300050509 nmdc:mga0qj67_112833_c1 nmdc:mga0qj67_112833_c1_507_983 157
228 3300050510 nmdc:mga06r32_172040_c1 nmdc:mga06r32_172040_c1_991_1467 157
229 3300050510 nmdc:mga06r32_488248_c1 nmdc:mga06r32_488248_c1_13_495 157
230 3300050511 nmdc:mga08y16_36165_c1 nmdc:mga08y16_36165_c1_587_1069 157
231 3300050511 nmdc:mga08y16_56757_c1 nmdc:mga08y16_56757_c1_1621_2097 157
232 3300050514 nmdc:mga08x19_925376_c1 nmdc:mga08x19_925376_c1_25_501 157
233 3300053084 Ga0495595_0148977 Ga0495595_0148977_155_631 157
234 3300053084 Ga0495595_0444424 Ga0495595_0444424_128_604 157
235 3300053151 Ga0500604_0178426 Ga0500604_0178426_42_515 157
236 3300053153 Ga0500616_0087727 Ga0500616_0087727_57_530 157
237 3300053153 Ga0500616_0164231 Ga0500616_0164231_183_656 157
238 3300054114 Ga0501084_0059326 Ga0501084_0059326_2315_2794 157
239 3300054114 Ga0501084_0195803 Ga0501084_0195803_531_1010 157
240 3300054114 Ga0501084_0280057 Ga0501084_0280057_262_741 157
241 3300054114 Ga0501084_0765589 Ga0501084_0765589_237_719 157
242 3300060353 Ga0501082_0001140 Ga0501082_0001140_16421_16903 157
243 3300060353 Ga0501082_0153516 Ga0501082_0153516_1406_1885 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

37

153

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tsj-assembly1.cif.gz_A crystal structure of protein from staphylococcus aureus 0.7986 1 117
1tsj-assembly1.cif.gz_A crystal structure of protein from staphylococcus aureus 0.755 1 117
8bxl-assembly3.cif.gz_E patulin synthase from penicillium expansum 0.711 28 64
8ckb-assembly1.cif.gz_E002 asymmetric reconstruction of the crass001 virion 0.6661 78 119
1kmz-assembly1.cif.gz_A molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.6287 5 119
ID Description Score Start End Superfamily
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8708 78 119 3.30.720.110
af_A0A1D8PQM9_7_118_1.10.8.1290 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Glutaminyl-tRNA synthetase, non-specific RNA binding region part 1, domain 1 0.8198 122 151 1.10.8.1290
af_Q9Y7Y8_3_120_1.10.8.1290 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Glutaminyl-tRNA synthetase, non-specific RNA binding region part 1, domain 1 0.7867 122 151 1.10.8.1290
3omsA01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7719 7 64 3.30.720.100
1tsjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7204 1 117 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A519PAD1-F1-model_v4 deleted 0.9875 1 60
AF-A0A435UWU8-F1-model_v4 deleted 0.9815 78 152
AF-A0A1G4T9J9-F1-model_v4 3-demethylubiquinone-9 3-methyltransferase 0.9794 78 152 GO:0008168
GO:0032259
AF-H0FSF1-F1-model_v4 PhnB-like domain-containing protein 0.9744 78 152
AF-A0A531K413-F1-model_v4 VOC family protein 0.9741 1 60

Feature Viewer

pLDDT pTM Quality
91.31 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map