F355477

General Info

Members Datasets Scaffolds Average Seq Length
243 128 486 137

Family's Representative Sequence

Representative Sequence 3300006178|Ga0075367_10091407|Ga0075367_100914073
Length 160
Sequence MLKFFTLFLNFGLFLASTIQGELTLSIIKPDAVAANHIGDIIARFEKNGLHIAAIKMVKLTQEDAENFYAVHKERPFYQNLVQFMSSGPVVAMVLEGNDAIVKNRQIMGATDPTKASSGTIRSDFASSTTRNAVHGSDSPDTAKEEIAFFFKPNEIFIMH

Samples

Sample ID Description Type Environment
1 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
80 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
81 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
82 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
86 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
87 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
88 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
89 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
90 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
93 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
94 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
95 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
96 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
103 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
104 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
105 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
106 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
107 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
108 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
109 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
110 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
111 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
112 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
115 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
116 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
117 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
118 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
119 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
120 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
121 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
122 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
123 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
124 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
125 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
126 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
127 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
128 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.65
Nodule 0
Rhizoplane 4.12
Rhizosphere 93.83
Stem 0
Stem Tuber 0
Unclassified 11.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075367_10091407 3300006178 Bacteria 1852
2 rootL2_10008767 3300003322 Bacteria 4121
3 Ga0070683_100138292 3300005329 Bacteria 2307
4 Ga0070680_100017210 3300005336 Bacteria 5696
5 Ga0070680_100255431 3300005336 Bacteria 1482
6 Ga0070680_101702054 3300005336 Unclassified 547
7 Ga0070660_100262830 3300005339 Bacteria 1410
8 Ga0070691_10234663 3300005341 Unclassified 978
9 Ga0070671_101658357 3300005355 Bacteria 567
10 Ga0070674_100464959 3300005356 Bacteria 1047
11 Ga0070659_101106054 3300005366 Bacteria 698
12 Ga0070703_10000072 3300005406 Bacteria 50010
13 Ga0070703_10097993 3300005406 Unclassified 1029
14 Ga0070713_100495637 3300005436 Bacteria 1152
15 Ga0070705_100011075 3300005440 Bacteria 4537
16 Ga0070705_100015143 3300005440 Bacteria 3980
17 Ga0070705_100036834 3300005440 Bacteria 2754
18 Ga0070705_100096439 3300005440 Bacteria 1856
19 Ga0070705_100244531 3300005440 Unclassified 1256
20 Ga0070705_101143512 3300005440 Bacteria 639
21 Ga0070694_100002082 3300005444 Bacteria 11878
22 Ga0070694_100056541 3300005444 Bacteria 2665
23 Ga0070694_100081410 3300005444 Bacteria 2252
24 Ga0070694_100742386 3300005444 Bacteria 801
25 Ga0070708_100000086 3300005445 Bacteria 61026
26 Ga0070708_100004686 3300005445 Bacteria 10778
27 Ga0070708_100051379 3300005445 Bacteria 3652
28 Ga0070708_100109715 3300005445 Bacteria 2535
29 Ga0070708_100155812 3300005445 Bacteria 2127
30 Ga0070708_100159871 3300005445 Bacteria 2099
31 Ga0070708_100586890 3300005445 Unclassified 1051
32 Ga0070708_101696905 3300005445 Bacteria 587
33 Ga0070681_10888029 3300005458 Bacteria 810
34 Ga0070681_11108249 3300005458 Unclassified 713
35 Ga0068867_101369686 3300005459 Unclassified 655
36 Ga0070706_100004501 3300005467 Bacteria 13433
37 Ga0070706_100188658 3300005467 Bacteria 1927
38 Ga0070706_100774141 3300005467 Bacteria 889
39 Ga0070706_101280334 3300005467 Bacteria 673
40 Ga0070707_100009596 3300005468 Bacteria 8991
41 Ga0070707_100077551 3300005468 Bacteria 3206
42 Ga0070707_100298999 3300005468 Bacteria 1564
43 Ga0070707_100341416 3300005468 Bacteria 1455
44 Ga0070707_100665350 3300005468 Bacteria 1004
45 Ga0070707_100840871 3300005468 Bacteria 882
46 Ga0070707_101478803 3300005468 Bacteria 646
47 Ga0070698_100013098 3300005471 Bacteria 8778
48 Ga0070699_100068235 3300005518 Bacteria 3088
49 Ga0070699_100094201 3300005518 Bacteria 2621
50 Ga0070699_100162521 3300005518 Bacteria 1977
51 Ga0070699_100268630 3300005518 Bacteria 1526
52 Ga0070679_100236847 3300005530 Unclassified 1784
53 Ga0070684_100062927 3300005535 Bacteria 3251
54 Ga0070697_100025665 3300005536 Bacteria 4701
55 Ga0070697_100050577 3300005536 Bacteria 3374
56 Ga0070697_100060733 3300005536 Bacteria 3081
57 Ga0070697_100077213 3300005536 Bacteria 2739
58 Ga0070697_101054050 3300005536 Unclassified 723
59 Ga0070672_101243146 3300005543 Bacteria 664
60 Ga0070686_100667226 3300005544 Bacteria 826
61 Ga0070695_100004784 3300005545 Bacteria 7969
62 Ga0070695_100009017 3300005545 Bacteria 5931
63 Ga0070695_100013364 3300005545 Bacteria 4932
64 Ga0070695_100485345 3300005545 Bacteria 953
65 Ga0070696_100000364 3300005546 Bacteria 27704
66 Ga0070696_100029482 3300005546 Bacteria 3751
67 Ga0070696_100070501 3300005546 Bacteria 2459
68 Ga0070696_100328689 3300005546 Bacteria 1178
69 Ga0070696_101372994 3300005546 Unclassified 602
70 Ga0070704_100000705 3300005549 Bacteria 16279
71 Ga0070704_100006296 3300005549 Bacteria 6992
72 Ga0070704_100024299 3300005549 Bacteria 3975
73 Ga0070704_100035446 3300005549 Bacteria 3392
74 Ga0070704_100195237 3300005549 Bacteria 1630
75 Ga0068855_101137550 3300005563 Unclassified 814
76 Ga0070664_100506087 3300005564 Bacteria 1113
77 Ga0068854_102020551 3300005578 Unclassified 531
78 Ga0070702_100545005 3300005615 Unclassified 860
79 Ga0068870_10534299 3300005840 Bacteria 787
80 Ga0068860_102334795 3300005843 Unclassified 555
81 Ga0070716_100137161 3300006173 Bacteria 1555
82 Ga0070716_100320021 3300006173 Bacteria 1086
83 Ga0070712_100105652 3300006175 Bacteria 2092
84 Ga0075367_10088762 3300006178 Bacteria 1879
85 Ga0075428_100072622 3300006844 Bacteria 3758
86 Ga0075431_100003686 3300006847 Bacteria 14880
87 Ga0075431_100099738 3300006847 Bacteria 2996
88 Ga0075431_100109028 3300006847 Bacteria 2858
89 Ga0075431_101200323 3300006847 Unclassified 721
90 Ga0075433_10038523 3300006852 Bacteria 4129
91 Ga0075433_10111590 3300006852 Bacteria 2426
92 Ga0075433_10118248 3300006852 Bacteria 2352
93 Ga0075433_10128479 3300006852 Bacteria 2251
94 Ga0075433_10130738 3300006852 Bacteria 2230
95 Ga0075433_10383888 3300006852 Bacteria 1240
96 Ga0075433_10545855 3300006852 Bacteria 1019
97 Ga0075434_100003859 3300006871 Bacteria 13410
98 Ga0075434_100150197 3300006871 Bacteria 2350
99 Ga0075434_100163292 3300006871 Bacteria 2247
100 Ga0075434_100189404 3300006871 Bacteria 2077
101 Ga0075434_100529761 3300006871 Bacteria 1198
102 Ga0075434_102198860 3300006871 Bacteria 555
103 Ga0075436_100017210 3300006914 Bacteria 4946
104 Ga0075436_100028903 3300006914 Bacteria 3814
105 Ga0075436_100035279 3300006914 Bacteria 3451
106 Ga0075435_100003405 3300007076 Bacteria 10786
107 Ga0075435_100029232 3300007076 Bacteria 4325
108 Ga0075435_100736313 3300007076 Bacteria 857
109 Ga0075435_101059364 3300007076 Bacteria 708
110 Ga0075435_101333895 3300007076 Unclassified 628
111 Ga0099794_10000064 3300007265 Bacteria 40634
112 Ga0099794_10007390 3300007265 Bacteria 4511
113 Ga0099794_10107203 3300007265 Bacteria 1398
114 Ga0099794_10277466 3300007265 Bacteria 866
115 Ga0105240_10300395 3300009093 Bacteria 1837
116 Ga0111539_10364189 3300009094 Bacteria 1683
117 Ga0111539_10423513 3300009094 Bacteria 1550
118 Ga0114129_10092821 3300009147 Bacteria 4182
119 Ga0114129_10396064 3300009147 Bacteria 1821
120 Ga0114129_11121132 3300009147 Bacteria 984
121 Ga0105246_10107058 3300011119 Bacteria 2047
122 Ga0157370_10131612 3300013104 Bacteria 2333
123 Ga0157369_10274790 3300013105 Bacteria 1755
124 Ga0157369_10793638 3300013105 Unclassified 973
125 Ga0157378_10125173 3300013297 Bacteria 2373
126 Ga0157372_10537134 3300013307 Bacteria 1363
127 Ga0157376_10000658 3300014969 Bacteria 22335
128 Ga0157376_10114601 3300014969 Bacteria 2378
129 Ga0163161_10153620 3300017792 Bacteria 1751
130 Ga0207653_10000053 3300025885 Bacteria 87641
131 Ga0207692_10408199 3300025898 Bacteria 848
132 Ga0207642_10117241 3300025899 Unclassified 1367
133 Ga0207684_10018464 3300025910 Bacteria 5972
134 Ga0207684_10403479 3300025910 Bacteria 1175
135 Ga0207684_10636531 3300025910 Bacteria 909
136 Ga0207684_11032307 3300025910 Bacteria 687
137 Ga0207671_10500104 3300025914 Bacteria 969
138 Ga0207693_10074237 3300025915 Bacteria 2663
139 Ga0207660_10132254 3300025917 Bacteria 1900
140 Ga0207660_10920068 3300025917 Bacteria 714
141 Ga0207660_11285976 3300025917 Unclassified 594
142 Ga0207652_10564264 3300025921 Bacteria 1022
143 Ga0207646_10009095 3300025922 Bacteria 9863
144 Ga0207646_10041478 3300025922 Bacteria 4138
145 Ga0207646_10132836 3300025922 Bacteria 2241
146 Ga0207646_10305744 3300025922 Bacteria 1437
147 Ga0207687_10058630 3300025927 Bacteria 2709
148 Ga0207690_10012717 3300025932 Bacteria 5045
149 Ga0207690_10732431 3300025932 Bacteria 814
150 Ga0207706_10630705 3300025933 Bacteria 919
151 Ga0207669_10394848 3300025937 Bacteria 1082
152 Ga0207665_10240581 3300025939 Bacteria 1333
153 Ga0207665_10817259 3300025939 Bacteria 737
154 Ga0207691_10865344 3300025940 Bacteria 757
155 Ga0207679_10842335 3300025945 Unclassified 837
156 Ga0207639_10226928 3300026041 Bacteria 1616
157 Ga0207678_10810432 3300026067 Unclassified 827
158 Ga0207678_10838940 3300026067 Bacteria 812
159 Ga0207702_10407513 3300026078 Bacteria 1312
160 Ga0207648_11010952 3300026089 Bacteria 779
161 Ga0207648_11173168 3300026089 Bacteria 721
162 Ga0207675_100506473 3300026118 Bacteria 1202
163 Ga0209588_1000495 3300027671 Bacteria 10089
164 Ga0209588_1000498 3300027671 Bacteria 10057
165 Ga0209974_10015536 3300027876 Bacteria 2527
166 Ga0268265_10300090 3300028380 Bacteria 1446
167 Ga0307409_100395303 3300031995 Bacteria 1319
168 Ga0373942_0144996 3300035207 Bacteria 759
169 Ga0451577_0150266 3300042876 Bacteria 2096
170 Ga0453683_0015544 3300044673 Bacteria 4926
171 Ga0453683_0242238 3300044673 Bacteria 1149
172 Ga0453684_0035537 3300044712 Bacteria 6883
173 Ga0451576_0017661 3300045051 Bacteria 7840
174 Ga0451576_0137669 3300045051 Bacteria 2546
175 Ga0495629_0011640 3300046459 Bacteria 6387
176 Ga0495636_0059311 3300047318 Bacteria 1615
177 Ga0495677_0173888 3300047445 Unclassified 834
178 Ga0496104_0013041 3300048907 Bacteria 7486
179 Ga0496105_0357280 3300048908 Bacteria 1166
180 Ga0496105_0629854 3300048908 Bacteria 830
181 Ga0496106_0073083 3300048909 Bacteria 2623
182 Ga0496108_0020311 3300048911 Bacteria 5459
183 Ga0496109_0090279 3300048912 Bacteria 2833
184 Ga0496111_0008134 3300048914 Bacteria 6929
185 Ga0496112_0006373 3300048915 Bacteria 10357
186 Ga0496113_0499181 3300048916 Unclassified 977
187 Ga0496114_0919571 3300048917 Bacteria 756
188 Ga0501033_0728175 3300049570 Bacteria 673
189 Ga0501037_0298610 3300049573 Bacteria 1119
190 Ga0501038_0723672 3300049574 Unclassified 744
191 Ga0501039_0514564 3300049575 Bacteria 940
192 Ga0501040_0382775 3300049576 Bacteria 1009
193 Ga0501042_0010711 3300049578 Bacteria 6163
194 Ga0501067_0001802 3300049583 Bacteria 11766
195 Ga0501068_0000075 3300049584 Bacteria 39857
196 Ga0501068_0617125 3300049584 Bacteria 707
197 Ga0501069_0051125 3300049585 Bacteria 2299
198 Ga0501070_0011931 3300049586 Bacteria 7340
199 Ga0501071_0000468 3300049587 Bacteria 20369
200 Ga0501072_0030094 3300049588 Bacteria 4244
201 Ga0501073_0022832 3300049589 Bacteria 4499
202 Ga0501074_0000981 3300049590 Bacteria 18483
203 Ga0501075_0847996 3300049591 Bacteria 695
204 Ga0501077_0000496 3300049593 Bacteria 23850
205 Ga0501079_0020314 3300049741 Bacteria 5076
206 Ga0501080_0052966 3300049742 Bacteria 3777
207 Ga0501081_0342337 3300049743 Bacteria 1101
208 Ga0501083_0278360 3300049744 Bacteria 1088
209 nmdc:mga06z11_173379_c1 3300050494 Bacteria 1240
210 nmdc:mga06z11_3420_c1 3300050494 Bacteria 6132
211 nmdc:mga05p37_347070_c1 3300050507 Bacteria 1748
212 nmdc:mga05p37_453968_c1 3300050507 Unclassified 1483
213 nmdc:mga05p37_951028_c1 3300050507 Bacteria 919
214 nmdc:mga0qj67_1480744_c1 3300050509 Unclassified 522
215 nmdc:mga06r32_20680_c1 3300050510 Bacteria 6062
216 nmdc:mga06r32_456224_c1 3300050510 Bacteria 1257
217 nmdc:mga08y16_300549_c1 3300050511 Bacteria 1654
218 nmdc:mga0n895_240864_c1 3300050512 Bacteria 1836
219 nmdc:mga0n895_271415_c1 3300050512 Bacteria 1721
220 nmdc:mga0n895_279290_c1 3300050512 Bacteria 1694
221 nmdc:mga0n895_41419_c1 3300050512 Bacteria 4478
222 nmdc:mga0rr50_104271_c1 3300050513 Bacteria 2234
223 nmdc:mga0rr50_146600_c1 3300050513 Bacteria 1904
224 nmdc:mga0rr50_219866_c1 3300050513 Bacteria 1568
225 nmdc:mga0rr50_47702_c1 3300050513 Bacteria 3162
226 nmdc:mga0rr50_69720_c1 3300050513 Bacteria 2677
227 nmdc:mga08x19_217270_c1 3300050514 Bacteria 1313
228 nmdc:mga08x19_218352_c1 3300050514 Bacteria 1310
229 nmdc:mga08x19_33165_c1 3300050514 Bacteria 3258
230 nmdc:mga08x19_43051_c1 3300050514 Bacteria 2880
231 nmdc:mga08x19_89158_c1 3300050514 Bacteria 2034
232 nmdc:mga0a205_304379_c1 3300050515 Bacteria 1466
233 nmdc:mga0a205_42068_c1 3300050515 Bacteria 4402
234 nmdc:mga0a205_881785_c1 3300050515 Unclassified 742
235 nmdc:mga0a205_92439_c1 3300050515 Bacteria 2923
236 nmdc:mga0a205_93789_c1 3300050515 Bacteria 2900
237 Ga0501084_0001381 3300054114 Bacteria 19208
238 Ga0501084_0026768 3300054114 Bacteria 4816
239 Ga0590071_000448 3300059421 Bacteria 11963
240 Ga0590075_003359 3300059424 Bacteria 3811
241 Ga0501082_0048209 3300060353 Bacteria 3671
242 Ga0501082_0052088 3300060353 Bacteria 3528
243 Ga0501082_0481492 3300060353 Bacteria 1085
244 Ga0075367_10091407
245 rootL2_10008767
246 Ga0070683_100138292
247 Ga0070680_100017210
248 Ga0070680_100255431
249 Ga0070680_101702054
250 Ga0070660_100262830
251 Ga0070691_10234663
252 Ga0070671_101658357
253 Ga0070674_100464959
254 Ga0070659_101106054
255 Ga0070703_10000072
256 Ga0070703_10097993
257 Ga0070713_100495637
258 Ga0070705_100011075
259 Ga0070705_100015143
260 Ga0070705_100036834
261 Ga0070705_100096439
262 Ga0070705_100244531
263 Ga0070705_101143512
264 Ga0070694_100002082
265 Ga0070694_100056541
266 Ga0070694_100081410
267 Ga0070694_100742386
268 Ga0070708_100000086
269 Ga0070708_100004686
270 Ga0070708_100051379
271 Ga0070708_100109715
272 Ga0070708_100155812
273 Ga0070708_100159871
274 Ga0070708_100586890
275 Ga0070708_101696905
276 Ga0070681_10888029
277 Ga0070681_11108249
278 Ga0068867_101369686
279 Ga0070706_100004501
280 Ga0070706_100188658
281 Ga0070706_100774141
282 Ga0070706_101280334
283 Ga0070707_100009596
284 Ga0070707_100077551
285 Ga0070707_100298999
286 Ga0070707_100341416
287 Ga0070707_100665350
288 Ga0070707_100840871
289 Ga0070707_101478803
290 Ga0070698_100013098
291 Ga0070699_100068235
292 Ga0070699_100094201
293 Ga0070699_100162521
294 Ga0070699_100268630
295 Ga0070679_100236847
296 Ga0070684_100062927
297 Ga0070697_100025665
298 Ga0070697_100050577
299 Ga0070697_100060733
300 Ga0070697_100077213
301 Ga0070697_101054050
302 Ga0070672_101243146
303 Ga0070686_100667226
304 Ga0070695_100004784
305 Ga0070695_100009017
306 Ga0070695_100013364
307 Ga0070695_100485345
308 Ga0070696_100000364
309 Ga0070696_100029482
310 Ga0070696_100070501
311 Ga0070696_100328689
312 Ga0070696_101372994
313 Ga0070704_100000705
314 Ga0070704_100006296
315 Ga0070704_100024299
316 Ga0070704_100035446
317 Ga0070704_100195237
318 Ga0068855_101137550
319 Ga0070664_100506087
320 Ga0068854_102020551
321 Ga0070702_100545005
322 Ga0068870_10534299
323 Ga0068860_102334795
324 Ga0070716_100137161
325 Ga0070716_100320021
326 Ga0070712_100105652
327 Ga0075367_10088762
328 Ga0075428_100072622
329 Ga0075431_100003686
330 Ga0075431_100099738
331 Ga0075431_100109028
332 Ga0075431_101200323
333 Ga0075433_10038523
334 Ga0075433_10111590
335 Ga0075433_10118248
336 Ga0075433_10128479
337 Ga0075433_10130738
338 Ga0075433_10383888
339 Ga0075433_10545855
340 Ga0075434_100003859
341 Ga0075434_100150197
342 Ga0075434_100163292
343 Ga0075434_100189404
344 Ga0075434_100529761
345 Ga0075434_102198860
346 Ga0075436_100017210
347 Ga0075436_100028903
348 Ga0075436_100035279
349 Ga0075435_100003405
350 Ga0075435_100029232
351 Ga0075435_100736313
352 Ga0075435_101059364
353 Ga0075435_101333895
354 Ga0099794_10000064
355 Ga0099794_10007390
356 Ga0099794_10107203
357 Ga0099794_10277466
358 Ga0105240_10300395
359 Ga0111539_10364189
360 Ga0111539_10423513
361 Ga0114129_10092821
362 Ga0114129_10396064
363 Ga0114129_11121132
364 Ga0105246_10107058
365 Ga0157370_10131612
366 Ga0157369_10274790
367 Ga0157369_10793638
368 Ga0157378_10125173
369 Ga0157372_10537134
370 Ga0157376_10000658
371 Ga0157376_10114601
372 Ga0163161_10153620
373 Ga0207653_10000053
374 Ga0207692_10408199
375 Ga0207642_10117241
376 Ga0207684_10018464
377 Ga0207684_10403479
378 Ga0207684_10636531
379 Ga0207684_11032307
380 Ga0207671_10500104
381 Ga0207693_10074237
382 Ga0207660_10132254
383 Ga0207660_10920068
384 Ga0207660_11285976
385 Ga0207652_10564264
386 Ga0207646_10009095
387 Ga0207646_10041478
388 Ga0207646_10132836
389 Ga0207646_10305744
390 Ga0207687_10058630
391 Ga0207690_10012717
392 Ga0207690_10732431
393 Ga0207706_10630705
394 Ga0207669_10394848
395 Ga0207665_10240581
396 Ga0207665_10817259
397 Ga0207691_10865344
398 Ga0207679_10842335
399 Ga0207639_10226928
400 Ga0207678_10810432
401 Ga0207678_10838940
402 Ga0207702_10407513
403 Ga0207648_11010952
404 Ga0207648_11173168
405 Ga0207675_100506473
406 Ga0209588_1000495
407 Ga0209588_1000498
408 Ga0209974_10015536
409 Ga0268265_10300090
410 Ga0307409_100395303
411 Ga0373942_0144996
412 Ga0451577_0150266
413 Ga0453683_0015544
414 Ga0453683_0242238
415 Ga0453684_0035537
416 Ga0451576_0017661
417 Ga0451576_0137669
418 Ga0495629_0011640
419 Ga0495636_0059311
420 Ga0495677_0173888
421 Ga0496104_0013041
422 Ga0496105_0357280
423 Ga0496105_0629854
424 Ga0496106_0073083
425 Ga0496108_0020311
426 Ga0496109_0090279
427 Ga0496111_0008134
428 Ga0496112_0006373
429 Ga0496113_0499181
430 Ga0496114_0919571
431 Ga0501033_0728175
432 Ga0501037_0298610
433 Ga0501038_0723672
434 Ga0501039_0514564
435 Ga0501040_0382775
436 Ga0501042_0010711
437 Ga0501067_0001802
438 Ga0501068_0000075
439 Ga0501068_0617125
440 Ga0501069_0051125
441 Ga0501070_0011931
442 Ga0501071_0000468
443 Ga0501072_0030094
444 Ga0501073_0022832
445 Ga0501074_0000981
446 Ga0501075_0847996
447 Ga0501077_0000496
448 Ga0501079_0020314
449 Ga0501080_0052966
450 Ga0501081_0342337
451 Ga0501083_0278360
452 nmdc:mga06z11_173379_c1
453 nmdc:mga06z11_3420_c1
454 nmdc:mga05p37_347070_c1
455 nmdc:mga05p37_453968_c1
456 nmdc:mga05p37_951028_c1
457 nmdc:mga0qj67_1480744_c1
458 nmdc:mga06r32_20680_c1
459 nmdc:mga06r32_456224_c1
460 nmdc:mga08y16_300549_c1
461 nmdc:mga0n895_240864_c1
462 nmdc:mga0n895_271415_c1
463 nmdc:mga0n895_279290_c1
464 nmdc:mga0n895_41419_c1
465 nmdc:mga0rr50_104271_c1
466 nmdc:mga0rr50_146600_c1
467 nmdc:mga0rr50_219866_c1
468 nmdc:mga0rr50_47702_c1
469 nmdc:mga0rr50_69720_c1
470 nmdc:mga08x19_217270_c1
471 nmdc:mga08x19_218352_c1
472 nmdc:mga08x19_33165_c1
473 nmdc:mga08x19_43051_c1
474 nmdc:mga08x19_89158_c1
475 nmdc:mga0a205_304379_c1
476 nmdc:mga0a205_42068_c1
477 nmdc:mga0a205_881785_c1
478 nmdc:mga0a205_92439_c1
479 nmdc:mga0a205_93789_c1
480 Ga0501084_0001381
481 Ga0501084_0026768
482 Ga0590071_000448
483 Ga0590075_003359
484 Ga0501082_0048209
485 Ga0501082_0052088
486 Ga0501082_0481492

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00334

NDK

Nucleoside diphosphate kinase

22

156

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nck-assembly1.cif.gz_R crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution 0.9938 5 137
6ay1-assembly5.cif.gz_E crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori 0.991 5 137
5v6d-assembly3.cif.gz_F crystal structure of nucleoside diphosphate kinase from neisseria gonorrhoeae in complex with citrate 0.9897 5 137
6aes-assembly2.cif.gz_B crystal structure of nucleoside diphosphate kinase from pseudomonas aeruginosa at 3.55 a resolution. 0.9895 5 138
4ek2-assembly1.cif.gz_A the structure of nucleoside diphosphate kinase (ndk) from burkholderia thailandensis bound to deoxyadenosine monophosphate 0.9886 5 137
ID Description Score Start End Superfamily
af_Q6Z7E5_29_180_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9799 5 135 3.30.70.141
4w98A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9795 5 137 3.30.70.141
6ay1G00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9785 5 137 3.30.70.141
3vgvN00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9741 5 137 3.30.70.141
af_A0A1D6EH51_54_191_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9707 20 137 3.30.70.141
ID Description Score Start End GO Terms
AF-A0A3D9B2G5-F1-model_v4 Nucleoside diphosphate kinase (EC 2.7.4.6) 1.001 4 126 GO:0004550
GO:0005524
GO:0006183
GO:0006228
GO:0006241
AF-A0A6B1FGR7-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 0.9994 5 137 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A0S7XSS3-F1-model_v4 Nucleoside diphosphate kinase (EC 2.7.4.6) 0.9986 5 134 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A538R0L5-F1-model_v4 Nucleoside-diphosphate kinase (EC 2.7.4.6) 0.998 5 126 GO:0004550
GO:0005524
GO:0006183
GO:0006228
GO:0006241
AF-A0A2E0LEK8-F1-model_v4 deleted 0.9978 5 133

Map