F355438

General Info

Members Datasets Scaffolds Average Seq Length
243 156 243 164

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100915843|Ga0068863_1009158431
Length 185
Sequence MTKHSMPEMKEGGVNVTPLIDVVMCLIIFFMLVAKIGVSSGIDTGIRAPETYLGVKINDMGNVLALNLYKTGAAAPQIVVDLKGQPKQELKIQDGGKYPLREVLKEMKKERGEQFKVVINGGKVVKPRLDPAGNPVVGADGVPLTDTTELDYEQVSLVLQECAMAGVSNINFATKRGTKVVDDSE

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
128 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
136 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.77
Stem 0
Stem Tuber 0
Unclassified 1.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10007514 3300005327 Bacteria 8795
2 Ga0070658_10318708 3300005327 Bacteria 1327
3 Ga0070658_10702193 3300005327 Bacteria 878
4 Ga0070676_10065030 3300005328 Bacteria 2176
5 Ga0070683_100270919 3300005329 Bacteria 1615
6 Ga0070683_100290524 3300005329 Bacteria 1555
7 Ga0070683_100446094 3300005329 Bacteria 1235
8 Ga0070670_100153602 3300005331 Bacteria 1993
9 Ga0070670_100254913 3300005331 Bacteria 1529
10 Ga0070670_100330746 3300005331 Unclassified 1336
11 Ga0070677_10227214 3300005333 Bacteria 915
12 Ga0070680_101022547 3300005336 Bacteria 714
13 Ga0070687_100241099 3300005343 Bacteria 1118
14 Ga0070661_100276674 3300005344 Bacteria 1301
15 Ga0070669_100697814 3300005353 Bacteria 857
16 Ga0070675_100048089 3300005354 Bacteria 3496
17 Ga0070675_100849155 3300005354 Bacteria 836
18 Ga0070671_100141206 3300005355 Bacteria 2032
19 Ga0070671_100211959 3300005355 Bacteria 1643
20 Ga0070674_100014318 3300005356 Bacteria 4930
21 Ga0070674_100927820 3300005356 Bacteria 760
22 Ga0070673_100556059 3300005364 Bacteria 1043
23 Ga0070714_100006953 3300005435 Bacteria 8772
24 Ga0070714_100499408 3300005435 Bacteria 1160
25 Ga0070713_101910169 3300005436 Bacteria 576
26 Ga0070678_100055447 3300005456 Bacteria 2893
27 Ga0070678_101495547 3300005456 Bacteria 632
28 Ga0070681_10576679 3300005458 Bacteria 1039
29 Ga0068867_100372741 3300005459 Unclassified 1197
30 Ga0070685_10146782 3300005466 Bacteria 1491
31 Ga0070684_100415182 3300005535 Bacteria 1242
32 Ga0070684_101002408 3300005535 Unclassified 784
33 Ga0068853_100370487 3300005539 Bacteria 1336
34 Ga0070672_100145305 3300005543 Bacteria 1959
35 Ga0070665_100034405 3300005548 Bacteria 5096
36 Ga0070665_100389151 3300005548 Bacteria 1402
37 Ga0068855_100034610 3300005563 Bacteria 6021
38 Ga0068855_100178006 3300005563 Bacteria 2405
39 Ga0068855_100465099 3300005563 Unclassified 1379
40 Ga0068855_100623867 3300005563 Bacteria 1161
41 Ga0070664_100073824 3300005564 Bacteria 2927
42 Ga0068857_100011039 3300005577 Bacteria 7862
43 Ga0068857_100793328 3300005577 Unclassified 904
44 Ga0068854_100637025 3300005578 Bacteria 914
45 Ga0068856_100423991 3300005614 Unclassified 1350
46 Ga0070702_100454255 3300005615 Unclassified 930
47 Ga0068859_100257710 3300005617 Unclassified 1835
48 Ga0068864_100205817 3300005618 Bacteria 1810
49 Ga0068864_101220830 3300005618 Bacteria 751
50 Ga0068863_100735265 3300005841 Bacteria 982
51 Ga0068863_100915843 3300005841 Bacteria 877
52 Ga0068858_100156422 3300005842 Bacteria 2145
53 Ga0068860_100497269 3300005843 Bacteria 1217
54 Ga0068860_101065942 3300005843 Bacteria 827
55 Ga0068860_101374661 3300005843 Bacteria 727
56 Ga0081539_10006791 3300005985 Bacteria 10736
57 Ga0097621_101388337 3300006237 Bacteria 665
58 Ga0068871_101855077 3300006358 Bacteria 573
59 Ga0075428_101312046 3300006844 Unclassified 761
60 Ga0075430_100059857 3300006846 Bacteria 3201
61 Ga0075431_100288807 3300006847 Bacteria 1660
62 Ga0075429_100239109 3300006880 Bacteria 1591
63 Ga0097620_100257703 3300006931 Unclassified 1835
64 Ga0105240_10015689 3300009093 Bacteria 10284
65 Ga0105240_10507191 3300009093 Bacteria 1340
66 Ga0105240_10632187 3300009093 Bacteria 1175
67 Ga0111539_11397902 3300009094 Bacteria 812
68 Ga0111539_12195591 3300009094 Unclassified 640
69 Ga0111539_12355163 3300009094 Unclassified 618
70 Ga0105245_10057158 3300009098 Unclassified 3508
71 Ga0105245_10744514 3300009098 Bacteria 1016
72 Ga0105245_11386194 3300009098 Bacteria 753
73 Ga0105245_11461986 3300009098 Bacteria 734
74 Ga0114129_11926764 3300009147 Bacteria 716
75 Ga0105241_10544765 3300009174 Unclassified 1041
76 Ga0105248_11077610 3300009177 Unclassified 908
77 Ga0105248_12026700 3300009177 Bacteria 654
78 Ga0105237_11331776 3300009545 Unclassified 724
79 Ga0105238_10499669 3300009551 Bacteria 1217
80 Ga0105239_10010974 3300010375 Bacteria 10115
81 Ga0105239_10578739 3300010375 Bacteria 1280
82 Ga0105239_10992347 3300010375 Unclassified 965
83 Ga0157373_10129596 3300013100 Bacteria 1774
84 Ga0157373_10339567 3300013100 Bacteria 1070
85 Ga0157371_10499086 3300013102 Bacteria 899
86 Ga0157370_10171003 3300013104 Unclassified 2020
87 Ga0157370_10270950 3300013104 Bacteria 1568
88 Ga0157370_10413616 3300013104 Bacteria 1241
89 Ga0157370_11165741 3300013104 Unclassified 696
90 Ga0157369_10075271 3300013105 Unclassified 3620
91 Ga0157369_10122165 3300013105 Bacteria 2762
92 Ga0157369_10203897 3300013105 Bacteria 2075
93 Ga0157369_10788941 3300013105 Unclassified 976
94 Ga0157369_10811980 3300013105 Bacteria 961
95 Ga0157369_11263995 3300013105 Bacteria 753
96 Ga0157369_11985741 3300013105 Unclassified 590
97 Ga0157374_10599063 3300013296 Bacteria 1112
98 Ga0157374_11429566 3300013296 Unclassified 714
99 Ga0163162_10045266 3300013306 Bacteria 4409
100 Ga0163162_10320205 3300013306 Bacteria 1683
101 Ga0163162_10682298 3300013306 Bacteria 1150
102 Ga0163162_12301264 3300013306 Bacteria 619
103 Ga0157372_10041464 3300013307 Bacteria 5090
104 Ga0157372_10115714 3300013307 Bacteria 3074
105 Ga0157372_10328188 3300013307 Unclassified 1782
106 Ga0157372_10419643 3300013307 Bacteria 1559
107 Ga0157372_10520099 3300013307 Bacteria 1387
108 Ga0157372_10582786 3300013307 Bacteria 1304
109 Ga0157372_10871501 3300013307 Bacteria 1045
110 Ga0157372_10973267 3300013307 Unclassified 983
111 Ga0157375_10608693 3300013308 Bacteria 1251
112 Ga0157375_11339521 3300013308 Bacteria 842
113 Ga0163163_11474523 3300014325 Bacteria 742
114 Ga0163163_12484409 3300014325 Unclassified 576
115 Ga0157377_10871431 3300014745 Unclassified 670
116 Ga0206352_10061443 3300020078 Unclassified 2169
117 Ga0213874_10291089 3300021377 Bacteria 612
118 Ga0207688_10339323 3300025901 Bacteria 924
119 Ga0207645_10031867 3300025907 Bacteria 3389
120 Ga0207705_10020568 3300025909 Bacteria 4713
121 Ga0207684_10059249 3300025910 Bacteria 3251
122 Ga0207654_10045173 3300025911 Bacteria 2506
123 Ga0207707_10215699 3300025912 Bacteria 1671
124 Ga0207695_10001194 3300025913 Bacteria 44655
125 Ga0207671_11308128 3300025914 Unclassified 564
126 Ga0207660_11496263 3300025917 Unclassified 546
127 Ga0207662_10628244 3300025918 Bacteria 749
128 Ga0207649_10432080 3300025920 Bacteria 991
129 Ga0207649_10975472 3300025920 Unclassified 666
130 Ga0207650_10180599 3300025925 Bacteria 1681
131 Ga0207650_10242622 3300025925 Bacteria 1456
132 Ga0207650_10810870 3300025925 Bacteria 793
133 Ga0207659_10101346 3300025926 Bacteria 2171
134 Ga0207659_10130088 3300025926 Bacteria 1942
135 Ga0207687_10103482 3300025927 Bacteria 2100
136 Ga0207687_10658348 3300025927 Bacteria 886
137 Ga0207664_10171914 3300025929 Bacteria 1855
138 Ga0207644_10142810 3300025931 Unclassified 1845
139 Ga0207690_10343050 3300025932 Bacteria 1179
140 Ga0207690_11145989 3300025932 Bacteria 649
141 Ga0207686_10794932 3300025934 Unclassified 758
142 Ga0207704_10516024 3300025938 Bacteria 966
143 Ga0207691_10105136 3300025940 Bacteria 2515
144 Ga0207691_10567885 3300025940 Bacteria 961
145 Ga0207661_10359642 3300025944 Bacteria 1315
146 Ga0207661_10461442 3300025944 Bacteria 1158
147 Ga0207661_10687711 3300025944 Bacteria 941
148 Ga0207679_10144887 3300025945 Bacteria 1925
149 Ga0207679_11425942 3300025945 Unclassified 635
150 Ga0207667_10274708 3300025949 Unclassified 1723
151 Ga0207667_10292039 3300025949 Bacteria 1665
152 Ga0207667_10297732 3300025949 Bacteria 1648
153 Ga0207651_10239569 3300025960 Bacteria 1478
154 Ga0207651_10917470 3300025960 Unclassified 780
155 Ga0207640_10413738 3300025981 Bacteria 1101
156 Ga0207658_10097797 3300025986 Bacteria 2292
157 Ga0207677_10782441 3300026023 Bacteria 853
158 Ga0207703_10438848 3300026035 Unclassified 1218
159 Ga0207708_10553144 3300026075 Bacteria 971
160 Ga0207641_10198125 3300026088 Bacteria 1850
161 Ga0207641_12036609 3300026088 Unclassified 575
162 Ga0207648_10034762 3300026089 Bacteria 4442
163 Ga0207648_10487512 3300026089 Unclassified 1126
164 Ga0207676_10618724 3300026095 Unclassified 1042
165 Ga0207676_11693812 3300026095 Unclassified 631
166 Ga0207674_10010736 3300026116 Bacteria 10338
167 Ga0207674_10390586 3300026116 Bacteria 1345
168 Ga0207675_100144745 3300026118 Bacteria 2259
169 Ga0207683_10050167 3300026121 Bacteria 3654
170 Ga0268266_10364998 3300028379 Bacteria 1359
171 Ga0268265_10548459 3300028380 Bacteria 1097
172 Ga0268264_10373587 3300028381 Bacteria 1363
173 Ga0307408_100879510 3300031548 Bacteria 819
174 Ga0265313_10018441 3300031595 Bacteria 3917
175 Ga0307405_10518586 3300031731 Bacteria 959
176 Ga0307413_10112446 3300031824 Bacteria 1826
177 Ga0307413_10704289 3300031824 Bacteria 839
178 Ga0307410_10177246 3300031852 Bacteria 1611
179 Ga0307410_10604994 3300031852 Bacteria 915
180 Ga0307406_10707794 3300031901 Bacteria 842
181 Ga0307412_10682508 3300031911 Unclassified 880
182 Ga0307409_100279517 3300031995 Bacteria 1542
183 Ga0307409_100345820 3300031995 Bacteria 1401
184 Ga0307409_100919208 3300031995 Bacteria 889
185 Ga0307409_100954139 3300031995 Bacteria 874
186 Ga0307416_100534616 3300032002 Bacteria 1243
187 Ga0307416_101256363 3300032002 Bacteria 846
188 Ga0307416_101301477 3300032002 Bacteria 833
189 Ga0307414_10331668 3300032004 Bacteria 1299
190 Ga0307411_10054239 3300032005 Bacteria 2631
191 Ga0307411_10156953 3300032005 Bacteria 1698
192 Ga0307415_100627415 3300032126 Bacteria 960
193 Ga0373933_0267546 3300035724 Unclassified 1103
194 Ga0373937_0022367 3300036401 Bacteria 5685
195 Ga0373937_0063214 3300036401 Bacteria 3404
196 Ga0395899_0734570 3300037312 Bacteria 616
197 Ga0395898_0604165 3300037466 Bacteria 1040
198 Ga0395905_0254038 3300037471 Bacteria 1642
199 Ga0395901_0024034 3300038443 Bacteria 6251
200 Ga0395901_0197983 3300038443 Bacteria 2106
201 Ga0436365_1585628 3300039437 Bacteria 1615
202 Ga0436363_1409552 3300039450 Bacteria 964
203 Ga0451577_0159501 3300042876 Bacteria 2031
204 Ga0453684_1430593 3300044712 Bacteria 716
205 Ga0451576_0000224 3300045051 Bacteria 138894
206 Ga0451576_1119504 3300045051 Bacteria 824
207 Ga0495592_0347326 3300046454 Unclassified 952
208 Ga0495580_0022812 3300046472 Bacteria 4602
209 Ga0495662_0053069 3300046476 Bacteria 1958
210 Ga0495594_0318715 3300046499 Unclassified 886
211 Ga0495608_0410341 3300046511 Bacteria 827
212 Ga0495628_0056175 3300046516 Bacteria 3100
213 Ga0495630_0001586 3300046517 Bacteria 15817
214 Ga0495652_0497479 3300046529 Bacteria 846
215 Ga0495586_0043975 3300046535 Bacteria 2405
216 Ga0495587_0306108 3300046536 Bacteria 888
217 Ga0495598_0126094 3300046537 Bacteria 873
218 Ga0495622_0309693 3300046557 Bacteria 687
219 Ga0495667_0208557 3300046559 Bacteria 1249
220 Ga0495634_0065795 3300046642 Bacteria 2401
221 Ga0495635_0136390 3300046663 Bacteria 1672
222 Ga0495635_0320252 3300046663 Bacteria 1038
223 Ga0495613_0017351 3300046689 Bacteria 5364
224 Ga0495624_0004658 3300046690 Bacteria 9983
225 Ga0495581_0324618 3300047315 Bacteria 899
226 Ga0495604_0144631 3300047317 Bacteria 1696
227 Ga0495674_0000959 3300047319 Bacteria 27597
228 Ga0495684_0014493 3300047471 Bacteria 6067
229 Ga0495684_0023709 3300047471 Bacteria 4719
230 Ga0501032_0101433 3300049569 Bacteria 1907
231 Ga0501034_0000691 3300049571 Bacteria 51242
232 Ga0501034_0092072 3300049571 Bacteria 3029
233 Ga0501040_0155467 3300049576 Bacteria 1615
234 Ga0501046_0516549 3300049580 Bacteria 854
235 Ga0501047_0033073 3300049581 Bacteria 4993
236 Ga0501070_0907173 3300049586 Bacteria 687
237 Ga0501221_044776 3300049704 Bacteria 978
238 Ga0501080_0106540 3300049742 Bacteria 2598
239 Ga0501080_0388003 3300049742 Bacteria 1257
240 Ga0501044_0001552 3300049823 Bacteria 26910
241 Ga0501044_0006456 3300049823 Bacteria 12954
242 nmdc:mga0qj67_168254_c1 3300050509 Bacteria 1780
243 nmdc:mga06r32_112109_c1 3300050510 Bacteria 2684

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025934 Ga0207686_10794932 Ga0207686_107949321 126
2 3300039437 Ga0436365_1585628 Ga0436365_1585628_1199_1600 127
3 3300025981 Ga0207640_10413738 Ga0207640_104137382 137
4 3300026089 Ga0207648_10034762 Ga0207648_100347622 137
5 3300013100 Ga0157373_10339567 Ga0157373_103395671 138
6 3300009098 Ga0105245_10744514 Ga0105245_107445141 140
7 3300045051 Ga0451576_1119504 Ga0451576_1119504_239_688 143
8 3300005459 Ga0068867_100372741 Ga0068867_1003727412 144
9 3300005615 Ga0070702_100454255 Ga0070702_1004542552 144
10 3300009094 Ga0111539_11397902 Ga0111539_113979022 144
11 3300026089 Ga0207648_10487512 Ga0207648_104875122 144
12 3300044712 Ga0453684_1430593 Ga0453684_1430593_41_493 144
13 3300009177 Ga0105248_11077610 Ga0105248_110776101 145
14 3300021377 Ga0213874_10291089 Ga0213874_102910891 145
15 3300046535 Ga0495586_0043975 Ga0495586_0043975_1378_1890 145
16 3300049569 Ga0501032_0101433 Ga0501032_0101433_1043_1555 145
17 3300049571 Ga0501034_0092072 Ga0501034_0092072_1104_1616 145
18 3300049576 Ga0501040_0155467 Ga0501040_0155467_702_1214 145
19 3300049580 Ga0501046_0516549 Ga0501046_0516549_278_790 145
20 3300049581 Ga0501047_0033073 Ga0501047_0033073_1600_2112 145
21 3300049586 Ga0501070_0907173 Ga0501070_0907173_164_676 145
22 3300049742 Ga0501080_0388003 Ga0501080_0388003_86_598 145
23 3300049823 Ga0501044_0001552 Ga0501044_0001552_22508_23020 145
24 3300005436 Ga0070713_101910169 Ga0070713_1019101691 146
25 3300046536 Ga0495587_0306108 Ga0495587_0306108_419_877 146
26 3300049571 Ga0501034_0000691 Ga0501034_0000691_19740_20255 146
27 3300049742 Ga0501080_0106540 Ga0501080_0106540_945_1460 146
28 3300049823 Ga0501044_0006456 Ga0501044_0006456_12037_12552 146
29 3300005843 Ga0068860_100497269 Ga0068860_1004972692 147
30 3300009093 Ga0105240_10015689 Ga0105240_100156894 147
31 3300009093 Ga0105240_10507191 Ga0105240_105071912 147
32 3300013104 Ga0157370_10171003 Ga0157370_101710032 147
33 3300013104 Ga0157370_10270950 Ga0157370_102709501 147
34 3300013105 Ga0157369_10075271 Ga0157369_100752712 147
35 3300013307 Ga0157372_10328188 Ga0157372_103281882 147
36 3300031595 Ga0265313_10018441 Ga0265313_100184413 147
37 3300031911 Ga0307412_10682508 Ga0307412_106825082 147
38 3300042876 Ga0451577_0159501 Ga0451577_0159501_658_1119 147
39 3300005331 Ga0070670_100330746 Ga0070670_1003307462 148
40 3300005354 Ga0070675_100849155 Ga0070675_1008491551 148
41 3300005617 Ga0068859_100257710 Ga0068859_1002577103 148
42 3300006237 Ga0097621_101388337 Ga0097621_1013883371 148
43 3300006931 Ga0097620_100257703 Ga0097620_1002577032 148
44 3300009098 Ga0105245_11461986 Ga0105245_114619861 148
45 3300014325 Ga0163163_12484409 Ga0163163_124844091 148
46 3300025926 Ga0207659_10130088 Ga0207659_101300883 148
47 3300025927 Ga0207687_10658348 Ga0207687_106583482 148
48 3300025945 Ga0207679_11425942 Ga0207679_114259421 148
49 3300031824 Ga0307413_10704289 Ga0307413_107042892 148
50 3300031901 Ga0307406_10707794 Ga0307406_107077941 148
51 3300031995 Ga0307409_100345820 Ga0307409_1003458203 148
52 3300032002 Ga0307416_101256363 Ga0307416_1012563631 148
53 3300032002 Ga0307416_101301477 Ga0307416_1013014772 148
54 3300032005 Ga0307411_10156953 Ga0307411_101569533 148
55 3300005435 Ga0070714_100006953 Ga0070714_1000069532 149
56 3300005842 Ga0068858_100156422 Ga0068858_1001564222 149
57 3300005843 Ga0068860_101065942 Ga0068860_1010659422 149
58 3300005985 Ga0081539_10006791 Ga0081539_100067916 149
59 3300009545 Ga0105237_11331776 Ga0105237_113317761 149
60 3300010375 Ga0105239_10010974 Ga0105239_100109745 149
61 3300010375 Ga0105239_10992347 Ga0105239_109923471 149
62 3300013102 Ga0157371_10499086 Ga0157371_104990862 149
63 3300013104 Ga0157370_10413616 Ga0157370_104136162 149
64 3300013105 Ga0157369_10122165 Ga0157369_101221652 149
65 3300013105 Ga0157369_10203897 Ga0157369_102038972 149
66 3300013105 Ga0157369_10811980 Ga0157369_108119802 149
67 3300013307 Ga0157372_10041464 Ga0157372_100414643 149
68 3300013307 Ga0157372_10115714 Ga0157372_101157142 149
69 3300013307 Ga0157372_10582786 Ga0157372_105827862 149
70 3300013307 Ga0157372_10871501 Ga0157372_108715011 149
71 3300013307 Ga0157372_10973267 Ga0157372_109732671 149
72 3300014325 Ga0163163_11474523 Ga0163163_114745232 149
73 3300025932 Ga0207690_11145989 Ga0207690_111459891 149
74 3300025944 Ga0207661_10687711 Ga0207661_106877112 149
75 3300026035 Ga0207703_10438848 Ga0207703_104388482 149
76 3300026095 Ga0207676_11693812 Ga0207676_116938121 149
77 3300035724 Ga0373933_0267546 Ga0373933_0267546_258_785 149
78 3300036401 Ga0373937_0022367 Ga0373937_0022367_2526_3053 149
79 3300037312 Ga0395899_0734570 Ga0395899_0734570_72_599 149
80 3300037466 Ga0395898_0604165 Ga0395898_0604165_549_1025 149
81 3300037471 Ga0395905_0254038 Ga0395905_0254038_186_662 149
82 3300038443 Ga0395901_0197983 Ga0395901_0197983_534_1010 149
83 3300039450 Ga0436363_1409552 Ga0436363_1409552_374_844 149
84 3300046454 Ga0495592_0347326 Ga0495592_0347326_208_735 149
85 3300046499 Ga0495594_0318715 Ga0495594_0318715_291_836 149
86 3300050510 nmdc:mga06r32_112109_c1 nmdc:mga06r32_112109_c1_1659_2141 149
87 3300005578 Ga0068854_100637025 Ga0068854_1006370252 150
88 3300005618 Ga0068864_100205817 Ga0068864_1002058172 150
89 3300006846 Ga0075430_100059857 Ga0075430_1000598573 150
90 3300006847 Ga0075431_100288807 Ga0075431_1002888072 150
91 3300006880 Ga0075429_100239109 Ga0075429_1002391093 150
92 3300009094 Ga0111539_12195591 Ga0111539_121955911 150
93 3300009551 Ga0105238_10499669 Ga0105238_104996692 150
94 3300013100 Ga0157373_10129596 Ga0157373_101295962 150
95 3300013104 Ga0157370_11165741 Ga0157370_111657411 150
96 3300013105 Ga0157369_11985741 Ga0157369_119857411 150
97 3300013306 Ga0163162_10320205 Ga0163162_103202053 150
98 3300013307 Ga0157372_10419643 Ga0157372_104196432 150
99 3300025910 Ga0207684_10059249 Ga0207684_100592493 150
100 3300026088 Ga0207641_12036609 Ga0207641_120366091 150
101 3300026095 Ga0207676_10618724 Ga0207676_106187242 150
102 3300031852 Ga0307410_10604994 Ga0307410_106049942 150
103 3300031995 Ga0307409_100954139 Ga0307409_1009541392 150
104 3300036401 Ga0373937_0063214 Ga0373937_0063214_666_1139 150
105 3300046511 Ga0495608_0410341 Ga0495608_0410341_326_799 150
106 3300046559 Ga0495667_0208557 Ga0495667_0208557_21_494 150
107 3300046642 Ga0495634_0065795 Ga0495634_0065795_1026_1499 150
108 3300046663 Ga0495635_0136390 Ga0495635_0136390_159_632 150
109 3300046689 Ga0495613_0017351 Ga0495613_0017351_3965_4438 150
110 3300047471 Ga0495684_0023709 Ga0495684_0023709_2018_2491 150
111 3300050509 nmdc:mga0qj67_168254_c1 nmdc:mga0qj67_168254_c1_391_873 150
112 3300005329 Ga0070683_100270919 Ga0070683_1002709192 151
113 3300005336 Ga0070680_101022547 Ga0070680_1010225472 151
114 3300005435 Ga0070714_100499408 Ga0070714_1004994081 151
115 3300005563 Ga0068855_100465099 Ga0068855_1004650991 151
116 3300005563 Ga0068855_100623867 Ga0068855_1006238672 151
117 3300005614 Ga0068856_100423991 Ga0068856_1004239913 151
118 3300005841 Ga0068863_100915843 Ga0068863_1009158431 151
119 3300009147 Ga0114129_11926764 Ga0114129_119267641 151
120 3300009177 Ga0105248_12026700 Ga0105248_120267001 151
121 3300013308 Ga0157375_11339521 Ga0157375_113395211 151
122 3300020078 Ga0206352_10061443 Ga0206352_100614432 151
123 3300025913 Ga0207695_10001194 Ga0207695_1000119432 151
124 3300025917 Ga0207660_11496263 Ga0207660_114962631 151
125 3300025949 Ga0207667_10274708 Ga0207667_102747082 151
126 3300025986 Ga0207658_10097797 Ga0207658_100977974 151
127 3300026088 Ga0207641_10198125 Ga0207641_101981251 151
128 3300028381 Ga0268264_10373587 Ga0268264_103735872 151
129 3300031995 Ga0307409_100919208 Ga0307409_1009192082 151
130 3300046537 Ga0495598_0126094 Ga0495598_0126094_392_862 151
131 3300005331 Ga0070670_100254913 Ga0070670_1002549132 152
132 3300005343 Ga0070687_100241099 Ga0070687_1002410991 152
133 3300005466 Ga0070685_10146782 Ga0070685_101467821 152
134 3300005548 Ga0070665_100034405 Ga0070665_1000344054 152
135 3300005841 Ga0068863_100735265 Ga0068863_1007352651 152
136 3300025925 Ga0207650_10242622 Ga0207650_102426222 152
137 3300025926 Ga0207659_10101346 Ga0207659_101013463 152
138 3300025929 Ga0207664_10171914 Ga0207664_101719143 152
139 3300025960 Ga0207651_10239569 Ga0207651_102395692 152
140 3300028379 Ga0268266_10364998 Ga0268266_103649982 152
141 3300031548 Ga0307408_100879510 Ga0307408_1008795102 152
142 3300031824 Ga0307413_10112446 Ga0307413_101124463 152
143 3300031852 Ga0307410_10177246 Ga0307410_101772462 152
144 3300031995 Ga0307409_100279517 Ga0307409_1002795171 152
145 3300032002 Ga0307416_100534616 Ga0307416_1005346162 152
146 3300032004 Ga0307414_10331668 Ga0307414_103316682 152
147 3300032005 Ga0307411_10054239 Ga0307411_100542392 152
148 3300032126 Ga0307415_100627415 Ga0307415_1006274152 152
149 3300049704 Ga0501221_044776 Ga0501221_044776_15_521 152
150 3300005327 Ga0070658_10702193 Ga0070658_107021932 153
151 3300005329 Ga0070683_100290524 Ga0070683_1002905242 153
152 3300005329 Ga0070683_100446094 Ga0070683_1004460942 153
153 3300005456 Ga0070678_101495547 Ga0070678_1014955471 153
154 3300005458 Ga0070681_10576679 Ga0070681_105766792 153
155 3300005535 Ga0070684_100415182 Ga0070684_1004151822 153
156 3300005535 Ga0070684_101002408 Ga0070684_1010024082 153
157 3300005548 Ga0070665_100389151 Ga0070665_1003891512 153
158 3300005563 Ga0068855_100034610 Ga0068855_1000346105 153
159 3300005563 Ga0068855_100178006 Ga0068855_1001780061 153
160 3300005577 Ga0068857_100011039 Ga0068857_1000110394 153
161 3300005618 Ga0068864_101220830 Ga0068864_1012208302 153
162 3300009093 Ga0105240_10632187 Ga0105240_106321872 153
163 3300009098 Ga0105245_10057158 Ga0105245_100571584 153
164 3300009098 Ga0105245_11386194 Ga0105245_113861942 153
165 3300009174 Ga0105241_10544765 Ga0105241_105447652 153
166 3300010375 Ga0105239_10578739 Ga0105239_105787392 153
167 3300013105 Ga0157369_10788941 Ga0157369_107889412 153
168 3300013296 Ga0157374_10599063 Ga0157374_105990632 153
169 3300013306 Ga0163162_10045266 Ga0163162_100452663 153
170 3300013306 Ga0163162_10682298 Ga0163162_106822982 153
171 3300013308 Ga0157375_10608693 Ga0157375_106086932 153
172 3300025911 Ga0207654_10045173 Ga0207654_100451733 153
173 3300025912 Ga0207707_10215699 Ga0207707_102156992 153
174 3300025914 Ga0207671_11308128 Ga0207671_113081281 153
175 3300025925 Ga0207650_10810870 Ga0207650_108108701 153
176 3300025927 Ga0207687_10103482 Ga0207687_101034821 153
177 3300025944 Ga0207661_10461442 Ga0207661_104614422 153
178 3300025949 Ga0207667_10292039 Ga0207667_102920392 153
179 3300025949 Ga0207667_10297732 Ga0207667_102977322 153
180 3300026116 Ga0207674_10010736 Ga0207674_100107364 153
181 3300031731 Ga0307405_10518586 Ga0307405_105185861 153
182 3300038443 Ga0395901_0024034 Ga0395901_0024034_4795_5349 153
183 3300045051 Ga0451576_0000224 Ga0451576_0000224_65183_65713 153
184 3300046472 Ga0495580_0022812 Ga0495580_0022812_2409_2903 153
185 3300046476 Ga0495662_0053069 Ga0495662_0053069_1116_1610 153
186 3300046516 Ga0495628_0056175 Ga0495628_0056175_2164_2658 153
187 3300046517 Ga0495630_0001586 Ga0495630_0001586_2787_3281 153
188 3300046529 Ga0495652_0497479 Ga0495652_0497479_322_816 153
189 3300046557 Ga0495622_0309693 Ga0495622_0309693_65_556 153
190 3300046663 Ga0495635_0320252 Ga0495635_0320252_476_970 153
191 3300046690 Ga0495624_0004658 Ga0495624_0004658_72_566 153
192 3300047315 Ga0495581_0324618 Ga0495581_0324618_278_769 153
193 3300047317 Ga0495604_0144631 Ga0495604_0144631_206_700 153
194 3300047319 Ga0495674_0000959 Ga0495674_0000959_23425_23919 153
195 3300047471 Ga0495684_0014493 Ga0495684_0014493_4475_4969 153
196 3300005327 Ga0070658_10318708 Ga0070658_103187082 154
197 3300005333 Ga0070677_10227214 Ga0070677_102272142 154
198 3300005344 Ga0070661_100276674 Ga0070661_1002766742 154
199 3300005356 Ga0070674_100927820 Ga0070674_1009278201 154
200 3300005539 Ga0068853_100370487 Ga0068853_1003704872 154
201 3300006358 Ga0068871_101855077 Ga0068871_1018550771 154
202 3300013105 Ga0157369_11263995 Ga0157369_112639952 154
203 3300013306 Ga0163162_12301264 Ga0163162_123012641 154
204 3300025901 Ga0207688_10339323 Ga0207688_103393232 154
205 3300025920 Ga0207649_10432080 Ga0207649_104320801 154
206 3300025932 Ga0207690_10343050 Ga0207690_103430502 154
207 3300025940 Ga0207691_10567885 Ga0207691_105678852 154
208 3300025944 Ga0207661_10359642 Ga0207661_103596422 154
209 3300005328 Ga0070676_10065030 Ga0070676_100650303 155
210 3300005354 Ga0070675_100048089 Ga0070675_1000480893 155
211 3300005355 Ga0070671_100211959 Ga0070671_1002119593 155
212 3300005356 Ga0070674_100014318 Ga0070674_1000143186 155
213 3300005364 Ga0070673_100556059 Ga0070673_1005560592 155
214 3300005456 Ga0070678_100055447 Ga0070678_1000554471 155
215 3300005543 Ga0070672_100145305 Ga0070672_1001453053 155
216 3300005843 Ga0068860_101374661 Ga0068860_1013746612 155
217 3300006844 Ga0075428_101312046 Ga0075428_1013120461 155
218 3300025907 Ga0207645_10031867 Ga0207645_100318672 155
219 3300025918 Ga0207662_10628244 Ga0207662_106282441 155
220 3300025920 Ga0207649_10975472 Ga0207649_109754721 155
221 3300025938 Ga0207704_10516024 Ga0207704_105160242 155
222 3300025940 Ga0207691_10105136 Ga0207691_101051363 155
223 3300026121 Ga0207683_10050167 Ga0207683_100501672 155
224 3300005331 Ga0070670_100153602 Ga0070670_1001536023 156
225 3300005353 Ga0070669_100697814 Ga0070669_1006978141 156
226 3300005564 Ga0070664_100073824 Ga0070664_1000738242 156
227 3300005577 Ga0068857_100793328 Ga0068857_1007933281 156
228 3300009094 Ga0111539_12355163 Ga0111539_123551631 156
229 3300013296 Ga0157374_11429566 Ga0157374_114295661 156
230 3300014745 Ga0157377_10871431 Ga0157377_108714311 156
231 3300025925 Ga0207650_10180599 Ga0207650_101805992 156
232 3300025931 Ga0207644_10142810 Ga0207644_101428103 156
233 3300025945 Ga0207679_10144887 Ga0207679_101448873 156
234 3300025960 Ga0207651_10917470 Ga0207651_109174701 156
235 3300026023 Ga0207677_10782441 Ga0207677_107824411 156
236 3300026075 Ga0207708_10553144 Ga0207708_105531441 156
237 3300026116 Ga0207674_10390586 Ga0207674_103905862 156
238 3300026118 Ga0207675_100144745 Ga0207675_1001447452 156
239 3300028380 Ga0268265_10548459 Ga0268265_105484591 156
240 3300005355 Ga0070671_100141206 Ga0070671_1001412062 157
241 3300005327 Ga0070658_10007514 Ga0070658_100075145 158
242 3300013307 Ga0157372_10520099 Ga0157372_105200992 158
243 3300025909 Ga0207705_10020568 Ga0207705_100205684 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

8

177

0.82

Feature Viewer

pLDDT pTM Quality
64.58 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map