F355438
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 243 | 156 | 243 | 164 |
Family's Representative Sequence
| Representative Sequence | 3300005841|Ga0068863_100915843|Ga0068863_1009158431 |
| Length | 185 |
| Sequence | MTKHSMPEMKEGGVNVTPLIDVVMCLIIFFMLVAKIGVSSGIDTGIRAPETYLGVKINDMGNVLALNLYKTGAAAPQIVVDLKGQPKQELKIQDGGKYPLREVLKEMKKERGEQFKVVINGGKVVKPRLDPAGNPVVGADGVPLTDTTELDYEQVSLVLQECAMAGVSNINFATKRGTKVVDDSE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 19 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 36 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 38 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 39 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 40 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 41 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 42 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 64 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 103 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 104 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 105 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 106 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 107 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 108 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 109 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 110 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 111 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 112 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 113 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 114 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 115 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 116 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 117 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 118 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 119 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 120 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 121 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 122 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 123 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 124 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 125 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 153 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.59 |
| Metatranscriptomes | 0.41 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 98.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10007514 | 3300005327 | Bacteria | 8795 |
| 2 | Ga0070658_10318708 | 3300005327 | Bacteria | 1327 |
| 3 | Ga0070658_10702193 | 3300005327 | Bacteria | 878 |
| 4 | Ga0070676_10065030 | 3300005328 | Bacteria | 2176 |
| 5 | Ga0070683_100270919 | 3300005329 | Bacteria | 1615 |
| 6 | Ga0070683_100290524 | 3300005329 | Bacteria | 1555 |
| 7 | Ga0070683_100446094 | 3300005329 | Bacteria | 1235 |
| 8 | Ga0070670_100153602 | 3300005331 | Bacteria | 1993 |
| 9 | Ga0070670_100254913 | 3300005331 | Bacteria | 1529 |
| 10 | Ga0070670_100330746 | 3300005331 | Unclassified | 1336 |
| 11 | Ga0070677_10227214 | 3300005333 | Bacteria | 915 |
| 12 | Ga0070680_101022547 | 3300005336 | Bacteria | 714 |
| 13 | Ga0070687_100241099 | 3300005343 | Bacteria | 1118 |
| 14 | Ga0070661_100276674 | 3300005344 | Bacteria | 1301 |
| 15 | Ga0070669_100697814 | 3300005353 | Bacteria | 857 |
| 16 | Ga0070675_100048089 | 3300005354 | Bacteria | 3496 |
| 17 | Ga0070675_100849155 | 3300005354 | Bacteria | 836 |
| 18 | Ga0070671_100141206 | 3300005355 | Bacteria | 2032 |
| 19 | Ga0070671_100211959 | 3300005355 | Bacteria | 1643 |
| 20 | Ga0070674_100014318 | 3300005356 | Bacteria | 4930 |
| 21 | Ga0070674_100927820 | 3300005356 | Bacteria | 760 |
| 22 | Ga0070673_100556059 | 3300005364 | Bacteria | 1043 |
| 23 | Ga0070714_100006953 | 3300005435 | Bacteria | 8772 |
| 24 | Ga0070714_100499408 | 3300005435 | Bacteria | 1160 |
| 25 | Ga0070713_101910169 | 3300005436 | Bacteria | 576 |
| 26 | Ga0070678_100055447 | 3300005456 | Bacteria | 2893 |
| 27 | Ga0070678_101495547 | 3300005456 | Bacteria | 632 |
| 28 | Ga0070681_10576679 | 3300005458 | Bacteria | 1039 |
| 29 | Ga0068867_100372741 | 3300005459 | Unclassified | 1197 |
| 30 | Ga0070685_10146782 | 3300005466 | Bacteria | 1491 |
| 31 | Ga0070684_100415182 | 3300005535 | Bacteria | 1242 |
| 32 | Ga0070684_101002408 | 3300005535 | Unclassified | 784 |
| 33 | Ga0068853_100370487 | 3300005539 | Bacteria | 1336 |
| 34 | Ga0070672_100145305 | 3300005543 | Bacteria | 1959 |
| 35 | Ga0070665_100034405 | 3300005548 | Bacteria | 5096 |
| 36 | Ga0070665_100389151 | 3300005548 | Bacteria | 1402 |
| 37 | Ga0068855_100034610 | 3300005563 | Bacteria | 6021 |
| 38 | Ga0068855_100178006 | 3300005563 | Bacteria | 2405 |
| 39 | Ga0068855_100465099 | 3300005563 | Unclassified | 1379 |
| 40 | Ga0068855_100623867 | 3300005563 | Bacteria | 1161 |
| 41 | Ga0070664_100073824 | 3300005564 | Bacteria | 2927 |
| 42 | Ga0068857_100011039 | 3300005577 | Bacteria | 7862 |
| 43 | Ga0068857_100793328 | 3300005577 | Unclassified | 904 |
| 44 | Ga0068854_100637025 | 3300005578 | Bacteria | 914 |
| 45 | Ga0068856_100423991 | 3300005614 | Unclassified | 1350 |
| 46 | Ga0070702_100454255 | 3300005615 | Unclassified | 930 |
| 47 | Ga0068859_100257710 | 3300005617 | Unclassified | 1835 |
| 48 | Ga0068864_100205817 | 3300005618 | Bacteria | 1810 |
| 49 | Ga0068864_101220830 | 3300005618 | Bacteria | 751 |
| 50 | Ga0068863_100735265 | 3300005841 | Bacteria | 982 |
| 51 | Ga0068863_100915843 | 3300005841 | Bacteria | 877 |
| 52 | Ga0068858_100156422 | 3300005842 | Bacteria | 2145 |
| 53 | Ga0068860_100497269 | 3300005843 | Bacteria | 1217 |
| 54 | Ga0068860_101065942 | 3300005843 | Bacteria | 827 |
| 55 | Ga0068860_101374661 | 3300005843 | Bacteria | 727 |
| 56 | Ga0081539_10006791 | 3300005985 | Bacteria | 10736 |
| 57 | Ga0097621_101388337 | 3300006237 | Bacteria | 665 |
| 58 | Ga0068871_101855077 | 3300006358 | Bacteria | 573 |
| 59 | Ga0075428_101312046 | 3300006844 | Unclassified | 761 |
| 60 | Ga0075430_100059857 | 3300006846 | Bacteria | 3201 |
| 61 | Ga0075431_100288807 | 3300006847 | Bacteria | 1660 |
| 62 | Ga0075429_100239109 | 3300006880 | Bacteria | 1591 |
| 63 | Ga0097620_100257703 | 3300006931 | Unclassified | 1835 |
| 64 | Ga0105240_10015689 | 3300009093 | Bacteria | 10284 |
| 65 | Ga0105240_10507191 | 3300009093 | Bacteria | 1340 |
| 66 | Ga0105240_10632187 | 3300009093 | Bacteria | 1175 |
| 67 | Ga0111539_11397902 | 3300009094 | Bacteria | 812 |
| 68 | Ga0111539_12195591 | 3300009094 | Unclassified | 640 |
| 69 | Ga0111539_12355163 | 3300009094 | Unclassified | 618 |
| 70 | Ga0105245_10057158 | 3300009098 | Unclassified | 3508 |
| 71 | Ga0105245_10744514 | 3300009098 | Bacteria | 1016 |
| 72 | Ga0105245_11386194 | 3300009098 | Bacteria | 753 |
| 73 | Ga0105245_11461986 | 3300009098 | Bacteria | 734 |
| 74 | Ga0114129_11926764 | 3300009147 | Bacteria | 716 |
| 75 | Ga0105241_10544765 | 3300009174 | Unclassified | 1041 |
| 76 | Ga0105248_11077610 | 3300009177 | Unclassified | 908 |
| 77 | Ga0105248_12026700 | 3300009177 | Bacteria | 654 |
| 78 | Ga0105237_11331776 | 3300009545 | Unclassified | 724 |
| 79 | Ga0105238_10499669 | 3300009551 | Bacteria | 1217 |
| 80 | Ga0105239_10010974 | 3300010375 | Bacteria | 10115 |
| 81 | Ga0105239_10578739 | 3300010375 | Bacteria | 1280 |
| 82 | Ga0105239_10992347 | 3300010375 | Unclassified | 965 |
| 83 | Ga0157373_10129596 | 3300013100 | Bacteria | 1774 |
| 84 | Ga0157373_10339567 | 3300013100 | Bacteria | 1070 |
| 85 | Ga0157371_10499086 | 3300013102 | Bacteria | 899 |
| 86 | Ga0157370_10171003 | 3300013104 | Unclassified | 2020 |
| 87 | Ga0157370_10270950 | 3300013104 | Bacteria | 1568 |
| 88 | Ga0157370_10413616 | 3300013104 | Bacteria | 1241 |
| 89 | Ga0157370_11165741 | 3300013104 | Unclassified | 696 |
| 90 | Ga0157369_10075271 | 3300013105 | Unclassified | 3620 |
| 91 | Ga0157369_10122165 | 3300013105 | Bacteria | 2762 |
| 92 | Ga0157369_10203897 | 3300013105 | Bacteria | 2075 |
| 93 | Ga0157369_10788941 | 3300013105 | Unclassified | 976 |
| 94 | Ga0157369_10811980 | 3300013105 | Bacteria | 961 |
| 95 | Ga0157369_11263995 | 3300013105 | Bacteria | 753 |
| 96 | Ga0157369_11985741 | 3300013105 | Unclassified | 590 |
| 97 | Ga0157374_10599063 | 3300013296 | Bacteria | 1112 |
| 98 | Ga0157374_11429566 | 3300013296 | Unclassified | 714 |
| 99 | Ga0163162_10045266 | 3300013306 | Bacteria | 4409 |
| 100 | Ga0163162_10320205 | 3300013306 | Bacteria | 1683 |
| 101 | Ga0163162_10682298 | 3300013306 | Bacteria | 1150 |
| 102 | Ga0163162_12301264 | 3300013306 | Bacteria | 619 |
| 103 | Ga0157372_10041464 | 3300013307 | Bacteria | 5090 |
| 104 | Ga0157372_10115714 | 3300013307 | Bacteria | 3074 |
| 105 | Ga0157372_10328188 | 3300013307 | Unclassified | 1782 |
| 106 | Ga0157372_10419643 | 3300013307 | Bacteria | 1559 |
| 107 | Ga0157372_10520099 | 3300013307 | Bacteria | 1387 |
| 108 | Ga0157372_10582786 | 3300013307 | Bacteria | 1304 |
| 109 | Ga0157372_10871501 | 3300013307 | Bacteria | 1045 |
| 110 | Ga0157372_10973267 | 3300013307 | Unclassified | 983 |
| 111 | Ga0157375_10608693 | 3300013308 | Bacteria | 1251 |
| 112 | Ga0157375_11339521 | 3300013308 | Bacteria | 842 |
| 113 | Ga0163163_11474523 | 3300014325 | Bacteria | 742 |
| 114 | Ga0163163_12484409 | 3300014325 | Unclassified | 576 |
| 115 | Ga0157377_10871431 | 3300014745 | Unclassified | 670 |
| 116 | Ga0206352_10061443 | 3300020078 | Unclassified | 2169 |
| 117 | Ga0213874_10291089 | 3300021377 | Bacteria | 612 |
| 118 | Ga0207688_10339323 | 3300025901 | Bacteria | 924 |
| 119 | Ga0207645_10031867 | 3300025907 | Bacteria | 3389 |
| 120 | Ga0207705_10020568 | 3300025909 | Bacteria | 4713 |
| 121 | Ga0207684_10059249 | 3300025910 | Bacteria | 3251 |
| 122 | Ga0207654_10045173 | 3300025911 | Bacteria | 2506 |
| 123 | Ga0207707_10215699 | 3300025912 | Bacteria | 1671 |
| 124 | Ga0207695_10001194 | 3300025913 | Bacteria | 44655 |
| 125 | Ga0207671_11308128 | 3300025914 | Unclassified | 564 |
| 126 | Ga0207660_11496263 | 3300025917 | Unclassified | 546 |
| 127 | Ga0207662_10628244 | 3300025918 | Bacteria | 749 |
| 128 | Ga0207649_10432080 | 3300025920 | Bacteria | 991 |
| 129 | Ga0207649_10975472 | 3300025920 | Unclassified | 666 |
| 130 | Ga0207650_10180599 | 3300025925 | Bacteria | 1681 |
| 131 | Ga0207650_10242622 | 3300025925 | Bacteria | 1456 |
| 132 | Ga0207650_10810870 | 3300025925 | Bacteria | 793 |
| 133 | Ga0207659_10101346 | 3300025926 | Bacteria | 2171 |
| 134 | Ga0207659_10130088 | 3300025926 | Bacteria | 1942 |
| 135 | Ga0207687_10103482 | 3300025927 | Bacteria | 2100 |
| 136 | Ga0207687_10658348 | 3300025927 | Bacteria | 886 |
| 137 | Ga0207664_10171914 | 3300025929 | Bacteria | 1855 |
| 138 | Ga0207644_10142810 | 3300025931 | Unclassified | 1845 |
| 139 | Ga0207690_10343050 | 3300025932 | Bacteria | 1179 |
| 140 | Ga0207690_11145989 | 3300025932 | Bacteria | 649 |
| 141 | Ga0207686_10794932 | 3300025934 | Unclassified | 758 |
| 142 | Ga0207704_10516024 | 3300025938 | Bacteria | 966 |
| 143 | Ga0207691_10105136 | 3300025940 | Bacteria | 2515 |
| 144 | Ga0207691_10567885 | 3300025940 | Bacteria | 961 |
| 145 | Ga0207661_10359642 | 3300025944 | Bacteria | 1315 |
| 146 | Ga0207661_10461442 | 3300025944 | Bacteria | 1158 |
| 147 | Ga0207661_10687711 | 3300025944 | Bacteria | 941 |
| 148 | Ga0207679_10144887 | 3300025945 | Bacteria | 1925 |
| 149 | Ga0207679_11425942 | 3300025945 | Unclassified | 635 |
| 150 | Ga0207667_10274708 | 3300025949 | Unclassified | 1723 |
| 151 | Ga0207667_10292039 | 3300025949 | Bacteria | 1665 |
| 152 | Ga0207667_10297732 | 3300025949 | Bacteria | 1648 |
| 153 | Ga0207651_10239569 | 3300025960 | Bacteria | 1478 |
| 154 | Ga0207651_10917470 | 3300025960 | Unclassified | 780 |
| 155 | Ga0207640_10413738 | 3300025981 | Bacteria | 1101 |
| 156 | Ga0207658_10097797 | 3300025986 | Bacteria | 2292 |
| 157 | Ga0207677_10782441 | 3300026023 | Bacteria | 853 |
| 158 | Ga0207703_10438848 | 3300026035 | Unclassified | 1218 |
| 159 | Ga0207708_10553144 | 3300026075 | Bacteria | 971 |
| 160 | Ga0207641_10198125 | 3300026088 | Bacteria | 1850 |
| 161 | Ga0207641_12036609 | 3300026088 | Unclassified | 575 |
| 162 | Ga0207648_10034762 | 3300026089 | Bacteria | 4442 |
| 163 | Ga0207648_10487512 | 3300026089 | Unclassified | 1126 |
| 164 | Ga0207676_10618724 | 3300026095 | Unclassified | 1042 |
| 165 | Ga0207676_11693812 | 3300026095 | Unclassified | 631 |
| 166 | Ga0207674_10010736 | 3300026116 | Bacteria | 10338 |
| 167 | Ga0207674_10390586 | 3300026116 | Bacteria | 1345 |
| 168 | Ga0207675_100144745 | 3300026118 | Bacteria | 2259 |
| 169 | Ga0207683_10050167 | 3300026121 | Bacteria | 3654 |
| 170 | Ga0268266_10364998 | 3300028379 | Bacteria | 1359 |
| 171 | Ga0268265_10548459 | 3300028380 | Bacteria | 1097 |
| 172 | Ga0268264_10373587 | 3300028381 | Bacteria | 1363 |
| 173 | Ga0307408_100879510 | 3300031548 | Bacteria | 819 |
| 174 | Ga0265313_10018441 | 3300031595 | Bacteria | 3917 |
| 175 | Ga0307405_10518586 | 3300031731 | Bacteria | 959 |
| 176 | Ga0307413_10112446 | 3300031824 | Bacteria | 1826 |
| 177 | Ga0307413_10704289 | 3300031824 | Bacteria | 839 |
| 178 | Ga0307410_10177246 | 3300031852 | Bacteria | 1611 |
| 179 | Ga0307410_10604994 | 3300031852 | Bacteria | 915 |
| 180 | Ga0307406_10707794 | 3300031901 | Bacteria | 842 |
| 181 | Ga0307412_10682508 | 3300031911 | Unclassified | 880 |
| 182 | Ga0307409_100279517 | 3300031995 | Bacteria | 1542 |
| 183 | Ga0307409_100345820 | 3300031995 | Bacteria | 1401 |
| 184 | Ga0307409_100919208 | 3300031995 | Bacteria | 889 |
| 185 | Ga0307409_100954139 | 3300031995 | Bacteria | 874 |
| 186 | Ga0307416_100534616 | 3300032002 | Bacteria | 1243 |
| 187 | Ga0307416_101256363 | 3300032002 | Bacteria | 846 |
| 188 | Ga0307416_101301477 | 3300032002 | Bacteria | 833 |
| 189 | Ga0307414_10331668 | 3300032004 | Bacteria | 1299 |
| 190 | Ga0307411_10054239 | 3300032005 | Bacteria | 2631 |
| 191 | Ga0307411_10156953 | 3300032005 | Bacteria | 1698 |
| 192 | Ga0307415_100627415 | 3300032126 | Bacteria | 960 |
| 193 | Ga0373933_0267546 | 3300035724 | Unclassified | 1103 |
| 194 | Ga0373937_0022367 | 3300036401 | Bacteria | 5685 |
| 195 | Ga0373937_0063214 | 3300036401 | Bacteria | 3404 |
| 196 | Ga0395899_0734570 | 3300037312 | Bacteria | 616 |
| 197 | Ga0395898_0604165 | 3300037466 | Bacteria | 1040 |
| 198 | Ga0395905_0254038 | 3300037471 | Bacteria | 1642 |
| 199 | Ga0395901_0024034 | 3300038443 | Bacteria | 6251 |
| 200 | Ga0395901_0197983 | 3300038443 | Bacteria | 2106 |
| 201 | Ga0436365_1585628 | 3300039437 | Bacteria | 1615 |
| 202 | Ga0436363_1409552 | 3300039450 | Bacteria | 964 |
| 203 | Ga0451577_0159501 | 3300042876 | Bacteria | 2031 |
| 204 | Ga0453684_1430593 | 3300044712 | Bacteria | 716 |
| 205 | Ga0451576_0000224 | 3300045051 | Bacteria | 138894 |
| 206 | Ga0451576_1119504 | 3300045051 | Bacteria | 824 |
| 207 | Ga0495592_0347326 | 3300046454 | Unclassified | 952 |
| 208 | Ga0495580_0022812 | 3300046472 | Bacteria | 4602 |
| 209 | Ga0495662_0053069 | 3300046476 | Bacteria | 1958 |
| 210 | Ga0495594_0318715 | 3300046499 | Unclassified | 886 |
| 211 | Ga0495608_0410341 | 3300046511 | Bacteria | 827 |
| 212 | Ga0495628_0056175 | 3300046516 | Bacteria | 3100 |
| 213 | Ga0495630_0001586 | 3300046517 | Bacteria | 15817 |
| 214 | Ga0495652_0497479 | 3300046529 | Bacteria | 846 |
| 215 | Ga0495586_0043975 | 3300046535 | Bacteria | 2405 |
| 216 | Ga0495587_0306108 | 3300046536 | Bacteria | 888 |
| 217 | Ga0495598_0126094 | 3300046537 | Bacteria | 873 |
| 218 | Ga0495622_0309693 | 3300046557 | Bacteria | 687 |
| 219 | Ga0495667_0208557 | 3300046559 | Bacteria | 1249 |
| 220 | Ga0495634_0065795 | 3300046642 | Bacteria | 2401 |
| 221 | Ga0495635_0136390 | 3300046663 | Bacteria | 1672 |
| 222 | Ga0495635_0320252 | 3300046663 | Bacteria | 1038 |
| 223 | Ga0495613_0017351 | 3300046689 | Bacteria | 5364 |
| 224 | Ga0495624_0004658 | 3300046690 | Bacteria | 9983 |
| 225 | Ga0495581_0324618 | 3300047315 | Bacteria | 899 |
| 226 | Ga0495604_0144631 | 3300047317 | Bacteria | 1696 |
| 227 | Ga0495674_0000959 | 3300047319 | Bacteria | 27597 |
| 228 | Ga0495684_0014493 | 3300047471 | Bacteria | 6067 |
| 229 | Ga0495684_0023709 | 3300047471 | Bacteria | 4719 |
| 230 | Ga0501032_0101433 | 3300049569 | Bacteria | 1907 |
| 231 | Ga0501034_0000691 | 3300049571 | Bacteria | 51242 |
| 232 | Ga0501034_0092072 | 3300049571 | Bacteria | 3029 |
| 233 | Ga0501040_0155467 | 3300049576 | Bacteria | 1615 |
| 234 | Ga0501046_0516549 | 3300049580 | Bacteria | 854 |
| 235 | Ga0501047_0033073 | 3300049581 | Bacteria | 4993 |
| 236 | Ga0501070_0907173 | 3300049586 | Bacteria | 687 |
| 237 | Ga0501221_044776 | 3300049704 | Bacteria | 978 |
| 238 | Ga0501080_0106540 | 3300049742 | Bacteria | 2598 |
| 239 | Ga0501080_0388003 | 3300049742 | Bacteria | 1257 |
| 240 | Ga0501044_0001552 | 3300049823 | Bacteria | 26910 |
| 241 | Ga0501044_0006456 | 3300049823 | Bacteria | 12954 |
| 242 | nmdc:mga0qj67_168254_c1 | 3300050509 | Bacteria | 1780 |
| 243 | nmdc:mga06r32_112109_c1 | 3300050510 | Bacteria | 2684 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025934 | Ga0207686_10794932 | Ga0207686_107949321 | 126 |
| 2 | 3300039437 | Ga0436365_1585628 | Ga0436365_1585628_1199_1600 | 127 |
| 3 | 3300025981 | Ga0207640_10413738 | Ga0207640_104137382 | 137 |
| 4 | 3300026089 | Ga0207648_10034762 | Ga0207648_100347622 | 137 |
| 5 | 3300013100 | Ga0157373_10339567 | Ga0157373_103395671 | 138 |
| 6 | 3300009098 | Ga0105245_10744514 | Ga0105245_107445141 | 140 |
| 7 | 3300045051 | Ga0451576_1119504 | Ga0451576_1119504_239_688 | 143 |
| 8 | 3300005459 | Ga0068867_100372741 | Ga0068867_1003727412 | 144 |
| 9 | 3300005615 | Ga0070702_100454255 | Ga0070702_1004542552 | 144 |
| 10 | 3300009094 | Ga0111539_11397902 | Ga0111539_113979022 | 144 |
| 11 | 3300026089 | Ga0207648_10487512 | Ga0207648_104875122 | 144 |
| 12 | 3300044712 | Ga0453684_1430593 | Ga0453684_1430593_41_493 | 144 |
| 13 | 3300009177 | Ga0105248_11077610 | Ga0105248_110776101 | 145 |
| 14 | 3300021377 | Ga0213874_10291089 | Ga0213874_102910891 | 145 |
| 15 | 3300046535 | Ga0495586_0043975 | Ga0495586_0043975_1378_1890 | 145 |
| 16 | 3300049569 | Ga0501032_0101433 | Ga0501032_0101433_1043_1555 | 145 |
| 17 | 3300049571 | Ga0501034_0092072 | Ga0501034_0092072_1104_1616 | 145 |
| 18 | 3300049576 | Ga0501040_0155467 | Ga0501040_0155467_702_1214 | 145 |
| 19 | 3300049580 | Ga0501046_0516549 | Ga0501046_0516549_278_790 | 145 |
| 20 | 3300049581 | Ga0501047_0033073 | Ga0501047_0033073_1600_2112 | 145 |
| 21 | 3300049586 | Ga0501070_0907173 | Ga0501070_0907173_164_676 | 145 |
| 22 | 3300049742 | Ga0501080_0388003 | Ga0501080_0388003_86_598 | 145 |
| 23 | 3300049823 | Ga0501044_0001552 | Ga0501044_0001552_22508_23020 | 145 |
| 24 | 3300005436 | Ga0070713_101910169 | Ga0070713_1019101691 | 146 |
| 25 | 3300046536 | Ga0495587_0306108 | Ga0495587_0306108_419_877 | 146 |
| 26 | 3300049571 | Ga0501034_0000691 | Ga0501034_0000691_19740_20255 | 146 |
| 27 | 3300049742 | Ga0501080_0106540 | Ga0501080_0106540_945_1460 | 146 |
| 28 | 3300049823 | Ga0501044_0006456 | Ga0501044_0006456_12037_12552 | 146 |
| 29 | 3300005843 | Ga0068860_100497269 | Ga0068860_1004972692 | 147 |
| 30 | 3300009093 | Ga0105240_10015689 | Ga0105240_100156894 | 147 |
| 31 | 3300009093 | Ga0105240_10507191 | Ga0105240_105071912 | 147 |
| 32 | 3300013104 | Ga0157370_10171003 | Ga0157370_101710032 | 147 |
| 33 | 3300013104 | Ga0157370_10270950 | Ga0157370_102709501 | 147 |
| 34 | 3300013105 | Ga0157369_10075271 | Ga0157369_100752712 | 147 |
| 35 | 3300013307 | Ga0157372_10328188 | Ga0157372_103281882 | 147 |
| 36 | 3300031595 | Ga0265313_10018441 | Ga0265313_100184413 | 147 |
| 37 | 3300031911 | Ga0307412_10682508 | Ga0307412_106825082 | 147 |
| 38 | 3300042876 | Ga0451577_0159501 | Ga0451577_0159501_658_1119 | 147 |
| 39 | 3300005331 | Ga0070670_100330746 | Ga0070670_1003307462 | 148 |
| 40 | 3300005354 | Ga0070675_100849155 | Ga0070675_1008491551 | 148 |
| 41 | 3300005617 | Ga0068859_100257710 | Ga0068859_1002577103 | 148 |
| 42 | 3300006237 | Ga0097621_101388337 | Ga0097621_1013883371 | 148 |
| 43 | 3300006931 | Ga0097620_100257703 | Ga0097620_1002577032 | 148 |
| 44 | 3300009098 | Ga0105245_11461986 | Ga0105245_114619861 | 148 |
| 45 | 3300014325 | Ga0163163_12484409 | Ga0163163_124844091 | 148 |
| 46 | 3300025926 | Ga0207659_10130088 | Ga0207659_101300883 | 148 |
| 47 | 3300025927 | Ga0207687_10658348 | Ga0207687_106583482 | 148 |
| 48 | 3300025945 | Ga0207679_11425942 | Ga0207679_114259421 | 148 |
| 49 | 3300031824 | Ga0307413_10704289 | Ga0307413_107042892 | 148 |
| 50 | 3300031901 | Ga0307406_10707794 | Ga0307406_107077941 | 148 |
| 51 | 3300031995 | Ga0307409_100345820 | Ga0307409_1003458203 | 148 |
| 52 | 3300032002 | Ga0307416_101256363 | Ga0307416_1012563631 | 148 |
| 53 | 3300032002 | Ga0307416_101301477 | Ga0307416_1013014772 | 148 |
| 54 | 3300032005 | Ga0307411_10156953 | Ga0307411_101569533 | 148 |
| 55 | 3300005435 | Ga0070714_100006953 | Ga0070714_1000069532 | 149 |
| 56 | 3300005842 | Ga0068858_100156422 | Ga0068858_1001564222 | 149 |
| 57 | 3300005843 | Ga0068860_101065942 | Ga0068860_1010659422 | 149 |
| 58 | 3300005985 | Ga0081539_10006791 | Ga0081539_100067916 | 149 |
| 59 | 3300009545 | Ga0105237_11331776 | Ga0105237_113317761 | 149 |
| 60 | 3300010375 | Ga0105239_10010974 | Ga0105239_100109745 | 149 |
| 61 | 3300010375 | Ga0105239_10992347 | Ga0105239_109923471 | 149 |
| 62 | 3300013102 | Ga0157371_10499086 | Ga0157371_104990862 | 149 |
| 63 | 3300013104 | Ga0157370_10413616 | Ga0157370_104136162 | 149 |
| 64 | 3300013105 | Ga0157369_10122165 | Ga0157369_101221652 | 149 |
| 65 | 3300013105 | Ga0157369_10203897 | Ga0157369_102038972 | 149 |
| 66 | 3300013105 | Ga0157369_10811980 | Ga0157369_108119802 | 149 |
| 67 | 3300013307 | Ga0157372_10041464 | Ga0157372_100414643 | 149 |
| 68 | 3300013307 | Ga0157372_10115714 | Ga0157372_101157142 | 149 |
| 69 | 3300013307 | Ga0157372_10582786 | Ga0157372_105827862 | 149 |
| 70 | 3300013307 | Ga0157372_10871501 | Ga0157372_108715011 | 149 |
| 71 | 3300013307 | Ga0157372_10973267 | Ga0157372_109732671 | 149 |
| 72 | 3300014325 | Ga0163163_11474523 | Ga0163163_114745232 | 149 |
| 73 | 3300025932 | Ga0207690_11145989 | Ga0207690_111459891 | 149 |
| 74 | 3300025944 | Ga0207661_10687711 | Ga0207661_106877112 | 149 |
| 75 | 3300026035 | Ga0207703_10438848 | Ga0207703_104388482 | 149 |
| 76 | 3300026095 | Ga0207676_11693812 | Ga0207676_116938121 | 149 |
| 77 | 3300035724 | Ga0373933_0267546 | Ga0373933_0267546_258_785 | 149 |
| 78 | 3300036401 | Ga0373937_0022367 | Ga0373937_0022367_2526_3053 | 149 |
| 79 | 3300037312 | Ga0395899_0734570 | Ga0395899_0734570_72_599 | 149 |
| 80 | 3300037466 | Ga0395898_0604165 | Ga0395898_0604165_549_1025 | 149 |
| 81 | 3300037471 | Ga0395905_0254038 | Ga0395905_0254038_186_662 | 149 |
| 82 | 3300038443 | Ga0395901_0197983 | Ga0395901_0197983_534_1010 | 149 |
| 83 | 3300039450 | Ga0436363_1409552 | Ga0436363_1409552_374_844 | 149 |
| 84 | 3300046454 | Ga0495592_0347326 | Ga0495592_0347326_208_735 | 149 |
| 85 | 3300046499 | Ga0495594_0318715 | Ga0495594_0318715_291_836 | 149 |
| 86 | 3300050510 | nmdc:mga06r32_112109_c1 | nmdc:mga06r32_112109_c1_1659_2141 | 149 |
| 87 | 3300005578 | Ga0068854_100637025 | Ga0068854_1006370252 | 150 |
| 88 | 3300005618 | Ga0068864_100205817 | Ga0068864_1002058172 | 150 |
| 89 | 3300006846 | Ga0075430_100059857 | Ga0075430_1000598573 | 150 |
| 90 | 3300006847 | Ga0075431_100288807 | Ga0075431_1002888072 | 150 |
| 91 | 3300006880 | Ga0075429_100239109 | Ga0075429_1002391093 | 150 |
| 92 | 3300009094 | Ga0111539_12195591 | Ga0111539_121955911 | 150 |
| 93 | 3300009551 | Ga0105238_10499669 | Ga0105238_104996692 | 150 |
| 94 | 3300013100 | Ga0157373_10129596 | Ga0157373_101295962 | 150 |
| 95 | 3300013104 | Ga0157370_11165741 | Ga0157370_111657411 | 150 |
| 96 | 3300013105 | Ga0157369_11985741 | Ga0157369_119857411 | 150 |
| 97 | 3300013306 | Ga0163162_10320205 | Ga0163162_103202053 | 150 |
| 98 | 3300013307 | Ga0157372_10419643 | Ga0157372_104196432 | 150 |
| 99 | 3300025910 | Ga0207684_10059249 | Ga0207684_100592493 | 150 |
| 100 | 3300026088 | Ga0207641_12036609 | Ga0207641_120366091 | 150 |
| 101 | 3300026095 | Ga0207676_10618724 | Ga0207676_106187242 | 150 |
| 102 | 3300031852 | Ga0307410_10604994 | Ga0307410_106049942 | 150 |
| 103 | 3300031995 | Ga0307409_100954139 | Ga0307409_1009541392 | 150 |
| 104 | 3300036401 | Ga0373937_0063214 | Ga0373937_0063214_666_1139 | 150 |
| 105 | 3300046511 | Ga0495608_0410341 | Ga0495608_0410341_326_799 | 150 |
| 106 | 3300046559 | Ga0495667_0208557 | Ga0495667_0208557_21_494 | 150 |
| 107 | 3300046642 | Ga0495634_0065795 | Ga0495634_0065795_1026_1499 | 150 |
| 108 | 3300046663 | Ga0495635_0136390 | Ga0495635_0136390_159_632 | 150 |
| 109 | 3300046689 | Ga0495613_0017351 | Ga0495613_0017351_3965_4438 | 150 |
| 110 | 3300047471 | Ga0495684_0023709 | Ga0495684_0023709_2018_2491 | 150 |
| 111 | 3300050509 | nmdc:mga0qj67_168254_c1 | nmdc:mga0qj67_168254_c1_391_873 | 150 |
| 112 | 3300005329 | Ga0070683_100270919 | Ga0070683_1002709192 | 151 |
| 113 | 3300005336 | Ga0070680_101022547 | Ga0070680_1010225472 | 151 |
| 114 | 3300005435 | Ga0070714_100499408 | Ga0070714_1004994081 | 151 |
| 115 | 3300005563 | Ga0068855_100465099 | Ga0068855_1004650991 | 151 |
| 116 | 3300005563 | Ga0068855_100623867 | Ga0068855_1006238672 | 151 |
| 117 | 3300005614 | Ga0068856_100423991 | Ga0068856_1004239913 | 151 |
| 118 | 3300005841 | Ga0068863_100915843 | Ga0068863_1009158431 | 151 |
| 119 | 3300009147 | Ga0114129_11926764 | Ga0114129_119267641 | 151 |
| 120 | 3300009177 | Ga0105248_12026700 | Ga0105248_120267001 | 151 |
| 121 | 3300013308 | Ga0157375_11339521 | Ga0157375_113395211 | 151 |
| 122 | 3300020078 | Ga0206352_10061443 | Ga0206352_100614432 | 151 |
| 123 | 3300025913 | Ga0207695_10001194 | Ga0207695_1000119432 | 151 |
| 124 | 3300025917 | Ga0207660_11496263 | Ga0207660_114962631 | 151 |
| 125 | 3300025949 | Ga0207667_10274708 | Ga0207667_102747082 | 151 |
| 126 | 3300025986 | Ga0207658_10097797 | Ga0207658_100977974 | 151 |
| 127 | 3300026088 | Ga0207641_10198125 | Ga0207641_101981251 | 151 |
| 128 | 3300028381 | Ga0268264_10373587 | Ga0268264_103735872 | 151 |
| 129 | 3300031995 | Ga0307409_100919208 | Ga0307409_1009192082 | 151 |
| 130 | 3300046537 | Ga0495598_0126094 | Ga0495598_0126094_392_862 | 151 |
| 131 | 3300005331 | Ga0070670_100254913 | Ga0070670_1002549132 | 152 |
| 132 | 3300005343 | Ga0070687_100241099 | Ga0070687_1002410991 | 152 |
| 133 | 3300005466 | Ga0070685_10146782 | Ga0070685_101467821 | 152 |
| 134 | 3300005548 | Ga0070665_100034405 | Ga0070665_1000344054 | 152 |
| 135 | 3300005841 | Ga0068863_100735265 | Ga0068863_1007352651 | 152 |
| 136 | 3300025925 | Ga0207650_10242622 | Ga0207650_102426222 | 152 |
| 137 | 3300025926 | Ga0207659_10101346 | Ga0207659_101013463 | 152 |
| 138 | 3300025929 | Ga0207664_10171914 | Ga0207664_101719143 | 152 |
| 139 | 3300025960 | Ga0207651_10239569 | Ga0207651_102395692 | 152 |
| 140 | 3300028379 | Ga0268266_10364998 | Ga0268266_103649982 | 152 |
| 141 | 3300031548 | Ga0307408_100879510 | Ga0307408_1008795102 | 152 |
| 142 | 3300031824 | Ga0307413_10112446 | Ga0307413_101124463 | 152 |
| 143 | 3300031852 | Ga0307410_10177246 | Ga0307410_101772462 | 152 |
| 144 | 3300031995 | Ga0307409_100279517 | Ga0307409_1002795171 | 152 |
| 145 | 3300032002 | Ga0307416_100534616 | Ga0307416_1005346162 | 152 |
| 146 | 3300032004 | Ga0307414_10331668 | Ga0307414_103316682 | 152 |
| 147 | 3300032005 | Ga0307411_10054239 | Ga0307411_100542392 | 152 |
| 148 | 3300032126 | Ga0307415_100627415 | Ga0307415_1006274152 | 152 |
| 149 | 3300049704 | Ga0501221_044776 | Ga0501221_044776_15_521 | 152 |
| 150 | 3300005327 | Ga0070658_10702193 | Ga0070658_107021932 | 153 |
| 151 | 3300005329 | Ga0070683_100290524 | Ga0070683_1002905242 | 153 |
| 152 | 3300005329 | Ga0070683_100446094 | Ga0070683_1004460942 | 153 |
| 153 | 3300005456 | Ga0070678_101495547 | Ga0070678_1014955471 | 153 |
| 154 | 3300005458 | Ga0070681_10576679 | Ga0070681_105766792 | 153 |
| 155 | 3300005535 | Ga0070684_100415182 | Ga0070684_1004151822 | 153 |
| 156 | 3300005535 | Ga0070684_101002408 | Ga0070684_1010024082 | 153 |
| 157 | 3300005548 | Ga0070665_100389151 | Ga0070665_1003891512 | 153 |
| 158 | 3300005563 | Ga0068855_100034610 | Ga0068855_1000346105 | 153 |
| 159 | 3300005563 | Ga0068855_100178006 | Ga0068855_1001780061 | 153 |
| 160 | 3300005577 | Ga0068857_100011039 | Ga0068857_1000110394 | 153 |
| 161 | 3300005618 | Ga0068864_101220830 | Ga0068864_1012208302 | 153 |
| 162 | 3300009093 | Ga0105240_10632187 | Ga0105240_106321872 | 153 |
| 163 | 3300009098 | Ga0105245_10057158 | Ga0105245_100571584 | 153 |
| 164 | 3300009098 | Ga0105245_11386194 | Ga0105245_113861942 | 153 |
| 165 | 3300009174 | Ga0105241_10544765 | Ga0105241_105447652 | 153 |
| 166 | 3300010375 | Ga0105239_10578739 | Ga0105239_105787392 | 153 |
| 167 | 3300013105 | Ga0157369_10788941 | Ga0157369_107889412 | 153 |
| 168 | 3300013296 | Ga0157374_10599063 | Ga0157374_105990632 | 153 |
| 169 | 3300013306 | Ga0163162_10045266 | Ga0163162_100452663 | 153 |
| 170 | 3300013306 | Ga0163162_10682298 | Ga0163162_106822982 | 153 |
| 171 | 3300013308 | Ga0157375_10608693 | Ga0157375_106086932 | 153 |
| 172 | 3300025911 | Ga0207654_10045173 | Ga0207654_100451733 | 153 |
| 173 | 3300025912 | Ga0207707_10215699 | Ga0207707_102156992 | 153 |
| 174 | 3300025914 | Ga0207671_11308128 | Ga0207671_113081281 | 153 |
| 175 | 3300025925 | Ga0207650_10810870 | Ga0207650_108108701 | 153 |
| 176 | 3300025927 | Ga0207687_10103482 | Ga0207687_101034821 | 153 |
| 177 | 3300025944 | Ga0207661_10461442 | Ga0207661_104614422 | 153 |
| 178 | 3300025949 | Ga0207667_10292039 | Ga0207667_102920392 | 153 |
| 179 | 3300025949 | Ga0207667_10297732 | Ga0207667_102977322 | 153 |
| 180 | 3300026116 | Ga0207674_10010736 | Ga0207674_100107364 | 153 |
| 181 | 3300031731 | Ga0307405_10518586 | Ga0307405_105185861 | 153 |
| 182 | 3300038443 | Ga0395901_0024034 | Ga0395901_0024034_4795_5349 | 153 |
| 183 | 3300045051 | Ga0451576_0000224 | Ga0451576_0000224_65183_65713 | 153 |
| 184 | 3300046472 | Ga0495580_0022812 | Ga0495580_0022812_2409_2903 | 153 |
| 185 | 3300046476 | Ga0495662_0053069 | Ga0495662_0053069_1116_1610 | 153 |
| 186 | 3300046516 | Ga0495628_0056175 | Ga0495628_0056175_2164_2658 | 153 |
| 187 | 3300046517 | Ga0495630_0001586 | Ga0495630_0001586_2787_3281 | 153 |
| 188 | 3300046529 | Ga0495652_0497479 | Ga0495652_0497479_322_816 | 153 |
| 189 | 3300046557 | Ga0495622_0309693 | Ga0495622_0309693_65_556 | 153 |
| 190 | 3300046663 | Ga0495635_0320252 | Ga0495635_0320252_476_970 | 153 |
| 191 | 3300046690 | Ga0495624_0004658 | Ga0495624_0004658_72_566 | 153 |
| 192 | 3300047315 | Ga0495581_0324618 | Ga0495581_0324618_278_769 | 153 |
| 193 | 3300047317 | Ga0495604_0144631 | Ga0495604_0144631_206_700 | 153 |
| 194 | 3300047319 | Ga0495674_0000959 | Ga0495674_0000959_23425_23919 | 153 |
| 195 | 3300047471 | Ga0495684_0014493 | Ga0495684_0014493_4475_4969 | 153 |
| 196 | 3300005327 | Ga0070658_10318708 | Ga0070658_103187082 | 154 |
| 197 | 3300005333 | Ga0070677_10227214 | Ga0070677_102272142 | 154 |
| 198 | 3300005344 | Ga0070661_100276674 | Ga0070661_1002766742 | 154 |
| 199 | 3300005356 | Ga0070674_100927820 | Ga0070674_1009278201 | 154 |
| 200 | 3300005539 | Ga0068853_100370487 | Ga0068853_1003704872 | 154 |
| 201 | 3300006358 | Ga0068871_101855077 | Ga0068871_1018550771 | 154 |
| 202 | 3300013105 | Ga0157369_11263995 | Ga0157369_112639952 | 154 |
| 203 | 3300013306 | Ga0163162_12301264 | Ga0163162_123012641 | 154 |
| 204 | 3300025901 | Ga0207688_10339323 | Ga0207688_103393232 | 154 |
| 205 | 3300025920 | Ga0207649_10432080 | Ga0207649_104320801 | 154 |
| 206 | 3300025932 | Ga0207690_10343050 | Ga0207690_103430502 | 154 |
| 207 | 3300025940 | Ga0207691_10567885 | Ga0207691_105678852 | 154 |
| 208 | 3300025944 | Ga0207661_10359642 | Ga0207661_103596422 | 154 |
| 209 | 3300005328 | Ga0070676_10065030 | Ga0070676_100650303 | 155 |
| 210 | 3300005354 | Ga0070675_100048089 | Ga0070675_1000480893 | 155 |
| 211 | 3300005355 | Ga0070671_100211959 | Ga0070671_1002119593 | 155 |
| 212 | 3300005356 | Ga0070674_100014318 | Ga0070674_1000143186 | 155 |
| 213 | 3300005364 | Ga0070673_100556059 | Ga0070673_1005560592 | 155 |
| 214 | 3300005456 | Ga0070678_100055447 | Ga0070678_1000554471 | 155 |
| 215 | 3300005543 | Ga0070672_100145305 | Ga0070672_1001453053 | 155 |
| 216 | 3300005843 | Ga0068860_101374661 | Ga0068860_1013746612 | 155 |
| 217 | 3300006844 | Ga0075428_101312046 | Ga0075428_1013120461 | 155 |
| 218 | 3300025907 | Ga0207645_10031867 | Ga0207645_100318672 | 155 |
| 219 | 3300025918 | Ga0207662_10628244 | Ga0207662_106282441 | 155 |
| 220 | 3300025920 | Ga0207649_10975472 | Ga0207649_109754721 | 155 |
| 221 | 3300025938 | Ga0207704_10516024 | Ga0207704_105160242 | 155 |
| 222 | 3300025940 | Ga0207691_10105136 | Ga0207691_101051363 | 155 |
| 223 | 3300026121 | Ga0207683_10050167 | Ga0207683_100501672 | 155 |
| 224 | 3300005331 | Ga0070670_100153602 | Ga0070670_1001536023 | 156 |
| 225 | 3300005353 | Ga0070669_100697814 | Ga0070669_1006978141 | 156 |
| 226 | 3300005564 | Ga0070664_100073824 | Ga0070664_1000738242 | 156 |
| 227 | 3300005577 | Ga0068857_100793328 | Ga0068857_1007933281 | 156 |
| 228 | 3300009094 | Ga0111539_12355163 | Ga0111539_123551631 | 156 |
| 229 | 3300013296 | Ga0157374_11429566 | Ga0157374_114295661 | 156 |
| 230 | 3300014745 | Ga0157377_10871431 | Ga0157377_108714311 | 156 |
| 231 | 3300025925 | Ga0207650_10180599 | Ga0207650_101805992 | 156 |
| 232 | 3300025931 | Ga0207644_10142810 | Ga0207644_101428103 | 156 |
| 233 | 3300025945 | Ga0207679_10144887 | Ga0207679_101448873 | 156 |
| 234 | 3300025960 | Ga0207651_10917470 | Ga0207651_109174701 | 156 |
| 235 | 3300026023 | Ga0207677_10782441 | Ga0207677_107824411 | 156 |
| 236 | 3300026075 | Ga0207708_10553144 | Ga0207708_105531441 | 156 |
| 237 | 3300026116 | Ga0207674_10390586 | Ga0207674_103905862 | 156 |
| 238 | 3300026118 | Ga0207675_100144745 | Ga0207675_1001447452 | 156 |
| 239 | 3300028380 | Ga0268265_10548459 | Ga0268265_105484591 | 156 |
| 240 | 3300005355 | Ga0070671_100141206 | Ga0070671_1001412062 | 157 |
| 241 | 3300005327 | Ga0070658_10007514 | Ga0070658_100075145 | 158 |
| 242 | 3300013307 | Ga0157372_10520099 | Ga0157372_105200992 | 158 |
| 243 | 3300025909 | Ga0207705_10020568 | Ga0207705_100205684 | 158 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar