F355423

General Info

Members Datasets Scaffolds Average Seq Length
243 147 486 268

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_100426459|Ga0070664_1004264592
Length 289
Sequence MRNTSPRDETTRVDDVGAVAELIEVTDADDPRLADYRDLRDVQLRTHLEAEHGLFLAEGEKVVRRAVEAGFVARSFLMAPRWLDGLADVLGPSDAPCYVVTEALAEQVTGFHVHRGALASLARTVLPDLDDVLEGSRHVLVLEDVVDHTNVGAIFRSGAAFGFDAVLLAPRCADPLYRRSIKVAMGAVFSMPWTRLPDWYDALPDLSARGFTTVALTLADDADPVEQAVAGLDRVALVLGSEGHGLSPRWEGSADRRAVIPMRRGIDSLNVAAATAVACYVVASRPRAS

Samples

Sample ID Description Type Environment
1 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
69 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
70 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
71 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
72 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
73 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
76 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
77 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
78 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
79 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
80 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
81 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
84 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
85 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
86 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
87 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
88 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
89 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
90 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
91 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
92 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
93 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
94 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
109 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
110 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
113 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
114 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
115 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
116 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
117 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
123 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
124 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
125 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
126 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
127 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
128 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
129 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
130 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
132 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
133 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
134 2643221576 Nocardioides sp. Root614 Isolate Unclassified
135 2643221590 Nocardioides sp. Root682 Isolate Unclassified
136 2643221615 Nocardioides sp. Root224 Isolate Unclassified
137 2643221617 Nocardioides sp. Root79 Isolate Unclassified
138 2643221620 Nocardioides sp. Root240 Isolate Unclassified
139 2643221641 Nocardioides sp. Root122 Isolate Unclassified
140 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
141 2738541305 Nocardioides sp. CF167 Isolate Unclassified
142 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
143 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
144 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
145 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
146 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
147 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.42
Metatranscriptomes 0.82
Isolates 5.76

Biome Distribution

Category Percentage (%)
Aerial Root 0.82
Bulb 0
Endosphere 11.11
Nodule 0.41
Rhizoplane 7.41
Rhizosphere 75.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070664_100426459 3300005564 Bacteria 1215
2 JGI24740J21852_10022807 3300001979 Bacteria 2148
3 Ga0070658_10006849 3300005327 Bacteria 9212
4 Ga0070658_10010395 3300005327 Bacteria 7462
5 Ga0070658_10047179 3300005327 Bacteria 3486
6 Ga0070683_100000641 3300005329 Bacteria 25186
7 Ga0070683_100011403 3300005329 Bacteria 7683
8 Ga0070683_100064941 3300005329 Bacteria 3398
9 Ga0070680_100049003 3300005336 Bacteria 3443
10 Ga0070682_100043633 3300005337 Bacteria 2774
11 Ga0068868_100477932 3300005338 Bacteria 1088
12 Ga0070660_100038587 3300005339 Bacteria 3627
13 Ga0070687_100156169 3300005343 Bacteria 1344
14 Ga0070692_10017619 3300005345 Bacteria 3419
15 Ga0070659_100077869 3300005366 Bacteria 2645
16 Ga0070659_100182846 3300005366 Bacteria 1721
17 Ga0070667_100062226 3300005367 Bacteria 3161
18 Ga0070714_100081896 3300005435 Bacteria 2811
19 Ga0070707_100061992 3300005468 Bacteria 3587
20 Ga0070698_100001988 3300005471 Bacteria 22693
21 Ga0070679_100007291 3300005530 Bacteria 10328
22 Ga0070684_100002845 3300005535 Bacteria 12858
23 Ga0070665_100001502 3300005548 Bacteria 27146
24 Ga0068855_100068555 3300005563 Bacteria 4130
25 Ga0068857_100005857 3300005577 Bacteria 10494
26 Ga0068857_100302317 3300005577 Bacteria 1475
27 Ga0068857_100479780 3300005577 Bacteria 1165
28 Ga0068859_100822004 3300005617 Bacteria 1016
29 Ga0068861_100104488 3300005719 Bacteria 2260
30 Ga0075365_10014398 3300006038 Bacteria 4756
31 Ga0075365_10093757 3300006038 Bacteria 2048
32 Ga0075365_10137002 3300006038 Bacteria 1697
33 Ga0075365_10143676 3300006038 Bacteria 1657
34 Ga0075365_10145110 3300006038 Bacteria 1649
35 Ga0075365_10206535 3300006038 Bacteria 1377
36 Ga0075368_10022556 3300006042 Bacteria 2397
37 Ga0075368_10028766 3300006042 Bacteria 2148
38 Ga0075363_100189363 3300006048 Bacteria 1173
39 Ga0075363_100204321 3300006048 Bacteria 1129
40 Ga0097621_100144389 3300006237 Bacteria 2036
41 Ga0068871_100176687 3300006358 Bacteria 1833
42 Ga0097620_100822030 3300006931 Bacteria 1016
43 Ga0105245_10087010 3300009098 Bacteria 2867
44 Ga0105245_10334160 3300009098 Bacteria 1496
45 Ga0105243_10009602 3300009148 Bacteria 7367
46 Ga0105242_10710864 3300009176 Bacteria 984
47 Ga0105239_10213449 3300010375 Bacteria 2163
48 Ga0105239_10435470 3300010375 Bacteria 1486
49 Ga0105246_10182156 3300011119 Bacteria 1618
50 Ga0157369_10062420 3300013105 Bacteria 4015
51 Ga0163162_10032523 3300013306 Bacteria 5182
52 Ga0157372_10003488 3300013307 Bacteria 16951
53 Ga0157372_10305884 3300013307 Bacteria 1850
54 Ga0157372_10337476 3300013307 Bacteria 1755
55 Ga0157375_10215147 3300013308 Bacteria 2079
56 Ga0157375_10261475 3300013308 Bacteria 1892
57 Ga0163163_10020560 3300014325 Bacteria 6220
58 Ga0157380_10274523 3300014326 Bacteria 1539
59 Ga0157377_10098070 3300014745 Bacteria 1741
60 Ga0157379_10114869 3300014968 Bacteria 2420
61 Ga0206353_10076821 3300020082 Bacteria 1763
62 Ga0206353_11793001 3300020082 Bacteria 5245
63 Ga0207647_10031810 3300025904 Bacteria 3393
64 Ga0207647_10056253 3300025904 Bacteria 2414
65 Ga0207705_10041859 3300025909 Bacteria 3287
66 Ga0207707_10024400 3300025912 Bacteria 5291
67 Ga0207657_10016338 3300025919 Bacteria 7161
68 Ga0207657_10105327 3300025919 Bacteria 2335
69 Ga0207652_10310332 3300025921 Bacteria 1424
70 Ga0207646_10212750 3300025922 Bacteria 1746
71 Ga0207687_10014921 3300025927 Bacteria 5089
72 Ga0207690_10157096 3300025932 Bacteria 1691
73 Ga0207690_10394243 3300025932 Bacteria 1103
74 Ga0207704_10223026 3300025938 Bacteria 1396
75 Ga0207661_10047132 3300025944 Bacteria 3420
76 Ga0207661_10088575 3300025944 Bacteria 2573
77 Ga0207661_10217417 3300025944 Bacteria 1687
78 Ga0207661_10513135 3300025944 Bacteria 1096
79 Ga0207712_10118524 3300025961 Bacteria 1998
80 Ga0207678_10016344 3300026067 Bacteria 6515
81 Ga0207702_10249378 3300026078 Bacteria 1667
82 Ga0207674_10001502 3300026116 Bacteria 30105
83 Ga0207674_10363163 3300026116 Bacteria 1400
84 Ga0207675_100213252 3300026118 Bacteria 1858
85 Ga0209813_10007269 3300027866 Bacteria 2755
86 Ga0268266_10025606 3300028379 Bacteria 5018
87 Ga0268266_10309354 3300028379 Bacteria 1476
88 Ga0307407_10009420 3300031903 Bacteria 4550
89 Ga0307412_10029190 3300031911 Bacteria 3460
90 Ga0307409_100014227 3300031995 Bacteria 5163
91 Ga0307409_100083298 3300031995 Bacteria 2593
92 Ga0307409_100258774 3300031995 Bacteria 1596
93 Ga0307416_100256054 3300032002 Bacteria 1707
94 Ga0307415_100000392 3300032126 Bacteria 18594
95 Ga0395898_0397494 3300037466 Bacteria 1314
96 Ga0395905_0044141 3300037471 Bacteria 4183
97 Ga0395901_0061935 3300038443 Bacteria 3893
98 Ga0395901_0662937 3300038443 Bacteria 1045
99 Ga0439445_0011751 3300042004 Bacteria 2092
100 Ga0450907_011737 3300042146 Bacteria 1455
101 Ga0439434_0014175 3300042435 Bacteria 2371
102 Ga0466969_0046217 3300044656 Bacteria 2159
103 Ga0466972_0035547 3300044658 Bacteria 2438
104 Ga0466965_0040336 3300044683 Bacteria 2298
105 Ga0466965_0044685 3300044683 Bacteria 2190
106 Ga0466965_0052627 3300044683 Bacteria 2023
107 Ga0466966_0003626 3300044684 Bacteria 10189
108 Ga0466961_0032213 3300044693 Bacteria 3367
109 Ga0466961_0061782 3300044693 Bacteria 2381
110 Ga0466961_0114856 3300044693 Bacteria 1692
111 Ga0466961_0135909 3300044693 Bacteria 1540
112 Ga0466961_0145730 3300044693 Bacteria 1481
113 Ga0466963_0010538 3300044694 Bacteria 5599
114 Ga0466963_0025379 3300044694 Bacteria 3779
115 Ga0466963_0100999 3300044694 Bacteria 1975
116 Ga0466963_0145785 3300044694 Bacteria 1642
117 Ga0466964_0012516 3300044706 Bacteria 3211
118 Ga0466970_0027052 3300044765 Bacteria 3008
119 Ga0466970_0043208 3300044765 Bacteria 2398
120 Ga0466957_0026695 3300044842 Bacteria 3427
121 Ga0466957_0065961 3300044842 Bacteria 2231
122 Ga0466960_0000222 3300044901 Bacteria 19771
123 Ga0466960_0002943 3300044901 Bacteria 6486
124 Ga0466960_0051584 3300044901 Bacteria 1988
125 Ga0466960_0081575 3300044901 Bacteria 1631
126 Ga0466959_0016320 3300045049 Bacteria 5424
127 Ga0466967_0000340 3300045976 Bacteria 21475
128 Ga0466967_0046457 3300045976 Bacteria 3780
129 Ga0466967_0047423 3300045976 Bacteria 3745
130 Ga0466967_0377699 3300045976 Bacteria 1375
131 Ga0466967_0404497 3300045976 Bacteria 1329
132 Ga0466967_0498771 3300045976 Bacteria 1194
133 Ga0495658_0439735 3300046683 Bacteria 833
134 Ga0496100_0235484 3300048903 Bacteria 1349
135 Ga0496102_0030024 3300048905 Bacteria 4865
136 Ga0496102_0054815 3300048905 Bacteria 3636
137 Ga0496105_0155967 3300048908 Bacteria 1875
138 Ga0496106_0186393 3300048909 Bacteria 1648
139 Ga0496106_0215245 3300048909 Bacteria 1531
140 Ga0496108_0062472 3300048911 Bacteria 3136
141 Ga0496108_0087771 3300048911 Bacteria 2642
142 Ga0496109_0035443 3300048912 Bacteria 4501
143 Ga0496109_0089463 3300048912 Bacteria 2846
144 Ga0496109_0167243 3300048912 Bacteria 2062
145 Ga0496110_0082270 3300048913 Bacteria 2871
146 Ga0496110_0145725 3300048913 Bacteria 2142
147 Ga0496111_0229961 3300048914 Bacteria 1377
148 Ga0496113_0192508 3300048916 Bacteria 1619
149 Ga0496114_0052576 3300048917 Bacteria 3394
150 Ga0496114_0121745 3300048917 Bacteria 2244
151 Ga0496114_0394251 3300048917 Bacteria 1226
152 Ga0501031_0037813 3300049568 Bacteria 3150
153 Ga0501031_0387355 3300049568 Bacteria 904
154 Ga0501032_0057568 3300049569 Bacteria 2612
155 Ga0501033_0361690 3300049570 Bacteria 1015
156 Ga0501034_0044639 3300049571 Bacteria 4481
157 Ga0501034_0138633 3300049571 Bacteria 2413
158 Ga0501034_0178898 3300049571 Bacteria 2086
159 Ga0501036_0010256 3300049572 Bacteria 7728
160 Ga0501036_0165765 3300049572 Bacteria 1862
161 Ga0501037_0002911 3300049573 Bacteria 12414
162 Ga0501038_0041595 3300049574 Bacteria 4007
163 Ga0501039_0029149 3300049575 Bacteria 4250
164 Ga0501039_0577876 3300049575 Bacteria 881
165 Ga0501040_0233258 3300049576 Bacteria 1311
166 Ga0501042_0020767 3300049578 Bacteria 4572
167 Ga0501043_0009280 3300049579 Bacteria 7731
168 Ga0501043_0388545 3300049579 Bacteria 1056
169 Ga0501046_0011157 3300049580 Bacteria 7697
170 Ga0501046_0422489 3300049580 Bacteria 961
171 Ga0501047_0337092 3300049581 Bacteria 1346
172 Ga0501048_0110070 3300049582 Bacteria 1945
173 Ga0501048_0371447 3300049582 Bacteria 1021
174 Ga0501067_0006105 3300049583 Bacteria 6680
175 Ga0501068_0021533 3300049584 Bacteria 3764
176 Ga0501068_0027432 3300049584 Bacteria 3362
177 Ga0501069_0017813 3300049585 Bacteria 3830
178 Ga0501069_0039353 3300049585 Bacteria 2612
179 Ga0501070_0001128 3300049586 Bacteria 23951
180 Ga0501070_0014590 3300049586 Bacteria 6612
181 Ga0501070_0023090 3300049586 Bacteria 5209
182 Ga0501070_0195064 3300049586 Bacteria 1663
183 Ga0501070_0323561 3300049586 Bacteria 1254
184 Ga0501071_0567440 3300049587 Bacteria 872
185 Ga0501072_0027742 3300049588 Bacteria 4417
186 Ga0501072_0032045 3300049588 Bacteria 4115
187 Ga0501072_0185205 3300049588 Bacteria 1661
188 Ga0501073_0005104 3300049589 Bacteria 9845
189 Ga0501073_0044863 3300049589 Bacteria 3116
190 Ga0501073_0050276 3300049589 Bacteria 2922
191 Ga0501074_0004203 3300049590 Bacteria 10289
192 Ga0501074_0007354 3300049590 Bacteria 7963
193 Ga0501074_0045902 3300049590 Bacteria 3160
194 Ga0501074_0237169 3300049590 Bacteria 1298
195 Ga0501074_0268844 3300049590 Bacteria 1212
196 Ga0501077_0039165 3300049593 Bacteria 3018
197 Ga0501079_0049907 3300049741 Bacteria 3230
198 Ga0501079_0129990 3300049741 Bacteria 1959
199 Ga0501080_0003998 3300049742 Bacteria 13053
200 Ga0501080_0011811 3300049742 Bacteria 8002
201 Ga0501080_0096080 3300049742 Bacteria 2751
202 Ga0501083_0015295 3300049744 Bacteria 5374
203 Ga0501083_0028931 3300049744 Bacteria 3816
204 Ga0501035_0040061 3300049822 Bacteria 4236
205 Ga0501044_0084886 3300049823 Bacteria 3199
206 Ga0501045_0061686 3300049824 Bacteria 2751
207 Ga0501045_0099224 3300049824 Bacteria 2155
208 nmdc:mga00v17_11327_c1 3300050491 Bacteria 4902
209 nmdc:mga00v17_18568_c1 3300050491 Bacteria 3953
210 nmdc:mga00v17_54084_c1 3300050491 Bacteria 2448
211 nmdc:mga00v17_60033_c1 3300050491 Bacteria 2334
212 nmdc:mga0yw44_109706_c2 3300050492 Bacteria 1406
213 nmdc:mga0yw44_175557_c1 3300050492 Bacteria 1408
214 nmdc:mga0yw44_21975_c1 3300050492 Bacteria 3569
215 nmdc:mga0yw44_24219_c1 3300050492 Bacteria 3432
216 nmdc:mga0yw44_2650_c1 3300050492 Bacteria 7708
217 nmdc:mga0yw44_342336_c1 3300050492 Bacteria 1006
218 nmdc:mga0yw44_63318_c1 3300050492 Bacteria 2274
219 nmdc:mga0yw44_69298_c1 3300050492 Bacteria 2184
220 nmdc:mga04h51_8908_c1 3300050495 Bacteria 2699
221 Ga0495595_0119679 3300053084 Bacteria 1282
222 Ga0500644_0035886 3300053088 Bacteria 1610
223 Ga0500593_000263 3300053117 Bacteria 21458
224 Ga0500573_0005554 3300053140 Bacteria 6761
225 Ga0501084_0013369 3300054114 Bacteria 6791
226 Ga0501084_0095083 3300054114 Bacteria 2502
227 Ga0501082_0242873 3300060353 Bacteria 1567
228 Ga0466962_0047541 3300061719 Bacteria 2050
229 Ga0530510_0216302 3300061734 Bacteria 1424
230 2643893586 2643221576 Bacteria 5214352
231 2643962636 2643221590 Bacteria 5214697
232 2644089076 2643221615 Bacteria 5487866
233 2644101833 2643221617 Bacteria 5139111
234 2644115895 2643221620 Bacteria 5134593
235 2644232261 2643221641 Bacteria 4490190
236 2644318921 2643221657 Bacteria 5490246
237 2738868313 2738541305 Bacteria 4910150
238 2812332751 2811994874 Bacteria 5367947
239 2855387160 2855386786 Bacteria 4752232
240 2857482514 2857481737 Bacteria 4761446
241 2984580199 2984576629 Bacteria 4248407
242 2990259049 2990256926 Bacteria 4252839
243 8054612972 8054609563 Bacteria 5170090
244 Ga0070664_100426459
245 JGI24740J21852_10022807
246 Ga0070658_10006849
247 Ga0070658_10010395
248 Ga0070658_10047179
249 Ga0070683_100000641
250 Ga0070683_100011403
251 Ga0070683_100064941
252 Ga0070680_100049003
253 Ga0070682_100043633
254 Ga0068868_100477932
255 Ga0070660_100038587
256 Ga0070687_100156169
257 Ga0070692_10017619
258 Ga0070659_100077869
259 Ga0070659_100182846
260 Ga0070667_100062226
261 Ga0070714_100081896
262 Ga0070707_100061992
263 Ga0070698_100001988
264 Ga0070679_100007291
265 Ga0070684_100002845
266 Ga0070665_100001502
267 Ga0068855_100068555
268 Ga0068857_100005857
269 Ga0068857_100302317
270 Ga0068857_100479780
271 Ga0068859_100822004
272 Ga0068861_100104488
273 Ga0075365_10014398
274 Ga0075365_10093757
275 Ga0075365_10137002
276 Ga0075365_10143676
277 Ga0075365_10145110
278 Ga0075365_10206535
279 Ga0075368_10022556
280 Ga0075368_10028766
281 Ga0075363_100189363
282 Ga0075363_100204321
283 Ga0097621_100144389
284 Ga0068871_100176687
285 Ga0097620_100822030
286 Ga0105245_10087010
287 Ga0105245_10334160
288 Ga0105243_10009602
289 Ga0105242_10710864
290 Ga0105239_10213449
291 Ga0105239_10435470
292 Ga0105246_10182156
293 Ga0157369_10062420
294 Ga0163162_10032523
295 Ga0157372_10003488
296 Ga0157372_10305884
297 Ga0157372_10337476
298 Ga0157375_10215147
299 Ga0157375_10261475
300 Ga0163163_10020560
301 Ga0157380_10274523
302 Ga0157377_10098070
303 Ga0157379_10114869
304 Ga0206353_10076821
305 Ga0206353_11793001
306 Ga0207647_10031810
307 Ga0207647_10056253
308 Ga0207705_10041859
309 Ga0207707_10024400
310 Ga0207657_10016338
311 Ga0207657_10105327
312 Ga0207652_10310332
313 Ga0207646_10212750
314 Ga0207687_10014921
315 Ga0207690_10157096
316 Ga0207690_10394243
317 Ga0207704_10223026
318 Ga0207661_10047132
319 Ga0207661_10088575
320 Ga0207661_10217417
321 Ga0207661_10513135
322 Ga0207712_10118524
323 Ga0207678_10016344
324 Ga0207702_10249378
325 Ga0207674_10001502
326 Ga0207674_10363163
327 Ga0207675_100213252
328 Ga0209813_10007269
329 Ga0268266_10025606
330 Ga0268266_10309354
331 Ga0307407_10009420
332 Ga0307412_10029190
333 Ga0307409_100014227
334 Ga0307409_100083298
335 Ga0307409_100258774
336 Ga0307416_100256054
337 Ga0307415_100000392
338 Ga0395898_0397494
339 Ga0395905_0044141
340 Ga0395901_0061935
341 Ga0395901_0662937
342 Ga0439445_0011751
343 Ga0450907_011737
344 Ga0439434_0014175
345 Ga0466969_0046217
346 Ga0466972_0035547
347 Ga0466965_0040336
348 Ga0466965_0044685
349 Ga0466965_0052627
350 Ga0466966_0003626
351 Ga0466961_0032213
352 Ga0466961_0061782
353 Ga0466961_0114856
354 Ga0466961_0135909
355 Ga0466961_0145730
356 Ga0466963_0010538
357 Ga0466963_0025379
358 Ga0466963_0100999
359 Ga0466963_0145785
360 Ga0466964_0012516
361 Ga0466970_0027052
362 Ga0466970_0043208
363 Ga0466957_0026695
364 Ga0466957_0065961
365 Ga0466960_0000222
366 Ga0466960_0002943
367 Ga0466960_0051584
368 Ga0466960_0081575
369 Ga0466959_0016320
370 Ga0466967_0000340
371 Ga0466967_0046457
372 Ga0466967_0047423
373 Ga0466967_0377699
374 Ga0466967_0404497
375 Ga0466967_0498771
376 Ga0495658_0439735
377 Ga0496100_0235484
378 Ga0496102_0030024
379 Ga0496102_0054815
380 Ga0496105_0155967
381 Ga0496106_0186393
382 Ga0496106_0215245
383 Ga0496108_0062472
384 Ga0496108_0087771
385 Ga0496109_0035443
386 Ga0496109_0089463
387 Ga0496109_0167243
388 Ga0496110_0082270
389 Ga0496110_0145725
390 Ga0496111_0229961
391 Ga0496113_0192508
392 Ga0496114_0052576
393 Ga0496114_0121745
394 Ga0496114_0394251
395 Ga0501031_0037813
396 Ga0501031_0387355
397 Ga0501032_0057568
398 Ga0501033_0361690
399 Ga0501034_0044639
400 Ga0501034_0138633
401 Ga0501034_0178898
402 Ga0501036_0010256
403 Ga0501036_0165765
404 Ga0501037_0002911
405 Ga0501038_0041595
406 Ga0501039_0029149
407 Ga0501039_0577876
408 Ga0501040_0233258
409 Ga0501042_0020767
410 Ga0501043_0009280
411 Ga0501043_0388545
412 Ga0501046_0011157
413 Ga0501046_0422489
414 Ga0501047_0337092
415 Ga0501048_0110070
416 Ga0501048_0371447
417 Ga0501067_0006105
418 Ga0501068_0021533
419 Ga0501068_0027432
420 Ga0501069_0017813
421 Ga0501069_0039353
422 Ga0501070_0001128
423 Ga0501070_0014590
424 Ga0501070_0023090
425 Ga0501070_0195064
426 Ga0501070_0323561
427 Ga0501071_0567440
428 Ga0501072_0027742
429 Ga0501072_0032045
430 Ga0501072_0185205
431 Ga0501073_0005104
432 Ga0501073_0044863
433 Ga0501073_0050276
434 Ga0501074_0004203
435 Ga0501074_0007354
436 Ga0501074_0045902
437 Ga0501074_0237169
438 Ga0501074_0268844
439 Ga0501077_0039165
440 Ga0501079_0049907
441 Ga0501079_0129990
442 Ga0501080_0003998
443 Ga0501080_0011811
444 Ga0501080_0096080
445 Ga0501083_0015295
446 Ga0501083_0028931
447 Ga0501035_0040061
448 Ga0501044_0084886
449 Ga0501045_0061686
450 Ga0501045_0099224
451 nmdc:mga00v17_11327_c1
452 nmdc:mga00v17_18568_c1
453 nmdc:mga00v17_54084_c1
454 nmdc:mga00v17_60033_c1
455 nmdc:mga0yw44_109706_c2
456 nmdc:mga0yw44_175557_c1
457 nmdc:mga0yw44_21975_c1
458 nmdc:mga0yw44_24219_c1
459 nmdc:mga0yw44_2650_c1
460 nmdc:mga0yw44_342336_c1
461 nmdc:mga0yw44_63318_c1
462 nmdc:mga0yw44_69298_c1
463 nmdc:mga04h51_8908_c1
464 Ga0495595_0119679
465 Ga0500644_0035886
466 Ga0500593_000263
467 Ga0500573_0005554
468 Ga0501084_0013369
469 Ga0501084_0095083
470 Ga0501082_0242873
471 Ga0466962_0047541
472 Ga0530510_0216302
473 2643893586
474 2643962636
475 2644089076
476 2644101833
477 2644115895
478 2644232261
479 2644318921
480 2738868313
481 2812332751
482 2855387160
483 2857482514
484 2984580199
485 2990259049
486 8054612972

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

137

280

0.94

PF22435

MRM3-like_sub_bind

MRM3-like substrate binding domain

31

127

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gz0-assembly4.cif.gz_E 23s ribosomal rna g2251 2'o-methyltransferase rlmb 0.9023 111 268
4x3m-assembly1.cif.gz_B crystal structure of ttha0275 from thermus thermophilus (hb8) in complex with adenosine in space group p212121 0.8926 5 266
1zjr-assembly1.cif.gz_A crystal structure of a. aeolicus trmh/spou trna modifying enzyme 0.8793 118 267
7qiu-assembly1.cif.gz_B ysga 23s rna methyltransferase from bacillus subtilis 0.8747 3 265
5l0z-assembly1.cif.gz_B crystal structure of adomet bound rrna methyltransferase from sinorhizobium meliloti 0.8737 2 266
ID Description Score Start End Superfamily
af_P9WFY3_121_283_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9577 110 266 3.40.1280.10
af_P9WFY3_121_283_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9181 110 266 3.40.1280.10
af_P94978_97_258_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9149 109 266 3.40.1280.10
af_P9WFY5_148_322_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9148 112 267 3.40.1280.10
1gz0F02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9044 111 268 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A022M7G2-F1-model_v4 Uroporphyrin-III C-methyltransferase 0.9789 1 266 GO:0003723
GO:0004851
GO:0006396
GO:0008173
GO:0009236
GO:0016829
GO:0019354
GO:0032259
GO:0043115
AF-A0A542G9A9-F1-model_v4 tRNA G18 (Ribose-2'-O)-methylase SpoU 0.9739 3 264 GO:0003723
GO:0006396
GO:0008173
GO:0032259
AF-A0A0P7GK08-F1-model_v4 rRNA methyltransferase 0.9739 3 264 GO:0003723
GO:0006396
GO:0008173
GO:0032259
AF-A0A1E5KJP0-F1-model_v4 deleted 0.9715 3 264
AF-A0A3Q9WLZ7-F1-model_v4 rRNA methyltransferase 0.9682 35 247 GO:0003723
GO:0006396
GO:0008173
GO:0032259

Map