F355357
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 243 | 127 | 243 | 309 |
Family's Representative Sequence
| Representative Sequence | 3300005406|Ga0070703_10000205|Ga0070703_100002054 |
| Length | 355 |
| Sequence | MHMAATTKKRELDLKDFPPGTVTEFTTLVCLACIFDIFTKQLGLAPRTAFSEIKRHTPTTEELTSRSAMRPYFDSEEKHPHCPYCGAAKRWHARFDTYCVEGGKSTDAARRALIKKLPTADQFIVVEKKSDSRAVLFEWLDTLGLNLDLSDERWLLDATRNYLERREPKTNWEEVFEQVRVVRRSSRLTEGWERDGARLFLAPKIYGEAILIQYLVSRSHAHGGLTLEGRLTLMELIRRLRYIGYLDQIGITEREPGEVFEKLIDHLAATHDWSRVSVASGSVKGKGVSTGSDRVGRSKKIGKKASKIASQSRKSKAAVQPEPDEIITEPVKLYYLIDRRDFLEKAKSVYASYLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 44 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 49 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 50 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 51 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 108 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 111 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 112 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 113 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 114 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 117 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 118 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 119 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 120 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 121 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 122 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 123 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 124 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 125 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 126 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 127 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.06 |
| Rhizosphere | 97.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1000001 | 3300002074 | Bacteria | 444271 |
| 2 | JGI24034J26672_10000001 | 3300002239 | Bacteria | 1118280 |
| 3 | Ga0065715_10114094 | 3300005293 | Bacteria | 2463 |
| 4 | Ga0070690_100013689 | 3300005330 | Bacteria | 4801 |
| 5 | Ga0068869_100027720 | 3300005334 | Bacteria | 3952 |
| 6 | Ga0068869_100092991 | 3300005334 | Bacteria | 2271 |
| 7 | Ga0070666_10166506 | 3300005335 | Unclassified | 1542 |
| 8 | Ga0070680_100147500 | 3300005336 | Bacteria | 1974 |
| 9 | Ga0068868_100037098 | 3300005338 | Bacteria | 3777 |
| 10 | Ga0068868_100072812 | 3300005338 | Bacteria | 2742 |
| 11 | Ga0068868_100338955 | 3300005338 | Bacteria | 1285 |
| 12 | Ga0070689_100122404 | 3300005340 | Bacteria | 2079 |
| 13 | Ga0070689_100292542 | 3300005340 | Bacteria | 1354 |
| 14 | Ga0070689_100298267 | 3300005340 | Unclassified | 1341 |
| 15 | Ga0070668_100000259 | 3300005347 | Bacteria | 35153 |
| 16 | Ga0070668_100397470 | 3300005347 | Unclassified | 1176 |
| 17 | Ga0070675_100055867 | 3300005354 | Bacteria | 3251 |
| 18 | Ga0070671_100572961 | 3300005355 | Bacteria | 974 |
| 19 | Ga0070673_100015372 | 3300005364 | Bacteria | 5374 |
| 20 | Ga0070673_100259968 | 3300005364 | Unclassified | 1516 |
| 21 | Ga0070667_100023107 | 3300005367 | Bacteria | 5157 |
| 22 | Ga0070703_10000205 | 3300005406 | Bacteria | 28472 |
| 23 | Ga0070709_10038177 | 3300005434 | Bacteria | 2939 |
| 24 | Ga0070700_100006731 | 3300005441 | Bacteria | 6156 |
| 25 | Ga0070694_100008993 | 3300005444 | Bacteria | 6119 |
| 26 | Ga0070694_100052731 | 3300005444 | Bacteria | 2750 |
| 27 | Ga0070694_100090313 | 3300005444 | Unclassified | 2148 |
| 28 | Ga0070708_100029340 | 3300005445 | Bacteria | 4743 |
| 29 | Ga0070708_100394923 | 3300005445 | Bacteria | 1304 |
| 30 | Ga0070662_100024326 | 3300005457 | Unclassified | 4171 |
| 31 | Ga0070681_10000475 | 3300005458 | Bacteria | 32749 |
| 32 | Ga0070706_100007569 | 3300005467 | Bacteria | 10172 |
| 33 | Ga0070706_100044250 | 3300005467 | Bacteria | 4112 |
| 34 | Ga0070706_100067101 | 3300005467 | Bacteria | 3318 |
| 35 | Ga0070706_100092237 | 3300005467 | Bacteria | 2810 |
| 36 | Ga0070707_100000107 | 3300005468 | Bacteria | 76101 |
| 37 | Ga0070707_100029270 | 3300005468 | Bacteria | 5244 |
| 38 | Ga0070707_100031352 | 3300005468 | Bacteria | 5063 |
| 39 | Ga0070707_100036757 | 3300005468 | Bacteria | 4673 |
| 40 | Ga0070707_100046298 | 3300005468 | Bacteria | 4163 |
| 41 | Ga0070707_100145826 | 3300005468 | Bacteria | 2304 |
| 42 | Ga0070698_100000063 | 3300005471 | Bacteria | 78062 |
| 43 | Ga0070698_100060748 | 3300005471 | Bacteria | 3813 |
| 44 | Ga0070698_100061857 | 3300005471 | Bacteria | 3778 |
| 45 | Ga0070698_100153730 | 3300005471 | Bacteria | 2247 |
| 46 | Ga0070698_100168825 | 3300005471 | Unclassified | 2129 |
| 47 | Ga0070699_100003797 | 3300005518 | Bacteria | 13349 |
| 48 | Ga0070679_100000307 | 3300005530 | Bacteria | 41692 |
| 49 | Ga0070697_100019460 | 3300005536 | Bacteria | 5362 |
| 50 | Ga0070697_100069034 | 3300005536 | Bacteria | 2894 |
| 51 | Ga0070686_100075449 | 3300005544 | Unclassified | 2218 |
| 52 | Ga0070686_100323017 | 3300005544 | Unclassified | 1151 |
| 53 | Ga0070696_100031104 | 3300005546 | Bacteria | 3657 |
| 54 | Ga0070696_100077036 | 3300005546 | Bacteria | 2355 |
| 55 | Ga0070696_100095141 | 3300005546 | Unclassified | 2127 |
| 56 | Ga0070696_100532008 | 3300005546 | Unclassified | 939 |
| 57 | Ga0070693_100244737 | 3300005547 | Unclassified | 1186 |
| 58 | Ga0070665_100061757 | 3300005548 | Bacteria | 3757 |
| 59 | Ga0070704_100018552 | 3300005549 | Bacteria | 4451 |
| 60 | Ga0070704_100089311 | 3300005549 | Bacteria | 2292 |
| 61 | Ga0070704_100233854 | 3300005549 | Unclassified | 1501 |
| 62 | Ga0070664_100063145 | 3300005564 | Bacteria | 3158 |
| 63 | Ga0068852_100439277 | 3300005616 | Unclassified | 1290 |
| 64 | Ga0068859_100071425 | 3300005617 | Bacteria | 3507 |
| 65 | Ga0068859_100158006 | 3300005617 | Bacteria | 2345 |
| 66 | Ga0068859_100851824 | 3300005617 | Unclassified | 998 |
| 67 | Ga0068864_100038112 | 3300005618 | Bacteria | 4103 |
| 68 | Ga0068864_100050872 | 3300005618 | Bacteria | 3567 |
| 69 | Ga0068864_100140316 | 3300005618 | Bacteria | 2179 |
| 70 | Ga0068864_100188215 | 3300005618 | Bacteria | 1891 |
| 71 | Ga0068861_100406770 | 3300005719 | Unclassified | 1209 |
| 72 | Ga0068851_10147228 | 3300005834 | Bacteria | 1285 |
| 73 | Ga0068863_100599780 | 3300005841 | Bacteria | 1090 |
| 74 | Ga0068858_100000044 | 3300005842 | Bacteria | 128977 |
| 75 | Ga0068858_100006421 | 3300005842 | Bacteria | 11452 |
| 76 | Ga0068858_100016372 | 3300005842 | Bacteria | 6963 |
| 77 | Ga0068858_100123909 | 3300005842 | Bacteria | 2419 |
| 78 | Ga0068860_100033131 | 3300005843 | Bacteria | 4959 |
| 79 | Ga0068860_100061529 | 3300005843 | Bacteria | 3567 |
| 80 | Ga0068860_100105342 | 3300005843 | Unclassified | 2693 |
| 81 | Ga0068862_100145807 | 3300005844 | Bacteria | 2104 |
| 82 | Ga0068862_100236890 | 3300005844 | Unclassified | 1658 |
| 83 | Ga0081539_10000731 | 3300005985 | Bacteria | 65764 |
| 84 | Ga0070715_10000002 | 3300006163 | Bacteria | 389554 |
| 85 | Ga0070716_100000004 | 3300006173 | Bacteria | 296614 |
| 86 | Ga0097621_100012853 | 3300006237 | Bacteria | 6219 |
| 87 | Ga0097621_100377352 | 3300006237 | Bacteria | 1266 |
| 88 | Ga0068871_100024574 | 3300006358 | Bacteria | 4674 |
| 89 | Ga0075433_10090137 | 3300006852 | Bacteria | 2710 |
| 90 | Ga0075433_10102818 | 3300006852 | Bacteria | 2531 |
| 91 | Ga0075434_100019279 | 3300006871 | Bacteria | 6599 |
| 92 | Ga0075429_100229787 | 3300006880 | Bacteria | 1625 |
| 93 | Ga0075436_100000002 | 3300006914 | Bacteria | 475522 |
| 94 | Ga0097620_100071422 | 3300006931 | Bacteria | 3507 |
| 95 | Ga0097620_100158016 | 3300006931 | Bacteria | 2345 |
| 96 | Ga0097620_100851841 | 3300006931 | Unclassified | 998 |
| 97 | Ga0075435_100002379 | 3300007076 | Bacteria | 12471 |
| 98 | Ga0075435_100231807 | 3300007076 | Bacteria | 1569 |
| 99 | Ga0111539_10052020 | 3300009094 | Bacteria | 4877 |
| 100 | Ga0111539_10076885 | 3300009094 | Bacteria | 3930 |
| 101 | Ga0111539_10107550 | 3300009094 | Bacteria | 3273 |
| 102 | Ga0111539_10191061 | 3300009094 | Bacteria | 2389 |
| 103 | Ga0105245_10074425 | 3300009098 | Bacteria | 3091 |
| 104 | Ga0105247_10000004 | 3300009101 | Bacteria | 455497 |
| 105 | Ga0114129_10217804 | 3300009147 | Bacteria | 2577 |
| 106 | Ga0114129_10589460 | 3300009147 | Bacteria | 1442 |
| 107 | Ga0114129_10628232 | 3300009147 | Viruses | 1388 |
| 108 | Ga0105243_10000037 | 3300009148 | Bacteria | 175237 |
| 109 | Ga0105243_10000240 | 3300009148 | Bacteria | 62821 |
| 110 | Ga0105243_10022998 | 3300009148 | Bacteria | 4741 |
| 111 | Ga0105243_10090322 | 3300009148 | Bacteria | 2520 |
| 112 | Ga0105242_10000276 | 3300009176 | Bacteria | 40893 |
| 113 | Ga0105242_10001016 | 3300009176 | Bacteria | 22045 |
| 114 | Ga0105242_10006789 | 3300009176 | Bacteria | 8825 |
| 115 | Ga0105242_10215927 | 3300009176 | Bacteria | 1711 |
| 116 | Ga0105242_10447527 | 3300009176 | Unclassified | 1217 |
| 117 | Ga0105242_10687305 | 3300009176 | Unclassified | 999 |
| 118 | Ga0105248_10044864 | 3300009177 | Bacteria | 4958 |
| 119 | Ga0105248_10127647 | 3300009177 | Bacteria | 2869 |
| 120 | Ga0105249_10000044 | 3300009553 | Bacteria | 184637 |
| 121 | Ga0105249_10050497 | 3300009553 | Unclassified | 3792 |
| 122 | Ga0105249_10097941 | 3300009553 | Bacteria | 2754 |
| 123 | Ga0105249_10172749 | 3300009553 | Unclassified | 2097 |
| 124 | Ga0105249_10311925 | 3300009553 | Bacteria | 1582 |
| 125 | Ga0105249_10669192 | 3300009553 | Unclassified | 1097 |
| 126 | Ga0105239_10099128 | 3300010375 | Unclassified | 3221 |
| 127 | Ga0105239_10672613 | 3300010375 | Bacteria | 1183 |
| 128 | Ga0105246_10209604 | 3300011119 | Bacteria | 1520 |
| 129 | Ga0105246_10252722 | 3300011119 | Bacteria | 1400 |
| 130 | Ga0157378_10000025 | 3300013297 | Bacteria | 128568 |
| 131 | Ga0157378_10005669 | 3300013297 | Bacteria | 10924 |
| 132 | Ga0157378_10012428 | 3300013297 | Bacteria | 7456 |
| 133 | Ga0157378_10076124 | 3300013297 | Bacteria | 3023 |
| 134 | Ga0157378_10086881 | 3300013297 | Bacteria | 2836 |
| 135 | Ga0157378_10158161 | 3300013297 | Bacteria | 2117 |
| 136 | Ga0157378_10333979 | 3300013297 | Bacteria | 1476 |
| 137 | Ga0157378_10394241 | 3300013297 | Unclassified | 1362 |
| 138 | Ga0157378_10482279 | 3300013297 | Unclassified | 1236 |
| 139 | Ga0157378_10698955 | 3300013297 | Unclassified | 1033 |
| 140 | Ga0163162_10000025 | 3300013306 | Bacteria | 184648 |
| 141 | Ga0163162_10017938 | 3300013306 | Bacteria | 6926 |
| 142 | Ga0163162_10064052 | 3300013306 | Bacteria | 3721 |
| 143 | Ga0163162_10242321 | 3300013306 | Bacteria | 1934 |
| 144 | Ga0157375_10025809 | 3300013308 | Bacteria | 5466 |
| 145 | Ga0157375_10031747 | 3300013308 | Bacteria | 5000 |
| 146 | Ga0157375_10039172 | 3300013308 | Bacteria | 4559 |
| 147 | Ga0157375_10218454 | 3300013308 | Bacteria | 2064 |
| 148 | Ga0157375_10800167 | 3300013308 | Unclassified | 1091 |
| 149 | Ga0163163_10018259 | 3300014325 | Bacteria | 6561 |
| 150 | Ga0163163_10052858 | 3300014325 | Bacteria | 4009 |
| 151 | Ga0157380_10019091 | 3300014326 | Bacteria | 5104 |
| 152 | Ga0157380_10021627 | 3300014326 | Bacteria | 4828 |
| 153 | Ga0157380_10070657 | 3300014326 | Bacteria | 2821 |
| 154 | Ga0157379_10043304 | 3300014968 | Unclassified | 4019 |
| 155 | Ga0157379_10403613 | 3300014968 | Bacteria | 1257 |
| 156 | Ga0157376_10018281 | 3300014969 | Bacteria | 5369 |
| 157 | Ga0163161_10292474 | 3300017792 | Unclassified | 1281 |
| 158 | Ga0207672_1000249 | 3300025223 | Bacteria | 7440 |
| 159 | Ga0207653_10000209 | 3300025885 | Bacteria | 39477 |
| 160 | Ga0207653_10022003 | 3300025885 | Bacteria | 2024 |
| 161 | Ga0207710_10000002 | 3300025900 | Bacteria | 1251998 |
| 162 | Ga0207685_10000002 | 3300025905 | Bacteria | 438088 |
| 163 | Ga0207699_10146249 | 3300025906 | Bacteria | 1558 |
| 164 | Ga0207684_10017245 | 3300025910 | Bacteria | 6194 |
| 165 | Ga0207684_10060624 | 3300025910 | Bacteria | 3213 |
| 166 | Ga0207654_10267708 | 3300025911 | Bacteria | 1151 |
| 167 | Ga0207707_10000006 | 3300025912 | Bacteria | 374131 |
| 168 | Ga0207671_10469200 | 3300025914 | Unclassified | 1003 |
| 169 | Ga0207660_10001704 | 3300025917 | Bacteria | 14738 |
| 170 | Ga0207660_10034690 | 3300025917 | Bacteria | 3498 |
| 171 | Ga0207652_10000216 | 3300025921 | Bacteria | 61049 |
| 172 | Ga0207646_10000543 | 3300025922 | Bacteria | 49799 |
| 173 | Ga0207646_10015280 | 3300025922 | Bacteria | 7260 |
| 174 | Ga0207646_10033595 | 3300025922 | Bacteria | 4639 |
| 175 | Ga0207646_10151329 | 3300025922 | Bacteria | 2093 |
| 176 | Ga0207646_10288302 | 3300025922 | Bacteria | 1483 |
| 177 | Ga0207681_10033484 | 3300025923 | Bacteria | 3369 |
| 178 | Ga0207659_10184664 | 3300025926 | Bacteria | 1655 |
| 179 | Ga0207644_10000623 | 3300025931 | Bacteria | 22562 |
| 180 | Ga0207644_10056356 | 3300025931 | Bacteria | 2836 |
| 181 | Ga0207706_10038400 | 3300025933 | Unclassified | 4248 |
| 182 | Ga0207686_10000003 | 3300025934 | Bacteria | 376934 |
| 183 | Ga0207686_10000127 | 3300025934 | Bacteria | 61880 |
| 184 | Ga0207686_10000925 | 3300025934 | Bacteria | 17584 |
| 185 | Ga0207709_10000017 | 3300025935 | Bacteria | 470753 |
| 186 | Ga0207709_10000884 | 3300025935 | Bacteria | 22669 |
| 187 | Ga0207709_10026481 | 3300025935 | Unclassified | 3332 |
| 188 | Ga0207709_10073695 | 3300025935 | Bacteria | 2176 |
| 189 | Ga0207709_10290143 | 3300025935 | Bacteria | 1212 |
| 190 | Ga0207704_10117221 | 3300025938 | Bacteria | 1814 |
| 191 | Ga0207665_10000006 | 3300025939 | Bacteria | 184957 |
| 192 | Ga0207691_10102105 | 3300025940 | Bacteria | 2559 |
| 193 | Ga0207711_10118215 | 3300025941 | Bacteria | 2365 |
| 194 | Ga0207689_10010385 | 3300025942 | Bacteria | 8020 |
| 195 | Ga0207679_10064961 | 3300025945 | Bacteria | 2729 |
| 196 | Ga0207651_10050554 | 3300025960 | Bacteria | 2823 |
| 197 | Ga0207712_10000039 | 3300025961 | Bacteria | 182548 |
| 198 | Ga0207712_10017673 | 3300025961 | Bacteria | 4636 |
| 199 | Ga0207668_10000519 | 3300025972 | Bacteria | 24141 |
| 200 | Ga0207640_10507540 | 3300025981 | Bacteria | 1005 |
| 201 | Ga0207658_10102453 | 3300025986 | Bacteria | 2245 |
| 202 | Ga0207677_10029389 | 3300026023 | Bacteria | 3492 |
| 203 | Ga0207677_10230367 | 3300026023 | Bacteria | 1492 |
| 204 | Ga0207677_10260962 | 3300026023 | Bacteria | 1412 |
| 205 | Ga0207703_10000032 | 3300026035 | Bacteria | 188472 |
| 206 | Ga0207703_10077991 | 3300026035 | Unclassified | 2751 |
| 207 | Ga0207703_10251160 | 3300026035 | Bacteria | 1594 |
| 208 | Ga0207708_10011413 | 3300026075 | Bacteria | 6616 |
| 209 | Ga0207676_10007015 | 3300026095 | Bacteria | 7981 |
| 210 | Ga0207676_10095428 | 3300026095 | Bacteria | 2452 |
| 211 | Ga0207675_100024694 | 3300026118 | Bacteria | 5589 |
| 212 | Ga0207698_10130850 | 3300026142 | Unclassified | 2144 |
| 213 | Ga0207428_10013055 | 3300027907 | Bacteria | 7275 |
| 214 | Ga0207428_10046223 | 3300027907 | Bacteria | 3501 |
| 215 | Ga0268265_10203535 | 3300028380 | Unclassified | 1719 |
| 216 | Ga0268264_10017789 | 3300028381 | Bacteria | 5818 |
| 217 | Ga0268264_10253117 | 3300028381 | Bacteria | 1637 |
| 218 | Ga0268264_10272600 | 3300028381 | Unclassified | 1581 |
| 219 | Ga0307513_10005443 | 3300031456 | Bacteria | 16822 |
| 220 | Ga0395905_0273053 | 3300037471 | Bacteria | 1577 |
| 221 | Ga0395901_0102149 | 3300038443 | Bacteria | 3009 |
| 222 | Ga0451576_0022354 | 3300045051 | Bacteria | 6859 |
| 223 | Ga0495664_0026020 | 3300046477 | Bacteria | 3407 |
| 224 | Ga0495613_0137859 | 3300046689 | Bacteria | 1745 |
| 225 | Ga0496100_0159044 | 3300048903 | Bacteria | 1618 |
| 226 | Ga0496102_0071209 | 3300048905 | Bacteria | 3192 |
| 227 | Ga0496106_0065062 | 3300048909 | Bacteria | 2775 |
| 228 | Ga0496112_0268441 | 3300048915 | Bacteria | 1655 |
| 229 | Ga0496112_0611585 | 3300048915 | Bacteria | 1021 |
| 230 | Ga0501227_019961 | 3300049665 | Bacteria | 1532 |
| 231 | Ga0501257_015353 | 3300049686 | Bacteria | 1768 |
| 232 | nmdc:mga09592_365985_c1 | 3300050508 | Unclassified | 1247 |
| 233 | nmdc:mga09592_94352_c1 | 3300050508 | Bacteria | 2559 |
| 234 | nmdc:mga08y16_11036_c1 | 3300050511 | Bacteria | 9485 |
| 235 | nmdc:mga08y16_14625_c1 | 3300050511 | Bacteria | 6119 |
| 236 | nmdc:mga0n895_29759_c1 | 3300050512 | Bacteria | 5211 |
| 237 | nmdc:mga0n895_71072_c1 | 3300050512 | Unclassified | 3450 |
| 238 | nmdc:mga0rr50_209219_c1 | 3300050513 | Bacteria | 1606 |
| 239 | nmdc:mga0rr50_783_c1 | 3300050513 | Bacteria | 17103 |
| 240 | nmdc:mga08x19_9_c1 | 3300050514 | Bacteria | 418852 |
| 241 | nmdc:mga0a205_174298_c1 | 3300050515 | Bacteria | 2046 |
| 242 | nmdc:mga0a205_247678_c1 | 3300050515 | Unclassified | 1662 |
| 243 | nmdc:mga0a205_85561_c1 | 3300050515 | Bacteria | 3045 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013297 | Ga0157378_10698955 | Ga0157378_106989551 | 265 |
| 2 | 3300031456 | Ga0307513_10005443 | Ga0307513_1000544312 | 270 |
| 3 | 3300005546 | Ga0070696_100532008 | Ga0070696_1005320081 | 279 |
| 4 | 3300005549 | Ga0070704_100233854 | Ga0070704_1002338542 | 289 |
| 5 | 3300005618 | Ga0068864_100038112 | Ga0068864_1000381122 | 289 |
| 6 | 3300005841 | Ga0068863_100599780 | Ga0068863_1005997801 | 289 |
| 7 | 3300006237 | Ga0097621_100377352 | Ga0097621_1003773521 | 289 |
| 8 | 3300009094 | Ga0111539_10076885 | Ga0111539_100768853 | 289 |
| 9 | 3300009147 | Ga0114129_10589460 | Ga0114129_105894602 | 289 |
| 10 | 3300011119 | Ga0105246_10252722 | Ga0105246_102527222 | 289 |
| 11 | 3300014326 | Ga0157380_10019091 | Ga0157380_100190914 | 289 |
| 12 | 3300025923 | Ga0207681_10033484 | Ga0207681_100334842 | 289 |
| 13 | 3300025940 | Ga0207691_10102105 | Ga0207691_101021053 | 289 |
| 14 | 3300026095 | Ga0207676_10007015 | Ga0207676_100070156 | 289 |
| 15 | 3300049665 | Ga0501227_019961 | Ga0501227_019961_330_1199 | 289 |
| 16 | 3300049686 | Ga0501257_015353 | Ga0501257_015353_455_1324 | 289 |
| 17 | 3300050511 | nmdc:mga08y16_14625_c1 | nmdc:mga08y16_14625_c1_4046_4915 | 289 |
| 18 | 3300005336 | Ga0070680_100147500 | Ga0070680_1001475002 | 291 |
| 19 | 3300005338 | Ga0068868_100338955 | Ga0068868_1003389552 | 291 |
| 20 | 3300005444 | Ga0070694_100090313 | Ga0070694_1000903132 | 291 |
| 21 | 3300005457 | Ga0070662_100024326 | Ga0070662_1000243264 | 291 |
| 22 | 3300005471 | Ga0070698_100168825 | Ga0070698_1001688252 | 291 |
| 23 | 3300005546 | Ga0070696_100031104 | Ga0070696_1000311043 | 291 |
| 24 | 3300005617 | Ga0068859_100071425 | Ga0068859_1000714253 | 291 |
| 25 | 3300005843 | Ga0068860_100105342 | Ga0068860_1001053422 | 291 |
| 26 | 3300006931 | Ga0097620_100071422 | Ga0097620_1000714223 | 291 |
| 27 | 3300009094 | Ga0111539_10052020 | Ga0111539_100520204 | 291 |
| 28 | 3300013308 | Ga0157375_10039172 | Ga0157375_100391723 | 291 |
| 29 | 3300014326 | Ga0157380_10070657 | Ga0157380_100706572 | 291 |
| 30 | 3300025917 | Ga0207660_10034690 | Ga0207660_100346904 | 291 |
| 31 | 3300025926 | Ga0207659_10184664 | Ga0207659_101846642 | 291 |
| 32 | 3300025933 | Ga0207706_10038400 | Ga0207706_100384004 | 291 |
| 33 | 3300026023 | Ga0207677_10230367 | Ga0207677_102303671 | 291 |
| 34 | 3300027907 | Ga0207428_10046223 | Ga0207428_100462232 | 291 |
| 35 | 3300028380 | Ga0268265_10203535 | Ga0268265_102035352 | 291 |
| 36 | 3300028381 | Ga0268264_10272600 | Ga0268264_102726002 | 291 |
| 37 | 3300050511 | nmdc:mga08y16_11036_c1 | nmdc:mga08y16_11036_c1_3744_4619 | 291 |
| 38 | 3300005467 | Ga0070706_100007569 | Ga0070706_1000075693 | 292 |
| 39 | 3300005468 | Ga0070707_100031352 | Ga0070707_1000313523 | 292 |
| 40 | 3300005518 | Ga0070699_100003797 | Ga0070699_1000037973 | 292 |
| 41 | 3300009147 | Ga0114129_10628232 | Ga0114129_106282322 | 292 |
| 42 | 3300014325 | Ga0163163_10018259 | Ga0163163_100182596 | 292 |
| 43 | 3300048915 | Ga0496112_0268441 | Ga0496112_0268441_144_1022 | 292 |
| 44 | 3300050515 | nmdc:mga0a205_174298_c1 | nmdc:mga0a205_174298_c1_756_1634 | 292 |
| 45 | 3300005293 | Ga0065715_10114094 | Ga0065715_101140943 | 293 |
| 46 | 3300005334 | Ga0068869_100027720 | Ga0068869_1000277202 | 293 |
| 47 | 3300005338 | Ga0068868_100037098 | Ga0068868_1000370983 | 293 |
| 48 | 3300005340 | Ga0070689_100292542 | Ga0070689_1002925422 | 293 |
| 49 | 3300005355 | Ga0070671_100572961 | Ga0070671_1005729611 | 293 |
| 50 | 3300005367 | Ga0070667_100023107 | Ga0070667_1000231074 | 293 |
| 51 | 3300005458 | Ga0070681_10000475 | Ga0070681_1000047524 | 293 |
| 52 | 3300005530 | Ga0070679_100000307 | Ga0070679_10000030715 | 293 |
| 53 | 3300005546 | Ga0070696_100095141 | Ga0070696_1000951411 | 293 |
| 54 | 3300005547 | Ga0070693_100244737 | Ga0070693_1002447372 | 293 |
| 55 | 3300005548 | Ga0070665_100061757 | Ga0070665_1000617573 | 293 |
| 56 | 3300005564 | Ga0070664_100063145 | Ga0070664_1000631452 | 293 |
| 57 | 3300005616 | Ga0068852_100439277 | Ga0068852_1004392772 | 293 |
| 58 | 3300005618 | Ga0068864_100140316 | Ga0068864_1001403162 | 293 |
| 59 | 3300005834 | Ga0068851_10147228 | Ga0068851_101472281 | 293 |
| 60 | 3300005842 | Ga0068858_100006421 | Ga0068858_1000064217 | 293 |
| 61 | 3300005843 | Ga0068860_100061529 | Ga0068860_1000615293 | 293 |
| 62 | 3300006237 | Ga0097621_100012853 | Ga0097621_1000128533 | 293 |
| 63 | 3300006358 | Ga0068871_100024574 | Ga0068871_1000245744 | 293 |
| 64 | 3300009094 | Ga0111539_10107550 | Ga0111539_101075502 | 293 |
| 65 | 3300009176 | Ga0105242_10687305 | Ga0105242_106873051 | 293 |
| 66 | 3300009177 | Ga0105248_10127647 | Ga0105248_101276473 | 293 |
| 67 | 3300009553 | Ga0105249_10050497 | Ga0105249_100504973 | 293 |
| 68 | 3300010375 | Ga0105239_10672613 | Ga0105239_106726131 | 293 |
| 69 | 3300013297 | Ga0157378_10005669 | Ga0157378_1000566910 | 293 |
| 70 | 3300013297 | Ga0157378_10158161 | Ga0157378_101581611 | 293 |
| 71 | 3300013306 | Ga0163162_10017938 | Ga0163162_100179382 | 293 |
| 72 | 3300013308 | Ga0157375_10025809 | Ga0157375_100258093 | 293 |
| 73 | 3300013308 | Ga0157375_10218454 | Ga0157375_102184542 | 293 |
| 74 | 3300014325 | Ga0163163_10052858 | Ga0163163_100528583 | 293 |
| 75 | 3300014969 | Ga0157376_10018281 | Ga0157376_100182812 | 293 |
| 76 | 3300025911 | Ga0207654_10267708 | Ga0207654_102677081 | 293 |
| 77 | 3300025912 | Ga0207707_10000006 | Ga0207707_10000006193 | 293 |
| 78 | 3300025914 | Ga0207671_10469200 | Ga0207671_104692001 | 293 |
| 79 | 3300025917 | Ga0207660_10001704 | Ga0207660_1000170415 | 293 |
| 80 | 3300025921 | Ga0207652_10000216 | Ga0207652_1000021655 | 293 |
| 81 | 3300025931 | Ga0207644_10056356 | Ga0207644_100563561 | 293 |
| 82 | 3300025941 | Ga0207711_10118215 | Ga0207711_101182151 | 293 |
| 83 | 3300025945 | Ga0207679_10064961 | Ga0207679_100649612 | 293 |
| 84 | 3300025960 | Ga0207651_10050554 | Ga0207651_100505543 | 293 |
| 85 | 3300025961 | Ga0207712_10017673 | Ga0207712_100176734 | 293 |
| 86 | 3300025981 | Ga0207640_10507540 | Ga0207640_105075401 | 293 |
| 87 | 3300025986 | Ga0207658_10102453 | Ga0207658_101024531 | 293 |
| 88 | 3300026023 | Ga0207677_10029389 | Ga0207677_100293893 | 293 |
| 89 | 3300026035 | Ga0207703_10251160 | Ga0207703_102511601 | 293 |
| 90 | 3300026095 | Ga0207676_10095428 | Ga0207676_100954281 | 293 |
| 91 | 3300026142 | Ga0207698_10130850 | Ga0207698_101308503 | 293 |
| 92 | 3300028381 | Ga0268264_10253117 | Ga0268264_102531172 | 293 |
| 93 | 3300048905 | Ga0496102_0071209 | Ga0496102_0071209_49_930 | 293 |
| 94 | 3300048915 | Ga0496112_0611585 | Ga0496112_0611585_38_919 | 293 |
| 95 | 3300050513 | nmdc:mga0rr50_209219_c1 | nmdc:mga0rr50_209219_c1_697_1578 | 293 |
| 96 | 3300009148 | Ga0105243_10090322 | Ga0105243_100903222 | 294 |
| 97 | 3300013308 | Ga0157375_10800167 | Ga0157375_108001671 | 294 |
| 98 | 3300025935 | Ga0207709_10073695 | Ga0207709_100736952 | 294 |
| 99 | 3300005330 | Ga0070690_100013689 | Ga0070690_1000136892 | 295 |
| 100 | 3300005335 | Ga0070666_10166506 | Ga0070666_101665062 | 295 |
| 101 | 3300005347 | Ga0070668_100397470 | Ga0070668_1003974702 | 295 |
| 102 | 3300005364 | Ga0070673_100259968 | Ga0070673_1002599682 | 295 |
| 103 | 3300005544 | Ga0070686_100075449 | Ga0070686_1000754492 | 295 |
| 104 | 3300005617 | Ga0068859_100851824 | Ga0068859_1008518241 | 295 |
| 105 | 3300005719 | Ga0068861_100406770 | Ga0068861_1004067702 | 295 |
| 106 | 3300005844 | Ga0068862_100145807 | Ga0068862_1001458072 | 295 |
| 107 | 3300006931 | Ga0097620_100851841 | Ga0097620_1008518411 | 295 |
| 108 | 3300009553 | Ga0105249_10669192 | Ga0105249_106691921 | 295 |
| 109 | 3300014326 | Ga0157380_10021627 | Ga0157380_100216272 | 295 |
| 110 | 3300037471 | Ga0395905_0273053 | Ga0395905_0273053_486_1376 | 296 |
| 111 | 3300038443 | Ga0395901_0102149 | Ga0395901_0102149_854_1744 | 296 |
| 112 | 3300005985 | Ga0081539_10000731 | Ga0081539_1000073126 | 297 |
| 113 | 3300005468 | Ga0070707_100000107 | Ga0070707_10000010772 | 303 |
| 114 | 3300005471 | Ga0070698_100153730 | Ga0070698_1001537301 | 303 |
| 115 | 3300005549 | Ga0070704_100018552 | Ga0070704_1000185524 | 303 |
| 116 | 3300006852 | Ga0075433_10090137 | Ga0075433_100901372 | 303 |
| 117 | 3300025922 | Ga0207646_10000543 | Ga0207646_1000054311 | 303 |
| 118 | 3300046689 | Ga0495613_0137859 | Ga0495613_0137859_490_1521 | 303 |
| 119 | 3300050512 | nmdc:mga0n895_71072_c1 | nmdc:mga0n895_71072_c1_919_1944 | 303 |
| 120 | 3300050515 | nmdc:mga0a205_85561_c1 | nmdc:mga0a205_85561_c1_1262_2287 | 303 |
| 121 | 3300005544 | Ga0070686_100323017 | Ga0070686_1003230171 | 304 |
| 122 | 3300013297 | Ga0157378_10482279 | Ga0157378_104822792 | 304 |
| 123 | 3300017792 | Ga0163161_10292474 | Ga0163161_102924742 | 304 |
| 124 | 3300005842 | Ga0068858_100016372 | Ga0068858_1000163722 | 305 |
| 125 | 3300026035 | Ga0207703_10077991 | Ga0207703_100779912 | 305 |
| 126 | 3300005471 | Ga0070698_100061857 | Ga0070698_1000618572 | 306 |
| 127 | 3300005444 | Ga0070694_100052731 | Ga0070694_1000527314 | 307 |
| 128 | 3300050508 | nmdc:mga09592_365985_c1 | nmdc:mga09592_365985_c1_140_1177 | 307 |
| 129 | 3300005340 | Ga0070689_100298267 | Ga0070689_1002982671 | 309 |
| 130 | 3300005347 | Ga0070668_100000259 | Ga0070668_1000002594 | 309 |
| 131 | 3300005618 | Ga0068864_100188215 | Ga0068864_1001882152 | 309 |
| 132 | 3300005843 | Ga0068860_100033131 | Ga0068860_1000331315 | 309 |
| 133 | 3300006880 | Ga0075429_100229787 | Ga0075429_1002297872 | 309 |
| 134 | 3300006914 | Ga0075436_100000002 | Ga0075436_100000002217 | 309 |
| 135 | 3300007076 | Ga0075435_100002379 | Ga0075435_1000023793 | 309 |
| 136 | 3300009176 | Ga0105242_10006789 | Ga0105242_100067897 | 309 |
| 137 | 3300009176 | Ga0105242_10215927 | Ga0105242_102159272 | 309 |
| 138 | 3300009176 | Ga0105242_10447527 | Ga0105242_104475271 | 309 |
| 139 | 3300009553 | Ga0105249_10000044 | Ga0105249_10000044143 | 309 |
| 140 | 3300013306 | Ga0163162_10000025 | Ga0163162_1000002514 | 309 |
| 141 | 3300013306 | Ga0163162_10242321 | Ga0163162_102423211 | 309 |
| 142 | 3300025934 | Ga0207686_10000127 | Ga0207686_1000012730 | 309 |
| 143 | 3300025935 | Ga0207709_10290143 | Ga0207709_102901432 | 309 |
| 144 | 3300025961 | Ga0207712_10000039 | Ga0207712_1000003929 | 309 |
| 145 | 3300025972 | Ga0207668_10000519 | Ga0207668_1000051916 | 309 |
| 146 | 3300028381 | Ga0268264_10017789 | Ga0268264_100177892 | 309 |
| 147 | 3300046477 | Ga0495664_0026020 | Ga0495664_0026020_1956_2987 | 309 |
| 148 | 3300050508 | nmdc:mga09592_94352_c1 | nmdc:mga09592_94352_c1_304_1341 | 309 |
| 149 | 3300050513 | nmdc:mga0rr50_783_c1 | nmdc:mga0rr50_783_c1_14399_15427 | 309 |
| 150 | 3300050514 | nmdc:mga08x19_9_c1 | nmdc:mga08x19_9_c1_163356_164384 | 309 |
| 151 | 3300005334 | Ga0068869_100092991 | Ga0068869_1000929911 | 310 |
| 152 | 3300005340 | Ga0070689_100122404 | Ga0070689_1001224042 | 310 |
| 153 | 3300005354 | Ga0070675_100055867 | Ga0070675_1000558671 | 310 |
| 154 | 3300005406 | Ga0070703_10000205 | Ga0070703_100002054 | 310 |
| 155 | 3300005434 | Ga0070709_10038177 | Ga0070709_100381772 | 310 |
| 156 | 3300005441 | Ga0070700_100006731 | Ga0070700_1000067315 | 310 |
| 157 | 3300005445 | Ga0070708_100029340 | Ga0070708_1000293403 | 310 |
| 158 | 3300005467 | Ga0070706_100067101 | Ga0070706_1000671012 | 310 |
| 159 | 3300005467 | Ga0070706_100092237 | Ga0070706_1000922371 | 310 |
| 160 | 3300005468 | Ga0070707_100029270 | Ga0070707_1000292705 | 310 |
| 161 | 3300005468 | Ga0070707_100036757 | Ga0070707_1000367571 | 310 |
| 162 | 3300005468 | Ga0070707_100046298 | Ga0070707_1000462985 | 310 |
| 163 | 3300005468 | Ga0070707_100145826 | Ga0070707_1001458262 | 310 |
| 164 | 3300005471 | Ga0070698_100000063 | Ga0070698_10000006313 | 310 |
| 165 | 3300005471 | Ga0070698_100060748 | Ga0070698_1000607483 | 310 |
| 166 | 3300005536 | Ga0070697_100069034 | Ga0070697_1000690342 | 310 |
| 167 | 3300005546 | Ga0070696_100077036 | Ga0070696_1000770362 | 310 |
| 168 | 3300005549 | Ga0070704_100089311 | Ga0070704_1000893111 | 310 |
| 169 | 3300005617 | Ga0068859_100158006 | Ga0068859_1001580061 | 310 |
| 170 | 3300005618 | Ga0068864_100050872 | Ga0068864_1000508723 | 310 |
| 171 | 3300005842 | Ga0068858_100123909 | Ga0068858_1001239092 | 310 |
| 172 | 3300005844 | Ga0068862_100236890 | Ga0068862_1002368902 | 310 |
| 173 | 3300006163 | Ga0070715_10000002 | Ga0070715_10000002217 | 310 |
| 174 | 3300006852 | Ga0075433_10102818 | Ga0075433_101028182 | 310 |
| 175 | 3300006871 | Ga0075434_100019279 | Ga0075434_1000192794 | 310 |
| 176 | 3300006931 | Ga0097620_100158016 | Ga0097620_1001580161 | 310 |
| 177 | 3300007076 | Ga0075435_100231807 | Ga0075435_1002318072 | 310 |
| 178 | 3300009094 | Ga0111539_10191061 | Ga0111539_101910612 | 310 |
| 179 | 3300009147 | Ga0114129_10217804 | Ga0114129_102178041 | 310 |
| 180 | 3300009177 | Ga0105248_10044864 | Ga0105248_100448645 | 310 |
| 181 | 3300009553 | Ga0105249_10172749 | Ga0105249_101727492 | 310 |
| 182 | 3300009553 | Ga0105249_10311925 | Ga0105249_103119252 | 310 |
| 183 | 3300011119 | Ga0105246_10209604 | Ga0105246_102096042 | 310 |
| 184 | 3300013297 | Ga0157378_10012428 | Ga0157378_100124287 | 310 |
| 185 | 3300013297 | Ga0157378_10076124 | Ga0157378_100761243 | 310 |
| 186 | 3300013297 | Ga0157378_10394241 | Ga0157378_103942411 | 310 |
| 187 | 3300013306 | Ga0163162_10064052 | Ga0163162_100640522 | 310 |
| 188 | 3300025885 | Ga0207653_10000209 | Ga0207653_100002094 | 310 |
| 189 | 3300025885 | Ga0207653_10022003 | Ga0207653_100220032 | 310 |
| 190 | 3300025906 | Ga0207699_10146249 | Ga0207699_101462492 | 310 |
| 191 | 3300025910 | Ga0207684_10017245 | Ga0207684_100172457 | 310 |
| 192 | 3300025922 | Ga0207646_10015280 | Ga0207646_100152802 | 310 |
| 193 | 3300025922 | Ga0207646_10033595 | Ga0207646_100335952 | 310 |
| 194 | 3300025922 | Ga0207646_10151329 | Ga0207646_101513292 | 310 |
| 195 | 3300025922 | Ga0207646_10288302 | Ga0207646_102883022 | 310 |
| 196 | 3300025935 | Ga0207709_10026481 | Ga0207709_100264812 | 310 |
| 197 | 3300026023 | Ga0207677_10260962 | Ga0207677_102609621 | 310 |
| 198 | 3300026075 | Ga0207708_10011413 | Ga0207708_100114134 | 310 |
| 199 | 3300027907 | Ga0207428_10013055 | Ga0207428_100130555 | 310 |
| 200 | 3300050512 | nmdc:mga0n895_29759_c1 | nmdc:mga0n895_29759_c1_1112_2119 | 310 |
| 201 | 3300050515 | nmdc:mga0a205_247678_c1 | nmdc:mga0a205_247678_c1_460_1533 | 310 |
| 202 | 3300002074 | JGI24748J21848_1000001 | JGI24748J21848_1000001217 | 311 |
| 203 | 3300002239 | JGI24034J26672_10000001 | JGI24034J26672_10000001200 | 311 |
| 204 | 3300005338 | Ga0068868_100072812 | Ga0068868_1000728121 | 311 |
| 205 | 3300005364 | Ga0070673_100015372 | Ga0070673_1000153722 | 311 |
| 206 | 3300005444 | Ga0070694_100008993 | Ga0070694_1000089933 | 311 |
| 207 | 3300005445 | Ga0070708_100394923 | Ga0070708_1003949232 | 311 |
| 208 | 3300005467 | Ga0070706_100044250 | Ga0070706_1000442501 | 311 |
| 209 | 3300005536 | Ga0070697_100019460 | Ga0070697_1000194604 | 311 |
| 210 | 3300005842 | Ga0068858_100000044 | Ga0068858_10000004476 | 311 |
| 211 | 3300006173 | Ga0070716_100000004 | Ga0070716_100000004132 | 311 |
| 212 | 3300009098 | Ga0105245_10074425 | Ga0105245_100744252 | 311 |
| 213 | 3300009101 | Ga0105247_10000004 | Ga0105247_10000004238 | 311 |
| 214 | 3300009148 | Ga0105243_10000037 | Ga0105243_1000003750 | 311 |
| 215 | 3300009148 | Ga0105243_10000240 | Ga0105243_1000024034 | 311 |
| 216 | 3300009148 | Ga0105243_10022998 | Ga0105243_100229982 | 311 |
| 217 | 3300009176 | Ga0105242_10000276 | Ga0105242_100002766 | 311 |
| 218 | 3300009176 | Ga0105242_10001016 | Ga0105242_100010168 | 311 |
| 219 | 3300009553 | Ga0105249_10097941 | Ga0105249_100979413 | 311 |
| 220 | 3300010375 | Ga0105239_10099128 | Ga0105239_100991283 | 311 |
| 221 | 3300013297 | Ga0157378_10000025 | Ga0157378_1000002575 | 311 |
| 222 | 3300013297 | Ga0157378_10086881 | Ga0157378_100868814 | 311 |
| 223 | 3300013297 | Ga0157378_10333979 | Ga0157378_103339792 | 311 |
| 224 | 3300013308 | Ga0157375_10031747 | Ga0157375_100317474 | 311 |
| 225 | 3300014968 | Ga0157379_10043304 | Ga0157379_100433042 | 311 |
| 226 | 3300014968 | Ga0157379_10403613 | Ga0157379_104036131 | 311 |
| 227 | 3300025223 | Ga0207672_1000249 | Ga0207672_10002494 | 311 |
| 228 | 3300025900 | Ga0207710_10000002 | Ga0207710_10000002775 | 311 |
| 229 | 3300025905 | Ga0207685_10000002 | Ga0207685_10000002227 | 311 |
| 230 | 3300025910 | Ga0207684_10060624 | Ga0207684_100606242 | 311 |
| 231 | 3300025931 | Ga0207644_10000623 | Ga0207644_100006236 | 311 |
| 232 | 3300025934 | Ga0207686_10000003 | Ga0207686_10000003239 | 311 |
| 233 | 3300025934 | Ga0207686_10000925 | Ga0207686_1000092512 | 311 |
| 234 | 3300025935 | Ga0207709_10000017 | Ga0207709_10000017298 | 311 |
| 235 | 3300025935 | Ga0207709_10000884 | Ga0207709_1000088415 | 311 |
| 236 | 3300025938 | Ga0207704_10117221 | Ga0207704_101172212 | 311 |
| 237 | 3300025939 | Ga0207665_10000006 | Ga0207665_1000000680 | 311 |
| 238 | 3300025942 | Ga0207689_10010385 | Ga0207689_100103855 | 311 |
| 239 | 3300026035 | Ga0207703_10000032 | Ga0207703_1000003277 | 311 |
| 240 | 3300026118 | Ga0207675_100024694 | Ga0207675_1000246944 | 311 |
| 241 | 3300045051 | Ga0451576_0022354 | Ga0451576_0022354_1465_2490 | 311 |
| 242 | 3300048903 | Ga0496100_0159044 | Ga0496100_0159044_544_1563 | 311 |
| 243 | 3300048909 | Ga0496106_0065062 | Ga0496106_0065062_1637_2656 | 311 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5x0n-assembly2.cif.gz_C | regulatory domain of variant c227s aphb from vibrio vulnificus | 0.5026 | 284 | 311 |
| 4ztu-assembly1.cif.gz_C | structural basis for processivity and antiviral drug toxicity in human mitochondrial dna replicase | 0.3227 | 85 | 131 |
| 2g4c-assembly2.cif.gz_D | crystal structure of human dna polymerase gamma accessory subunit | 0.3153 | 77 | 131 |
| 4bw9-assembly1.cif.gz_A-2 | pylrs y306g, y384f, i405r mutant in complex with amp-pnp | 0.3063 | 70 | 127 |
| 4qhj-assembly1.cif.gz_B | crystal structure of methanocaldococcus jannaschii selecase mutant i100f+h107f | 0.301 | 148 | 248 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R4IHF6_384_488_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.424 | 77 | 127 | 3.30.200.20 |
| 3fulA02 | Alpha Beta;2-Layer Sandwich;Zincin-like; | 0.391 | 153 | 221 | 3.30.2010.30 |
| af_A0A1D6P7W3_1_91_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.3665 | 77 | 118 | 3.30.200.20 |
| af_P32742_14_103_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.3537 | 91 | 130 | 3.30.200.20 |
| af_Q21199_43_258_3.80.10.10 | Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor | 0.3495 | 180 | 213 | 3.80.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8Q3C8-F1-model_v4 | Uncharacterized protein | 0.9419 | 3 | 311 |
|
| AF-A0A1Q7Y7D7-F1-model_v4 | Uncharacterized protein | 0.9347 | 1 | 311 |
|
| AF-A0A2V8Q3C8-F1-model_v4 | Uncharacterized protein | 0.933 | 3 | 311 |
|
| AF-A0A1Q7Y7D7-F1-model_v4 | Uncharacterized protein | 0.9316 | 1 | 311 |
|
| AF-A0A2V9I2U1-F1-model_v4 | Uncharacterized protein | 0.9147 | 1 | 307 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar