F355357

General Info

Members Datasets Scaffolds Average Seq Length
243 127 243 309

Family's Representative Sequence

Representative Sequence 3300005406|Ga0070703_10000205|Ga0070703_100002054
Length 355
Sequence MHMAATTKKRELDLKDFPPGTVTEFTTLVCLACIFDIFTKQLGLAPRTAFSEIKRHTPTTEELTSRSAMRPYFDSEEKHPHCPYCGAAKRWHARFDTYCVEGGKSTDAARRALIKKLPTADQFIVVEKKSDSRAVLFEWLDTLGLNLDLSDERWLLDATRNYLERREPKTNWEEVFEQVRVVRRSSRLTEGWERDGARLFLAPKIYGEAILIQYLVSRSHAHGGLTLEGRLTLMELIRRLRYIGYLDQIGITEREPGEVFEKLIDHLAATHDWSRVSVASGSVKGKGVSTGSDRVGRSKKIGKKASKIASQSRKSKAAVQPEPDEIITEPVKLYYLIDRRDFLEKAKSVYASYLA

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
121 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
122 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
125 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
126 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
127 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.06
Rhizosphere 97.53
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000001 3300002074 Bacteria 444271
2 JGI24034J26672_10000001 3300002239 Bacteria 1118280
3 Ga0065715_10114094 3300005293 Bacteria 2463
4 Ga0070690_100013689 3300005330 Bacteria 4801
5 Ga0068869_100027720 3300005334 Bacteria 3952
6 Ga0068869_100092991 3300005334 Bacteria 2271
7 Ga0070666_10166506 3300005335 Unclassified 1542
8 Ga0070680_100147500 3300005336 Bacteria 1974
9 Ga0068868_100037098 3300005338 Bacteria 3777
10 Ga0068868_100072812 3300005338 Bacteria 2742
11 Ga0068868_100338955 3300005338 Bacteria 1285
12 Ga0070689_100122404 3300005340 Bacteria 2079
13 Ga0070689_100292542 3300005340 Bacteria 1354
14 Ga0070689_100298267 3300005340 Unclassified 1341
15 Ga0070668_100000259 3300005347 Bacteria 35153
16 Ga0070668_100397470 3300005347 Unclassified 1176
17 Ga0070675_100055867 3300005354 Bacteria 3251
18 Ga0070671_100572961 3300005355 Bacteria 974
19 Ga0070673_100015372 3300005364 Bacteria 5374
20 Ga0070673_100259968 3300005364 Unclassified 1516
21 Ga0070667_100023107 3300005367 Bacteria 5157
22 Ga0070703_10000205 3300005406 Bacteria 28472
23 Ga0070709_10038177 3300005434 Bacteria 2939
24 Ga0070700_100006731 3300005441 Bacteria 6156
25 Ga0070694_100008993 3300005444 Bacteria 6119
26 Ga0070694_100052731 3300005444 Bacteria 2750
27 Ga0070694_100090313 3300005444 Unclassified 2148
28 Ga0070708_100029340 3300005445 Bacteria 4743
29 Ga0070708_100394923 3300005445 Bacteria 1304
30 Ga0070662_100024326 3300005457 Unclassified 4171
31 Ga0070681_10000475 3300005458 Bacteria 32749
32 Ga0070706_100007569 3300005467 Bacteria 10172
33 Ga0070706_100044250 3300005467 Bacteria 4112
34 Ga0070706_100067101 3300005467 Bacteria 3318
35 Ga0070706_100092237 3300005467 Bacteria 2810
36 Ga0070707_100000107 3300005468 Bacteria 76101
37 Ga0070707_100029270 3300005468 Bacteria 5244
38 Ga0070707_100031352 3300005468 Bacteria 5063
39 Ga0070707_100036757 3300005468 Bacteria 4673
40 Ga0070707_100046298 3300005468 Bacteria 4163
41 Ga0070707_100145826 3300005468 Bacteria 2304
42 Ga0070698_100000063 3300005471 Bacteria 78062
43 Ga0070698_100060748 3300005471 Bacteria 3813
44 Ga0070698_100061857 3300005471 Bacteria 3778
45 Ga0070698_100153730 3300005471 Bacteria 2247
46 Ga0070698_100168825 3300005471 Unclassified 2129
47 Ga0070699_100003797 3300005518 Bacteria 13349
48 Ga0070679_100000307 3300005530 Bacteria 41692
49 Ga0070697_100019460 3300005536 Bacteria 5362
50 Ga0070697_100069034 3300005536 Bacteria 2894
51 Ga0070686_100075449 3300005544 Unclassified 2218
52 Ga0070686_100323017 3300005544 Unclassified 1151
53 Ga0070696_100031104 3300005546 Bacteria 3657
54 Ga0070696_100077036 3300005546 Bacteria 2355
55 Ga0070696_100095141 3300005546 Unclassified 2127
56 Ga0070696_100532008 3300005546 Unclassified 939
57 Ga0070693_100244737 3300005547 Unclassified 1186
58 Ga0070665_100061757 3300005548 Bacteria 3757
59 Ga0070704_100018552 3300005549 Bacteria 4451
60 Ga0070704_100089311 3300005549 Bacteria 2292
61 Ga0070704_100233854 3300005549 Unclassified 1501
62 Ga0070664_100063145 3300005564 Bacteria 3158
63 Ga0068852_100439277 3300005616 Unclassified 1290
64 Ga0068859_100071425 3300005617 Bacteria 3507
65 Ga0068859_100158006 3300005617 Bacteria 2345
66 Ga0068859_100851824 3300005617 Unclassified 998
67 Ga0068864_100038112 3300005618 Bacteria 4103
68 Ga0068864_100050872 3300005618 Bacteria 3567
69 Ga0068864_100140316 3300005618 Bacteria 2179
70 Ga0068864_100188215 3300005618 Bacteria 1891
71 Ga0068861_100406770 3300005719 Unclassified 1209
72 Ga0068851_10147228 3300005834 Bacteria 1285
73 Ga0068863_100599780 3300005841 Bacteria 1090
74 Ga0068858_100000044 3300005842 Bacteria 128977
75 Ga0068858_100006421 3300005842 Bacteria 11452
76 Ga0068858_100016372 3300005842 Bacteria 6963
77 Ga0068858_100123909 3300005842 Bacteria 2419
78 Ga0068860_100033131 3300005843 Bacteria 4959
79 Ga0068860_100061529 3300005843 Bacteria 3567
80 Ga0068860_100105342 3300005843 Unclassified 2693
81 Ga0068862_100145807 3300005844 Bacteria 2104
82 Ga0068862_100236890 3300005844 Unclassified 1658
83 Ga0081539_10000731 3300005985 Bacteria 65764
84 Ga0070715_10000002 3300006163 Bacteria 389554
85 Ga0070716_100000004 3300006173 Bacteria 296614
86 Ga0097621_100012853 3300006237 Bacteria 6219
87 Ga0097621_100377352 3300006237 Bacteria 1266
88 Ga0068871_100024574 3300006358 Bacteria 4674
89 Ga0075433_10090137 3300006852 Bacteria 2710
90 Ga0075433_10102818 3300006852 Bacteria 2531
91 Ga0075434_100019279 3300006871 Bacteria 6599
92 Ga0075429_100229787 3300006880 Bacteria 1625
93 Ga0075436_100000002 3300006914 Bacteria 475522
94 Ga0097620_100071422 3300006931 Bacteria 3507
95 Ga0097620_100158016 3300006931 Bacteria 2345
96 Ga0097620_100851841 3300006931 Unclassified 998
97 Ga0075435_100002379 3300007076 Bacteria 12471
98 Ga0075435_100231807 3300007076 Bacteria 1569
99 Ga0111539_10052020 3300009094 Bacteria 4877
100 Ga0111539_10076885 3300009094 Bacteria 3930
101 Ga0111539_10107550 3300009094 Bacteria 3273
102 Ga0111539_10191061 3300009094 Bacteria 2389
103 Ga0105245_10074425 3300009098 Bacteria 3091
104 Ga0105247_10000004 3300009101 Bacteria 455497
105 Ga0114129_10217804 3300009147 Bacteria 2577
106 Ga0114129_10589460 3300009147 Bacteria 1442
107 Ga0114129_10628232 3300009147 Viruses 1388
108 Ga0105243_10000037 3300009148 Bacteria 175237
109 Ga0105243_10000240 3300009148 Bacteria 62821
110 Ga0105243_10022998 3300009148 Bacteria 4741
111 Ga0105243_10090322 3300009148 Bacteria 2520
112 Ga0105242_10000276 3300009176 Bacteria 40893
113 Ga0105242_10001016 3300009176 Bacteria 22045
114 Ga0105242_10006789 3300009176 Bacteria 8825
115 Ga0105242_10215927 3300009176 Bacteria 1711
116 Ga0105242_10447527 3300009176 Unclassified 1217
117 Ga0105242_10687305 3300009176 Unclassified 999
118 Ga0105248_10044864 3300009177 Bacteria 4958
119 Ga0105248_10127647 3300009177 Bacteria 2869
120 Ga0105249_10000044 3300009553 Bacteria 184637
121 Ga0105249_10050497 3300009553 Unclassified 3792
122 Ga0105249_10097941 3300009553 Bacteria 2754
123 Ga0105249_10172749 3300009553 Unclassified 2097
124 Ga0105249_10311925 3300009553 Bacteria 1582
125 Ga0105249_10669192 3300009553 Unclassified 1097
126 Ga0105239_10099128 3300010375 Unclassified 3221
127 Ga0105239_10672613 3300010375 Bacteria 1183
128 Ga0105246_10209604 3300011119 Bacteria 1520
129 Ga0105246_10252722 3300011119 Bacteria 1400
130 Ga0157378_10000025 3300013297 Bacteria 128568
131 Ga0157378_10005669 3300013297 Bacteria 10924
132 Ga0157378_10012428 3300013297 Bacteria 7456
133 Ga0157378_10076124 3300013297 Bacteria 3023
134 Ga0157378_10086881 3300013297 Bacteria 2836
135 Ga0157378_10158161 3300013297 Bacteria 2117
136 Ga0157378_10333979 3300013297 Bacteria 1476
137 Ga0157378_10394241 3300013297 Unclassified 1362
138 Ga0157378_10482279 3300013297 Unclassified 1236
139 Ga0157378_10698955 3300013297 Unclassified 1033
140 Ga0163162_10000025 3300013306 Bacteria 184648
141 Ga0163162_10017938 3300013306 Bacteria 6926
142 Ga0163162_10064052 3300013306 Bacteria 3721
143 Ga0163162_10242321 3300013306 Bacteria 1934
144 Ga0157375_10025809 3300013308 Bacteria 5466
145 Ga0157375_10031747 3300013308 Bacteria 5000
146 Ga0157375_10039172 3300013308 Bacteria 4559
147 Ga0157375_10218454 3300013308 Bacteria 2064
148 Ga0157375_10800167 3300013308 Unclassified 1091
149 Ga0163163_10018259 3300014325 Bacteria 6561
150 Ga0163163_10052858 3300014325 Bacteria 4009
151 Ga0157380_10019091 3300014326 Bacteria 5104
152 Ga0157380_10021627 3300014326 Bacteria 4828
153 Ga0157380_10070657 3300014326 Bacteria 2821
154 Ga0157379_10043304 3300014968 Unclassified 4019
155 Ga0157379_10403613 3300014968 Bacteria 1257
156 Ga0157376_10018281 3300014969 Bacteria 5369
157 Ga0163161_10292474 3300017792 Unclassified 1281
158 Ga0207672_1000249 3300025223 Bacteria 7440
159 Ga0207653_10000209 3300025885 Bacteria 39477
160 Ga0207653_10022003 3300025885 Bacteria 2024
161 Ga0207710_10000002 3300025900 Bacteria 1251998
162 Ga0207685_10000002 3300025905 Bacteria 438088
163 Ga0207699_10146249 3300025906 Bacteria 1558
164 Ga0207684_10017245 3300025910 Bacteria 6194
165 Ga0207684_10060624 3300025910 Bacteria 3213
166 Ga0207654_10267708 3300025911 Bacteria 1151
167 Ga0207707_10000006 3300025912 Bacteria 374131
168 Ga0207671_10469200 3300025914 Unclassified 1003
169 Ga0207660_10001704 3300025917 Bacteria 14738
170 Ga0207660_10034690 3300025917 Bacteria 3498
171 Ga0207652_10000216 3300025921 Bacteria 61049
172 Ga0207646_10000543 3300025922 Bacteria 49799
173 Ga0207646_10015280 3300025922 Bacteria 7260
174 Ga0207646_10033595 3300025922 Bacteria 4639
175 Ga0207646_10151329 3300025922 Bacteria 2093
176 Ga0207646_10288302 3300025922 Bacteria 1483
177 Ga0207681_10033484 3300025923 Bacteria 3369
178 Ga0207659_10184664 3300025926 Bacteria 1655
179 Ga0207644_10000623 3300025931 Bacteria 22562
180 Ga0207644_10056356 3300025931 Bacteria 2836
181 Ga0207706_10038400 3300025933 Unclassified 4248
182 Ga0207686_10000003 3300025934 Bacteria 376934
183 Ga0207686_10000127 3300025934 Bacteria 61880
184 Ga0207686_10000925 3300025934 Bacteria 17584
185 Ga0207709_10000017 3300025935 Bacteria 470753
186 Ga0207709_10000884 3300025935 Bacteria 22669
187 Ga0207709_10026481 3300025935 Unclassified 3332
188 Ga0207709_10073695 3300025935 Bacteria 2176
189 Ga0207709_10290143 3300025935 Bacteria 1212
190 Ga0207704_10117221 3300025938 Bacteria 1814
191 Ga0207665_10000006 3300025939 Bacteria 184957
192 Ga0207691_10102105 3300025940 Bacteria 2559
193 Ga0207711_10118215 3300025941 Bacteria 2365
194 Ga0207689_10010385 3300025942 Bacteria 8020
195 Ga0207679_10064961 3300025945 Bacteria 2729
196 Ga0207651_10050554 3300025960 Bacteria 2823
197 Ga0207712_10000039 3300025961 Bacteria 182548
198 Ga0207712_10017673 3300025961 Bacteria 4636
199 Ga0207668_10000519 3300025972 Bacteria 24141
200 Ga0207640_10507540 3300025981 Bacteria 1005
201 Ga0207658_10102453 3300025986 Bacteria 2245
202 Ga0207677_10029389 3300026023 Bacteria 3492
203 Ga0207677_10230367 3300026023 Bacteria 1492
204 Ga0207677_10260962 3300026023 Bacteria 1412
205 Ga0207703_10000032 3300026035 Bacteria 188472
206 Ga0207703_10077991 3300026035 Unclassified 2751
207 Ga0207703_10251160 3300026035 Bacteria 1594
208 Ga0207708_10011413 3300026075 Bacteria 6616
209 Ga0207676_10007015 3300026095 Bacteria 7981
210 Ga0207676_10095428 3300026095 Bacteria 2452
211 Ga0207675_100024694 3300026118 Bacteria 5589
212 Ga0207698_10130850 3300026142 Unclassified 2144
213 Ga0207428_10013055 3300027907 Bacteria 7275
214 Ga0207428_10046223 3300027907 Bacteria 3501
215 Ga0268265_10203535 3300028380 Unclassified 1719
216 Ga0268264_10017789 3300028381 Bacteria 5818
217 Ga0268264_10253117 3300028381 Bacteria 1637
218 Ga0268264_10272600 3300028381 Unclassified 1581
219 Ga0307513_10005443 3300031456 Bacteria 16822
220 Ga0395905_0273053 3300037471 Bacteria 1577
221 Ga0395901_0102149 3300038443 Bacteria 3009
222 Ga0451576_0022354 3300045051 Bacteria 6859
223 Ga0495664_0026020 3300046477 Bacteria 3407
224 Ga0495613_0137859 3300046689 Bacteria 1745
225 Ga0496100_0159044 3300048903 Bacteria 1618
226 Ga0496102_0071209 3300048905 Bacteria 3192
227 Ga0496106_0065062 3300048909 Bacteria 2775
228 Ga0496112_0268441 3300048915 Bacteria 1655
229 Ga0496112_0611585 3300048915 Bacteria 1021
230 Ga0501227_019961 3300049665 Bacteria 1532
231 Ga0501257_015353 3300049686 Bacteria 1768
232 nmdc:mga09592_365985_c1 3300050508 Unclassified 1247
233 nmdc:mga09592_94352_c1 3300050508 Bacteria 2559
234 nmdc:mga08y16_11036_c1 3300050511 Bacteria 9485
235 nmdc:mga08y16_14625_c1 3300050511 Bacteria 6119
236 nmdc:mga0n895_29759_c1 3300050512 Bacteria 5211
237 nmdc:mga0n895_71072_c1 3300050512 Unclassified 3450
238 nmdc:mga0rr50_209219_c1 3300050513 Bacteria 1606
239 nmdc:mga0rr50_783_c1 3300050513 Bacteria 17103
240 nmdc:mga08x19_9_c1 3300050514 Bacteria 418852
241 nmdc:mga0a205_174298_c1 3300050515 Bacteria 2046
242 nmdc:mga0a205_247678_c1 3300050515 Unclassified 1662
243 nmdc:mga0a205_85561_c1 3300050515 Bacteria 3045

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_10698955 Ga0157378_106989551 265
2 3300031456 Ga0307513_10005443 Ga0307513_1000544312 270
3 3300005546 Ga0070696_100532008 Ga0070696_1005320081 279
4 3300005549 Ga0070704_100233854 Ga0070704_1002338542 289
5 3300005618 Ga0068864_100038112 Ga0068864_1000381122 289
6 3300005841 Ga0068863_100599780 Ga0068863_1005997801 289
7 3300006237 Ga0097621_100377352 Ga0097621_1003773521 289
8 3300009094 Ga0111539_10076885 Ga0111539_100768853 289
9 3300009147 Ga0114129_10589460 Ga0114129_105894602 289
10 3300011119 Ga0105246_10252722 Ga0105246_102527222 289
11 3300014326 Ga0157380_10019091 Ga0157380_100190914 289
12 3300025923 Ga0207681_10033484 Ga0207681_100334842 289
13 3300025940 Ga0207691_10102105 Ga0207691_101021053 289
14 3300026095 Ga0207676_10007015 Ga0207676_100070156 289
15 3300049665 Ga0501227_019961 Ga0501227_019961_330_1199 289
16 3300049686 Ga0501257_015353 Ga0501257_015353_455_1324 289
17 3300050511 nmdc:mga08y16_14625_c1 nmdc:mga08y16_14625_c1_4046_4915 289
18 3300005336 Ga0070680_100147500 Ga0070680_1001475002 291
19 3300005338 Ga0068868_100338955 Ga0068868_1003389552 291
20 3300005444 Ga0070694_100090313 Ga0070694_1000903132 291
21 3300005457 Ga0070662_100024326 Ga0070662_1000243264 291
22 3300005471 Ga0070698_100168825 Ga0070698_1001688252 291
23 3300005546 Ga0070696_100031104 Ga0070696_1000311043 291
24 3300005617 Ga0068859_100071425 Ga0068859_1000714253 291
25 3300005843 Ga0068860_100105342 Ga0068860_1001053422 291
26 3300006931 Ga0097620_100071422 Ga0097620_1000714223 291
27 3300009094 Ga0111539_10052020 Ga0111539_100520204 291
28 3300013308 Ga0157375_10039172 Ga0157375_100391723 291
29 3300014326 Ga0157380_10070657 Ga0157380_100706572 291
30 3300025917 Ga0207660_10034690 Ga0207660_100346904 291
31 3300025926 Ga0207659_10184664 Ga0207659_101846642 291
32 3300025933 Ga0207706_10038400 Ga0207706_100384004 291
33 3300026023 Ga0207677_10230367 Ga0207677_102303671 291
34 3300027907 Ga0207428_10046223 Ga0207428_100462232 291
35 3300028380 Ga0268265_10203535 Ga0268265_102035352 291
36 3300028381 Ga0268264_10272600 Ga0268264_102726002 291
37 3300050511 nmdc:mga08y16_11036_c1 nmdc:mga08y16_11036_c1_3744_4619 291
38 3300005467 Ga0070706_100007569 Ga0070706_1000075693 292
39 3300005468 Ga0070707_100031352 Ga0070707_1000313523 292
40 3300005518 Ga0070699_100003797 Ga0070699_1000037973 292
41 3300009147 Ga0114129_10628232 Ga0114129_106282322 292
42 3300014325 Ga0163163_10018259 Ga0163163_100182596 292
43 3300048915 Ga0496112_0268441 Ga0496112_0268441_144_1022 292
44 3300050515 nmdc:mga0a205_174298_c1 nmdc:mga0a205_174298_c1_756_1634 292
45 3300005293 Ga0065715_10114094 Ga0065715_101140943 293
46 3300005334 Ga0068869_100027720 Ga0068869_1000277202 293
47 3300005338 Ga0068868_100037098 Ga0068868_1000370983 293
48 3300005340 Ga0070689_100292542 Ga0070689_1002925422 293
49 3300005355 Ga0070671_100572961 Ga0070671_1005729611 293
50 3300005367 Ga0070667_100023107 Ga0070667_1000231074 293
51 3300005458 Ga0070681_10000475 Ga0070681_1000047524 293
52 3300005530 Ga0070679_100000307 Ga0070679_10000030715 293
53 3300005546 Ga0070696_100095141 Ga0070696_1000951411 293
54 3300005547 Ga0070693_100244737 Ga0070693_1002447372 293
55 3300005548 Ga0070665_100061757 Ga0070665_1000617573 293
56 3300005564 Ga0070664_100063145 Ga0070664_1000631452 293
57 3300005616 Ga0068852_100439277 Ga0068852_1004392772 293
58 3300005618 Ga0068864_100140316 Ga0068864_1001403162 293
59 3300005834 Ga0068851_10147228 Ga0068851_101472281 293
60 3300005842 Ga0068858_100006421 Ga0068858_1000064217 293
61 3300005843 Ga0068860_100061529 Ga0068860_1000615293 293
62 3300006237 Ga0097621_100012853 Ga0097621_1000128533 293
63 3300006358 Ga0068871_100024574 Ga0068871_1000245744 293
64 3300009094 Ga0111539_10107550 Ga0111539_101075502 293
65 3300009176 Ga0105242_10687305 Ga0105242_106873051 293
66 3300009177 Ga0105248_10127647 Ga0105248_101276473 293
67 3300009553 Ga0105249_10050497 Ga0105249_100504973 293
68 3300010375 Ga0105239_10672613 Ga0105239_106726131 293
69 3300013297 Ga0157378_10005669 Ga0157378_1000566910 293
70 3300013297 Ga0157378_10158161 Ga0157378_101581611 293
71 3300013306 Ga0163162_10017938 Ga0163162_100179382 293
72 3300013308 Ga0157375_10025809 Ga0157375_100258093 293
73 3300013308 Ga0157375_10218454 Ga0157375_102184542 293
74 3300014325 Ga0163163_10052858 Ga0163163_100528583 293
75 3300014969 Ga0157376_10018281 Ga0157376_100182812 293
76 3300025911 Ga0207654_10267708 Ga0207654_102677081 293
77 3300025912 Ga0207707_10000006 Ga0207707_10000006193 293
78 3300025914 Ga0207671_10469200 Ga0207671_104692001 293
79 3300025917 Ga0207660_10001704 Ga0207660_1000170415 293
80 3300025921 Ga0207652_10000216 Ga0207652_1000021655 293
81 3300025931 Ga0207644_10056356 Ga0207644_100563561 293
82 3300025941 Ga0207711_10118215 Ga0207711_101182151 293
83 3300025945 Ga0207679_10064961 Ga0207679_100649612 293
84 3300025960 Ga0207651_10050554 Ga0207651_100505543 293
85 3300025961 Ga0207712_10017673 Ga0207712_100176734 293
86 3300025981 Ga0207640_10507540 Ga0207640_105075401 293
87 3300025986 Ga0207658_10102453 Ga0207658_101024531 293
88 3300026023 Ga0207677_10029389 Ga0207677_100293893 293
89 3300026035 Ga0207703_10251160 Ga0207703_102511601 293
90 3300026095 Ga0207676_10095428 Ga0207676_100954281 293
91 3300026142 Ga0207698_10130850 Ga0207698_101308503 293
92 3300028381 Ga0268264_10253117 Ga0268264_102531172 293
93 3300048905 Ga0496102_0071209 Ga0496102_0071209_49_930 293
94 3300048915 Ga0496112_0611585 Ga0496112_0611585_38_919 293
95 3300050513 nmdc:mga0rr50_209219_c1 nmdc:mga0rr50_209219_c1_697_1578 293
96 3300009148 Ga0105243_10090322 Ga0105243_100903222 294
97 3300013308 Ga0157375_10800167 Ga0157375_108001671 294
98 3300025935 Ga0207709_10073695 Ga0207709_100736952 294
99 3300005330 Ga0070690_100013689 Ga0070690_1000136892 295
100 3300005335 Ga0070666_10166506 Ga0070666_101665062 295
101 3300005347 Ga0070668_100397470 Ga0070668_1003974702 295
102 3300005364 Ga0070673_100259968 Ga0070673_1002599682 295
103 3300005544 Ga0070686_100075449 Ga0070686_1000754492 295
104 3300005617 Ga0068859_100851824 Ga0068859_1008518241 295
105 3300005719 Ga0068861_100406770 Ga0068861_1004067702 295
106 3300005844 Ga0068862_100145807 Ga0068862_1001458072 295
107 3300006931 Ga0097620_100851841 Ga0097620_1008518411 295
108 3300009553 Ga0105249_10669192 Ga0105249_106691921 295
109 3300014326 Ga0157380_10021627 Ga0157380_100216272 295
110 3300037471 Ga0395905_0273053 Ga0395905_0273053_486_1376 296
111 3300038443 Ga0395901_0102149 Ga0395901_0102149_854_1744 296
112 3300005985 Ga0081539_10000731 Ga0081539_1000073126 297
113 3300005468 Ga0070707_100000107 Ga0070707_10000010772 303
114 3300005471 Ga0070698_100153730 Ga0070698_1001537301 303
115 3300005549 Ga0070704_100018552 Ga0070704_1000185524 303
116 3300006852 Ga0075433_10090137 Ga0075433_100901372 303
117 3300025922 Ga0207646_10000543 Ga0207646_1000054311 303
118 3300046689 Ga0495613_0137859 Ga0495613_0137859_490_1521 303
119 3300050512 nmdc:mga0n895_71072_c1 nmdc:mga0n895_71072_c1_919_1944 303
120 3300050515 nmdc:mga0a205_85561_c1 nmdc:mga0a205_85561_c1_1262_2287 303
121 3300005544 Ga0070686_100323017 Ga0070686_1003230171 304
122 3300013297 Ga0157378_10482279 Ga0157378_104822792 304
123 3300017792 Ga0163161_10292474 Ga0163161_102924742 304
124 3300005842 Ga0068858_100016372 Ga0068858_1000163722 305
125 3300026035 Ga0207703_10077991 Ga0207703_100779912 305
126 3300005471 Ga0070698_100061857 Ga0070698_1000618572 306
127 3300005444 Ga0070694_100052731 Ga0070694_1000527314 307
128 3300050508 nmdc:mga09592_365985_c1 nmdc:mga09592_365985_c1_140_1177 307
129 3300005340 Ga0070689_100298267 Ga0070689_1002982671 309
130 3300005347 Ga0070668_100000259 Ga0070668_1000002594 309
131 3300005618 Ga0068864_100188215 Ga0068864_1001882152 309
132 3300005843 Ga0068860_100033131 Ga0068860_1000331315 309
133 3300006880 Ga0075429_100229787 Ga0075429_1002297872 309
134 3300006914 Ga0075436_100000002 Ga0075436_100000002217 309
135 3300007076 Ga0075435_100002379 Ga0075435_1000023793 309
136 3300009176 Ga0105242_10006789 Ga0105242_100067897 309
137 3300009176 Ga0105242_10215927 Ga0105242_102159272 309
138 3300009176 Ga0105242_10447527 Ga0105242_104475271 309
139 3300009553 Ga0105249_10000044 Ga0105249_10000044143 309
140 3300013306 Ga0163162_10000025 Ga0163162_1000002514 309
141 3300013306 Ga0163162_10242321 Ga0163162_102423211 309
142 3300025934 Ga0207686_10000127 Ga0207686_1000012730 309
143 3300025935 Ga0207709_10290143 Ga0207709_102901432 309
144 3300025961 Ga0207712_10000039 Ga0207712_1000003929 309
145 3300025972 Ga0207668_10000519 Ga0207668_1000051916 309
146 3300028381 Ga0268264_10017789 Ga0268264_100177892 309
147 3300046477 Ga0495664_0026020 Ga0495664_0026020_1956_2987 309
148 3300050508 nmdc:mga09592_94352_c1 nmdc:mga09592_94352_c1_304_1341 309
149 3300050513 nmdc:mga0rr50_783_c1 nmdc:mga0rr50_783_c1_14399_15427 309
150 3300050514 nmdc:mga08x19_9_c1 nmdc:mga08x19_9_c1_163356_164384 309
151 3300005334 Ga0068869_100092991 Ga0068869_1000929911 310
152 3300005340 Ga0070689_100122404 Ga0070689_1001224042 310
153 3300005354 Ga0070675_100055867 Ga0070675_1000558671 310
154 3300005406 Ga0070703_10000205 Ga0070703_100002054 310
155 3300005434 Ga0070709_10038177 Ga0070709_100381772 310
156 3300005441 Ga0070700_100006731 Ga0070700_1000067315 310
157 3300005445 Ga0070708_100029340 Ga0070708_1000293403 310
158 3300005467 Ga0070706_100067101 Ga0070706_1000671012 310
159 3300005467 Ga0070706_100092237 Ga0070706_1000922371 310
160 3300005468 Ga0070707_100029270 Ga0070707_1000292705 310
161 3300005468 Ga0070707_100036757 Ga0070707_1000367571 310
162 3300005468 Ga0070707_100046298 Ga0070707_1000462985 310
163 3300005468 Ga0070707_100145826 Ga0070707_1001458262 310
164 3300005471 Ga0070698_100000063 Ga0070698_10000006313 310
165 3300005471 Ga0070698_100060748 Ga0070698_1000607483 310
166 3300005536 Ga0070697_100069034 Ga0070697_1000690342 310
167 3300005546 Ga0070696_100077036 Ga0070696_1000770362 310
168 3300005549 Ga0070704_100089311 Ga0070704_1000893111 310
169 3300005617 Ga0068859_100158006 Ga0068859_1001580061 310
170 3300005618 Ga0068864_100050872 Ga0068864_1000508723 310
171 3300005842 Ga0068858_100123909 Ga0068858_1001239092 310
172 3300005844 Ga0068862_100236890 Ga0068862_1002368902 310
173 3300006163 Ga0070715_10000002 Ga0070715_10000002217 310
174 3300006852 Ga0075433_10102818 Ga0075433_101028182 310
175 3300006871 Ga0075434_100019279 Ga0075434_1000192794 310
176 3300006931 Ga0097620_100158016 Ga0097620_1001580161 310
177 3300007076 Ga0075435_100231807 Ga0075435_1002318072 310
178 3300009094 Ga0111539_10191061 Ga0111539_101910612 310
179 3300009147 Ga0114129_10217804 Ga0114129_102178041 310
180 3300009177 Ga0105248_10044864 Ga0105248_100448645 310
181 3300009553 Ga0105249_10172749 Ga0105249_101727492 310
182 3300009553 Ga0105249_10311925 Ga0105249_103119252 310
183 3300011119 Ga0105246_10209604 Ga0105246_102096042 310
184 3300013297 Ga0157378_10012428 Ga0157378_100124287 310
185 3300013297 Ga0157378_10076124 Ga0157378_100761243 310
186 3300013297 Ga0157378_10394241 Ga0157378_103942411 310
187 3300013306 Ga0163162_10064052 Ga0163162_100640522 310
188 3300025885 Ga0207653_10000209 Ga0207653_100002094 310
189 3300025885 Ga0207653_10022003 Ga0207653_100220032 310
190 3300025906 Ga0207699_10146249 Ga0207699_101462492 310
191 3300025910 Ga0207684_10017245 Ga0207684_100172457 310
192 3300025922 Ga0207646_10015280 Ga0207646_100152802 310
193 3300025922 Ga0207646_10033595 Ga0207646_100335952 310
194 3300025922 Ga0207646_10151329 Ga0207646_101513292 310
195 3300025922 Ga0207646_10288302 Ga0207646_102883022 310
196 3300025935 Ga0207709_10026481 Ga0207709_100264812 310
197 3300026023 Ga0207677_10260962 Ga0207677_102609621 310
198 3300026075 Ga0207708_10011413 Ga0207708_100114134 310
199 3300027907 Ga0207428_10013055 Ga0207428_100130555 310
200 3300050512 nmdc:mga0n895_29759_c1 nmdc:mga0n895_29759_c1_1112_2119 310
201 3300050515 nmdc:mga0a205_247678_c1 nmdc:mga0a205_247678_c1_460_1533 310
202 3300002074 JGI24748J21848_1000001 JGI24748J21848_1000001217 311
203 3300002239 JGI24034J26672_10000001 JGI24034J26672_10000001200 311
204 3300005338 Ga0068868_100072812 Ga0068868_1000728121 311
205 3300005364 Ga0070673_100015372 Ga0070673_1000153722 311
206 3300005444 Ga0070694_100008993 Ga0070694_1000089933 311
207 3300005445 Ga0070708_100394923 Ga0070708_1003949232 311
208 3300005467 Ga0070706_100044250 Ga0070706_1000442501 311
209 3300005536 Ga0070697_100019460 Ga0070697_1000194604 311
210 3300005842 Ga0068858_100000044 Ga0068858_10000004476 311
211 3300006173 Ga0070716_100000004 Ga0070716_100000004132 311
212 3300009098 Ga0105245_10074425 Ga0105245_100744252 311
213 3300009101 Ga0105247_10000004 Ga0105247_10000004238 311
214 3300009148 Ga0105243_10000037 Ga0105243_1000003750 311
215 3300009148 Ga0105243_10000240 Ga0105243_1000024034 311
216 3300009148 Ga0105243_10022998 Ga0105243_100229982 311
217 3300009176 Ga0105242_10000276 Ga0105242_100002766 311
218 3300009176 Ga0105242_10001016 Ga0105242_100010168 311
219 3300009553 Ga0105249_10097941 Ga0105249_100979413 311
220 3300010375 Ga0105239_10099128 Ga0105239_100991283 311
221 3300013297 Ga0157378_10000025 Ga0157378_1000002575 311
222 3300013297 Ga0157378_10086881 Ga0157378_100868814 311
223 3300013297 Ga0157378_10333979 Ga0157378_103339792 311
224 3300013308 Ga0157375_10031747 Ga0157375_100317474 311
225 3300014968 Ga0157379_10043304 Ga0157379_100433042 311
226 3300014968 Ga0157379_10403613 Ga0157379_104036131 311
227 3300025223 Ga0207672_1000249 Ga0207672_10002494 311
228 3300025900 Ga0207710_10000002 Ga0207710_10000002775 311
229 3300025905 Ga0207685_10000002 Ga0207685_10000002227 311
230 3300025910 Ga0207684_10060624 Ga0207684_100606242 311
231 3300025931 Ga0207644_10000623 Ga0207644_100006236 311
232 3300025934 Ga0207686_10000003 Ga0207686_10000003239 311
233 3300025934 Ga0207686_10000925 Ga0207686_1000092512 311
234 3300025935 Ga0207709_10000017 Ga0207709_10000017298 311
235 3300025935 Ga0207709_10000884 Ga0207709_1000088415 311
236 3300025938 Ga0207704_10117221 Ga0207704_101172212 311
237 3300025939 Ga0207665_10000006 Ga0207665_1000000680 311
238 3300025942 Ga0207689_10010385 Ga0207689_100103855 311
239 3300026035 Ga0207703_10000032 Ga0207703_1000003277 311
240 3300026118 Ga0207675_100024694 Ga0207675_1000246944 311
241 3300045051 Ga0451576_0022354 Ga0451576_0022354_1465_2490 311
242 3300048903 Ga0496100_0159044 Ga0496100_0159044_544_1563 311
243 3300048909 Ga0496106_0065062 Ga0496106_0065062_1637_2656 311

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x0n-assembly2.cif.gz_C regulatory domain of variant c227s aphb from vibrio vulnificus 0.5026 284 311
4ztu-assembly1.cif.gz_C structural basis for processivity and antiviral drug toxicity in human mitochondrial dna replicase 0.3227 85 131
2g4c-assembly2.cif.gz_D crystal structure of human dna polymerase gamma accessory subunit 0.3153 77 131
4bw9-assembly1.cif.gz_A-2 pylrs y306g, y384f, i405r mutant in complex with amp-pnp 0.3063 70 127
4qhj-assembly1.cif.gz_B crystal structure of methanocaldococcus jannaschii selecase mutant i100f+h107f 0.301 148 248
ID Description Score Start End Superfamily
af_A0A0R4IHF6_384_488_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.424 77 127 3.30.200.20
3fulA02 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.391 153 221 3.30.2010.30
af_A0A1D6P7W3_1_91_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.3665 77 118 3.30.200.20
af_P32742_14_103_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.3537 91 130 3.30.200.20
af_Q21199_43_258_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.3495 180 213 3.80.10.10
ID Description Score Start End GO Terms
AF-A0A2V8Q3C8-F1-model_v4 Uncharacterized protein 0.9419 3 311
AF-A0A1Q7Y7D7-F1-model_v4 Uncharacterized protein 0.9347 1 311
AF-A0A2V8Q3C8-F1-model_v4 Uncharacterized protein 0.933 3 311
AF-A0A1Q7Y7D7-F1-model_v4 Uncharacterized protein 0.9316 1 311
AF-A0A2V9I2U1-F1-model_v4 Uncharacterized protein 0.9147 1 307

Feature Viewer

pLDDT pTM Quality
87.53 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map