F355084

General Info

Members Datasets Scaffolds Average Seq Length
242 189 484 136

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0105671|Ga0501044_0105671_1034_1477
Length 147
Sequence MDFTTHPREHAMDLAIHSSFLPQNDPDAALAFWRDTLGFEVRNDVGYGGKRWITVGPKGQPGTSIVLYPPEASPGVTDDERRTIAEMMAKGTYGMVILASTDLDATFHRLQSGGAEVVQEPTEQPYGVRDCAFRDPAGNHVRINETR

Samples

Sample ID Description Type Environment
1 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
2 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
39 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
42 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
43 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
44 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
45 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
46 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
86 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
87 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
89 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
90 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
91 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
92 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
93 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
94 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
95 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
97 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
106 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
107 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
108 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
109 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
110 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
111 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
112 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
113 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
114 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
119 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
120 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
130 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
183 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
186 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
189 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.76
Metatranscriptomes 0.41
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.72
Nodule 0
Rhizoplane 9.5
Rhizosphere 83.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501044_0105671 3300049823 Bacteria 2828
2 Ga0065165_1000386 3300005262 Bacteria 71435
3 Ga0070690_100098120 3300005330 Bacteria 1939
4 Ga0068869_100603198 3300005334 Bacteria 928
5 Ga0070714_101148295 3300005435 Bacteria 757
6 Ga0070713_100617997 3300005436 Bacteria 1030
7 Ga0070711_100279393 3300005439 Bacteria 1320
8 Ga0070705_101116080 3300005440 Bacteria 646
9 Ga0068867_100238035 3300005459 Bacteria 1475
10 Ga0070706_100006812 3300005467 Bacteria 10788
11 Ga0070707_100001287 3300005468 Bacteria 24686
12 Ga0070698_100001681 3300005471 Bacteria 24676
13 Ga0070684_100120742 3300005535 Bacteria 2358
14 Ga0070665_100346769 3300005548 Bacteria 1490
15 Ga0068855_100260770 3300005563 Bacteria 1931
16 Ga0068857_100098733 3300005577 Bacteria 2619
17 Ga0068856_100248386 3300005614 Bacteria 1794
18 Ga0068856_100464470 3300005614 Bacteria 1286
19 Ga0070702_100411953 3300005615 Bacteria 970
20 Ga0068852_100000534 3300005616 Bacteria 24968
21 Ga0068852_100517943 3300005616 Bacteria 1190
22 Ga0068863_100240686 3300005841 Bacteria 1746
23 Ga0068858_100104659 3300005842 Bacteria 2641
24 Ga0068858_101587432 3300005842 Bacteria 646
25 Ga0081539_10004053 3300005985 Bacteria 16773
26 Ga0070717_10279501 3300006028 Bacteria 1480
27 Ga0070717_11038301 3300006028 Bacteria 746
28 Ga0070717_11038302 3300006028 Bacteria 746
29 Ga0070717_11239356 3300006028 Bacteria 679
30 Ga0070715_10695511 3300006163 Bacteria 607
31 Ga0070716_100156352 3300006173 Bacteria 1472
32 Ga0070712_100272157 3300006175 Bacteria 1361
33 Ga0070712_101103881 3300006175 Bacteria 688
34 Ga0075362_10732659 3300006177 Bacteria 517
35 Ga0097621_100204251 3300006237 Bacteria 1717
36 Ga0097621_100744514 3300006237 Bacteria 905
37 Ga0075370_10049564 3300006353 Bacteria 2381
38 Ga0068865_100847049 3300006881 Bacteria 792
39 Ga0075436_100197624 3300006914 Bacteria 1424
40 Ga0111539_12536761 3300009094 Bacteria 594
41 Ga0105245_10037800 3300009098 Bacteria 4293
42 Ga0105247_10238137 3300009101 Bacteria 1239
43 Ga0105247_10359649 3300009101 Bacteria 1026
44 Ga0105237_10162811 3300009545 Bacteria 2230
45 Ga0105237_10569980 3300009545 Bacteria 1139
46 Ga0105238_10297096 3300009551 Bacteria 1598
47 Ga0105249_11332277 3300009553 Bacteria 790
48 Ga0105148_100643 3300009978 Bacteria 2816
49 Ga0105032_101675 3300009979 Bacteria 2009
50 Ga0105239_10284572 3300010375 Bacteria 1862
51 Ga0105239_11294083 3300010375 Bacteria 841
52 Ga0157340_1001445 3300012473 Bacteria 1093
53 Ga0157320_1031014 3300012481 Bacteria 539
54 Ga0157335_1009611 3300012492 Bacteria 763
55 Ga0157314_1029665 3300012500 Bacteria 608
56 Ga0157339_1062582 3300012505 Bacteria 520
57 Ga0157315_1044536 3300012508 Bacteria 575
58 Ga0157370_10077896 3300013104 Bacteria 3122
59 Ga0157369_10208376 3300013105 Bacteria 2050
60 Ga0157369_10432010 3300013105 Bacteria 1365
61 Ga0157374_10086980 3300013296 Bacteria 2975
62 Ga0157374_10901563 3300013296 Bacteria 902
63 Ga0157375_10246221 3300013308 Bacteria 1948
64 Ga0157375_10854148 3300013308 Bacteria 1057
65 Ga0157375_12823942 3300013308 Bacteria 581
66 Ga0163163_10532395 3300014325 Bacteria 1237
67 Ga0163163_12255887 3300014325 Bacteria 603
68 Ga0157377_10085407 3300014745 Bacteria 1853
69 Ga0157379_10074485 3300014968 Bacteria 3039
70 Ga0157376_10043948 3300014969 Bacteria 3670
71 Ga0157376_10247089 3300014969 Bacteria 1665
72 Ga0157376_12536494 3300014969 Bacteria 552
73 Ga0209130_1063989 3300025284 Bacteria 629
74 Ga0209676_1004986 3300025292 Bacteria 7120
75 Ga0209256_1006309 3300025299 Bacteria 6346
76 Ga0207426_1017521 3300025302 Bacteria 2546
77 Ga0207692_10229928 3300025898 Bacteria 1103
78 Ga0207710_10142990 3300025900 Bacteria 1156
79 Ga0207685_10158484 3300025905 Bacteria 1031
80 Ga0207699_10053651 3300025906 Bacteria 2391
81 Ga0207684_10002217 3300025910 Bacteria 19817
82 Ga0207671_10238498 3300025914 Bacteria 1428
83 Ga0207671_11234465 3300025914 Bacteria 584
84 Ga0207693_10477602 3300025915 Bacteria 973
85 Ga0207693_10733360 3300025915 Bacteria 764
86 Ga0207693_10733469 3300025915 Bacteria 764
87 Ga0207663_10319774 3300025916 Bacteria 1166
88 Ga0207646_10000136 3300025922 Bacteria 100383
89 Ga0207659_10514394 3300025926 Bacteria 1015
90 Ga0207687_10210844 3300025927 Bacteria 1524
91 Ga0207700_10123495 3300025928 Bacteria 2102
92 Ga0207664_10255021 3300025929 Bacteria 1532
93 Ga0207669_11588723 3300025937 Bacteria 558
94 Ga0207704_10320955 3300025938 Bacteria 1195
95 Ga0207665_10319033 3300025939 Bacteria 1165
96 Ga0207677_10148631 3300026023 Bacteria 1804
97 Ga0207703_10522032 3300026035 Bacteria 1117
98 Ga0207702_10273606 3300026078 Bacteria 1594
99 Ga0207702_10356851 3300026078 Bacteria 1400
100 Ga0207674_10108583 3300026116 Bacteria 2751
101 Ga0207698_10045229 3300026142 Bacteria 3315
102 Ga0268266_10346681 3300028379 Bacteria 1395
103 Ga0307409_100210266 3300031995 Bacteria 1748
104 Ga0307409_100937222 3300031995 Bacteria 881
105 Ga0307414_10639380 3300032004 Bacteria 958
106 Ga0307411_10872004 3300032005 Bacteria 798
107 Ga0307415_101699972 3300032126 Bacteria 608
108 Ga0373934_0240492 3300035086 Bacteria 748
109 Ga0373944_0081990 3300035089 Bacteria 1066
110 Ga0373936_0175598 3300035113 Bacteria 938
111 Ga0373945_0042145 3300035116 Bacteria 1653
112 Ga0373945_0234837 3300035116 Bacteria 770
113 Ga0373953_0133016 3300035117 Bacteria 1061
114 Ga0373954_0203697 3300035118 Bacteria 972
115 Ga0373956_0371890 3300035119 Bacteria 681
116 Ga0373957_0075062 3300035120 Bacteria 1328
117 Ga0373957_0250236 3300035120 Bacteria 746
118 Ga0373946_0092866 3300035171 Bacteria 1340
119 Ga0373955_0624463 3300035172 Bacteria 660
120 Ga0373924_0007786 3300035410 Bacteria 3873
121 Ga0373933_1124614 3300035724 Bacteria 517
122 Ga0373947_0276567 3300035725 Bacteria 1115
123 Ga0373937_0306167 3300036401 Bacteria 1502
124 Ga0373925_0276607 3300037068 Bacteria 1351
125 Ga0373925_0351211 3300037068 Bacteria 1197
126 Ga0395899_0281261 3300037312 Bacteria 1132
127 Ga0395899_0289256 3300037312 Bacteria 1112
128 Ga0395900_0090646 3300037418 Bacteria 3142
129 Ga0395900_0759528 3300037418 Bacteria 899
130 Ga0395898_0040377 3300037466 Bacteria 4614
131 Ga0395898_0050451 3300037466 Bacteria 4072
132 Ga0395898_0141142 3300037466 Bacteria 2306
133 Ga0395905_0625636 3300037471 Bacteria 978
134 Ga0395905_0754682 3300037471 Bacteria 875
135 Ga0395901_0007602 3300038443 Bacteria 10942
136 Ga0395901_0303701 3300038443 Bacteria 1654
137 Ga0436360_1225550 3300039438 Bacteria 693
138 Ga0451791_0019136 3300041451 Bacteria 506
139 Ga0451793_0976840 3300041452 Bacteria 1259
140 Ga0451798_0099460 3300041458 Bacteria 887
141 Ga0451847_0871468 3300041503 Bacteria 506
142 Ga0451849_1574183 3300041505 Bacteria 1442
143 Ga0439448_0088355 3300042005 Bacteria 1045
144 Ga0439463_006433 3300042016 Bacteria 2914
145 Ga0450914_058087 3300042118 Bacteria 520
146 Ga0450895_034063 3300042132 Bacteria 504
147 Ga0466966_0082100 3300044684 Bacteria 2006
148 Ga0466961_0020807 3300044693 Bacteria 4223
149 Ga0466963_0871366 3300044694 Bacteria 635
150 Ga0466964_0171566 3300044706 Bacteria 1022
151 Ga0466971_0194533 3300044719 Bacteria 956
152 Ga0466960_0165461 3300044901 Bacteria 1190
153 Ga0466959_0072341 3300045049 Bacteria 2496
154 Ga0466959_0211365 3300045049 Bacteria 1348
155 Ga0451576_0126619 3300045051 Bacteria 2661
156 Ga0466958_0521988 3300045836 Bacteria 771
157 Ga0466967_0205870 3300045976 Bacteria 1865
158 Ga0466967_0318645 3300045976 Bacteria 1499
159 Ga0466967_1757568 3300045976 Bacteria 617
160 Ga0495592_0221284 3300046454 Bacteria 1265
161 Ga0495592_0561481 3300046454 Bacteria 700
162 Ga0495629_0113761 3300046459 Bacteria 1886
163 Ga0495651_0033101 3300046462 Bacteria 4031
164 Ga0495653_0089593 3300046463 Bacteria 2253
165 Ga0495639_0068506 3300046475 Bacteria 1636
166 Ga0495662_0100507 3300046476 Bacteria 1415
167 Ga0495664_0076326 3300046477 Bacteria 2005
168 Ga0495664_0640223 3300046477 Bacteria 630
169 Ga0495608_0068262 3300046511 Bacteria 2324
170 Ga0495618_0067426 3300046514 Bacteria 2275
171 Ga0495618_0838521 3300046514 Bacteria 533
172 Ga0495628_0209561 3300046516 Bacteria 1466
173 Ga0495628_0428167 3300046516 Bacteria 963
174 Ga0495630_0126164 3300046517 Bacteria 1942
175 Ga0495652_0032373 3300046529 Bacteria 4573
176 Ga0495665_0070563 3300046531 Bacteria 1841
177 Ga0495640_0008936 3300046533 Bacteria 7823
178 Ga0495586_0225154 3300046535 Bacteria 1066
179 Ga0495587_0005673 3300046536 Bacteria 8136
180 Ga0495645_0055762 3300046543 Bacteria 2869
181 Ga0495667_0014511 3300046559 Bacteria 5321
182 Ga0495634_0089018 3300046642 Bacteria 2007
183 Ga0495634_0438101 3300046642 Bacteria 772
184 Ga0495635_0025199 3300046663 Bacteria 4142
185 Ga0495657_0054887 3300046675 Bacteria 2659
186 Ga0495657_0164880 3300046675 Bacteria 1368
187 Ga0495599_0047324 3300046678 Bacteria 2695
188 Ga0495623_0042340 3300046679 Bacteria 2901
189 Ga0495658_0339849 3300046683 Bacteria 953
190 Ga0495613_0071979 3300046689 Bacteria 2520
191 Ga0495624_0021353 3300046690 Bacteria 4294
192 Ga0495600_0011551 3300046809 Bacteria 5507
193 Ga0495604_0437121 3300047317 Bacteria 856
194 Ga0495674_1166829 3300047319 Bacteria 583
195 Ga0495680_0038482 3300047322 Bacteria 3821
196 Ga0495675_0058695 3300047444 Bacteria 2439
197 Ga0495684_0049469 3300047471 Bacteria 3211
198 Ga0495593_0142320 3300047673 Bacteria 1215
199 Ga0495602_0059094 3300048088 Bacteria 3350
200 Ga0495602_0560653 3300048088 Bacteria 790
201 Ga0496101_0473456 3300048904 Bacteria 989
202 Ga0496104_0040532 3300048907 Bacteria 4365
203 Ga0496105_0318745 3300048908 Bacteria 1246
204 Ga0496105_0536506 3300048908 Bacteria 915
205 Ga0496108_0591123 3300048911 Bacteria 967
206 Ga0496108_0877775 3300048911 Bacteria 771
207 Ga0496109_0083874 3300048912 Bacteria 2939
208 Ga0496109_0227301 3300048912 Bacteria 1755
209 Ga0496109_0645602 3300048912 Bacteria 995
210 Ga0496110_0117269 3300048913 Bacteria 2397
211 Ga0496111_0079731 3300048914 Bacteria 2389
212 Ga0496111_0144358 3300048914 Bacteria 1764
213 Ga0496111_0837421 3300048914 Bacteria 664
214 Ga0496112_0108818 3300048915 Bacteria 2742
215 Ga0496112_0207424 3300048915 Bacteria 1917
216 Ga0496112_1130027 3300048915 Bacteria 701
217 Ga0496113_0093497 3300048916 Bacteria 2321
218 Ga0496113_0283721 3300048916 Bacteria 1324
219 Ga0496114_0491166 3300048917 Bacteria 1086
220 Ga0496115_0000793 3300048918 Bacteria 23183
221 Ga0496120_0000015 3300048923 Bacteria 310795
222 Ga0496124_0103813 3300048927 Bacteria 2299
223 Ga0496126_0000813 3300048929 Bacteria 55711
224 Ga0496126_0019611 3300048929 Bacteria 6658
225 Ga0501308_002347 3300049128 Bacteria 1652
226 Ga0501043_0501295 3300049579 Bacteria 907
227 Ga0501071_0373764 3300049587 Bacteria 1086
228 Ga0501075_0314126 3300049591 Bacteria 1194
229 Ga0501075_1351046 3300049591 Bacteria 540
230 Ga0501076_0428468 3300049592 Bacteria 1089
231 nmdc:mga05p37_1669134_c1 3300050507 Bacteria 623
232 nmdc:mga0n895_274305_c1 3300050512 Bacteria 1710
233 nmdc:mga0rr50_1142404_c1 3300050513 Bacteria 662
234 nmdc:mga08x19_495953_c1 3300050514 Bacteria 862
235 Ga0495612_0068198 3300053078 Bacteria 1480
236 Ga0495595_0020518 3300053084 Bacteria 2877
237 Ga0495619_0026754 3300053085 Bacteria 3713
238 Ga0500572_061955 3300053111 Bacteria 1139
239 Ga0500661_001929 3300055283 Bacteria 3912
240 Ga0501082_0312334 3300060353 Bacteria 1369
241 2832007040 2832004796 Bacteria 6538017
242 2866070346 2866065130 Bacteria 6518152
243 Ga0501044_0105671
244 Ga0065165_1000386
245 Ga0070690_100098120
246 Ga0068869_100603198
247 Ga0070714_101148295
248 Ga0070713_100617997
249 Ga0070711_100279393
250 Ga0070705_101116080
251 Ga0068867_100238035
252 Ga0070706_100006812
253 Ga0070707_100001287
254 Ga0070698_100001681
255 Ga0070684_100120742
256 Ga0070665_100346769
257 Ga0068855_100260770
258 Ga0068857_100098733
259 Ga0068856_100248386
260 Ga0068856_100464470
261 Ga0070702_100411953
262 Ga0068852_100000534
263 Ga0068852_100517943
264 Ga0068863_100240686
265 Ga0068858_100104659
266 Ga0068858_101587432
267 Ga0081539_10004053
268 Ga0070717_10279501
269 Ga0070717_11038301
270 Ga0070717_11038302
271 Ga0070717_11239356
272 Ga0070715_10695511
273 Ga0070716_100156352
274 Ga0070712_100272157
275 Ga0070712_101103881
276 Ga0075362_10732659
277 Ga0097621_100204251
278 Ga0097621_100744514
279 Ga0075370_10049564
280 Ga0068865_100847049
281 Ga0075436_100197624
282 Ga0111539_12536761
283 Ga0105245_10037800
284 Ga0105247_10238137
285 Ga0105247_10359649
286 Ga0105237_10162811
287 Ga0105237_10569980
288 Ga0105238_10297096
289 Ga0105249_11332277
290 Ga0105148_100643
291 Ga0105032_101675
292 Ga0105239_10284572
293 Ga0105239_11294083
294 Ga0157340_1001445
295 Ga0157320_1031014
296 Ga0157335_1009611
297 Ga0157314_1029665
298 Ga0157339_1062582
299 Ga0157315_1044536
300 Ga0157370_10077896
301 Ga0157369_10208376
302 Ga0157369_10432010
303 Ga0157374_10086980
304 Ga0157374_10901563
305 Ga0157375_10246221
306 Ga0157375_10854148
307 Ga0157375_12823942
308 Ga0163163_10532395
309 Ga0163163_12255887
310 Ga0157377_10085407
311 Ga0157379_10074485
312 Ga0157376_10043948
313 Ga0157376_10247089
314 Ga0157376_12536494
315 Ga0209130_1063989
316 Ga0209676_1004986
317 Ga0209256_1006309
318 Ga0207426_1017521
319 Ga0207692_10229928
320 Ga0207710_10142990
321 Ga0207685_10158484
322 Ga0207699_10053651
323 Ga0207684_10002217
324 Ga0207671_10238498
325 Ga0207671_11234465
326 Ga0207693_10477602
327 Ga0207693_10733360
328 Ga0207693_10733469
329 Ga0207663_10319774
330 Ga0207646_10000136
331 Ga0207659_10514394
332 Ga0207687_10210844
333 Ga0207700_10123495
334 Ga0207664_10255021
335 Ga0207669_11588723
336 Ga0207704_10320955
337 Ga0207665_10319033
338 Ga0207677_10148631
339 Ga0207703_10522032
340 Ga0207702_10273606
341 Ga0207702_10356851
342 Ga0207674_10108583
343 Ga0207698_10045229
344 Ga0268266_10346681
345 Ga0307409_100210266
346 Ga0307409_100937222
347 Ga0307414_10639380
348 Ga0307411_10872004
349 Ga0307415_101699972
350 Ga0373934_0240492
351 Ga0373944_0081990
352 Ga0373936_0175598
353 Ga0373945_0042145
354 Ga0373945_0234837
355 Ga0373953_0133016
356 Ga0373954_0203697
357 Ga0373956_0371890
358 Ga0373957_0075062
359 Ga0373957_0250236
360 Ga0373946_0092866
361 Ga0373955_0624463
362 Ga0373924_0007786
363 Ga0373933_1124614
364 Ga0373947_0276567
365 Ga0373937_0306167
366 Ga0373925_0276607
367 Ga0373925_0351211
368 Ga0395899_0281261
369 Ga0395899_0289256
370 Ga0395900_0090646
371 Ga0395900_0759528
372 Ga0395898_0040377
373 Ga0395898_0050451
374 Ga0395898_0141142
375 Ga0395905_0625636
376 Ga0395905_0754682
377 Ga0395901_0007602
378 Ga0395901_0303701
379 Ga0436360_1225550
380 Ga0451791_0019136
381 Ga0451793_0976840
382 Ga0451798_0099460
383 Ga0451847_0871468
384 Ga0451849_1574183
385 Ga0439448_0088355
386 Ga0439463_006433
387 Ga0450914_058087
388 Ga0450895_034063
389 Ga0466966_0082100
390 Ga0466961_0020807
391 Ga0466963_0871366
392 Ga0466964_0171566
393 Ga0466971_0194533
394 Ga0466960_0165461
395 Ga0466959_0072341
396 Ga0466959_0211365
397 Ga0451576_0126619
398 Ga0466958_0521988
399 Ga0466967_0205870
400 Ga0466967_0318645
401 Ga0466967_1757568
402 Ga0495592_0221284
403 Ga0495592_0561481
404 Ga0495629_0113761
405 Ga0495651_0033101
406 Ga0495653_0089593
407 Ga0495639_0068506
408 Ga0495662_0100507
409 Ga0495664_0076326
410 Ga0495664_0640223
411 Ga0495608_0068262
412 Ga0495618_0067426
413 Ga0495618_0838521
414 Ga0495628_0209561
415 Ga0495628_0428167
416 Ga0495630_0126164
417 Ga0495652_0032373
418 Ga0495665_0070563
419 Ga0495640_0008936
420 Ga0495586_0225154
421 Ga0495587_0005673
422 Ga0495645_0055762
423 Ga0495667_0014511
424 Ga0495634_0089018
425 Ga0495634_0438101
426 Ga0495635_0025199
427 Ga0495657_0054887
428 Ga0495657_0164880
429 Ga0495599_0047324
430 Ga0495623_0042340
431 Ga0495658_0339849
432 Ga0495613_0071979
433 Ga0495624_0021353
434 Ga0495600_0011551
435 Ga0495604_0437121
436 Ga0495674_1166829
437 Ga0495680_0038482
438 Ga0495675_0058695
439 Ga0495684_0049469
440 Ga0495593_0142320
441 Ga0495602_0059094
442 Ga0495602_0560653
443 Ga0496101_0473456
444 Ga0496104_0040532
445 Ga0496105_0318745
446 Ga0496105_0536506
447 Ga0496108_0591123
448 Ga0496108_0877775
449 Ga0496109_0083874
450 Ga0496109_0227301
451 Ga0496109_0645602
452 Ga0496110_0117269
453 Ga0496111_0079731
454 Ga0496111_0144358
455 Ga0496111_0837421
456 Ga0496112_0108818
457 Ga0496112_0207424
458 Ga0496112_1130027
459 Ga0496113_0093497
460 Ga0496113_0283721
461 Ga0496114_0491166
462 Ga0496115_0000793
463 Ga0496120_0000015
464 Ga0496124_0103813
465 Ga0496126_0000813
466 Ga0496126_0019611
467 Ga0501308_002347
468 Ga0501043_0501295
469 Ga0501071_0373764
470 Ga0501075_0314126
471 Ga0501075_1351046
472 Ga0501076_0428468
473 nmdc:mga05p37_1669134_c1
474 nmdc:mga0n895_274305_c1
475 nmdc:mga0rr50_1142404_c1
476 nmdc:mga08x19_495953_c1
477 Ga0495612_0068198
478 Ga0495595_0020518
479 Ga0495619_0026754
480 Ga0500572_061955
481 Ga0500661_001929
482 Ga0501082_0312334
483 2832007040
484 2866070346

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

10

143

0.88

PF18029

Glyoxalase_6

Glyoxalase-like domain

19

144

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8823 1 135
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8792 2 134
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8761 1 135
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8753 1 135
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8692 1 135
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9452 83 132 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9188 83 134 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8747 83 132 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8585 84 136 3.30.720.110
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.848 1 135 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A6B3EIF2-F1-model_v4 VOC family protein 0.9965 85 136
AF-A0A535RXX1-F1-model_v4 VOC family protein 0.9959 1 135
AF-A0A7K0DU72-F1-model_v4 VOC domain-containing protein 0.9935 1 136
AF-A0A0Q1CJ93-F1-model_v4 Glyoxalase 0.9926 1 136
AF-A0A1Q3PY79-F1-model_v4 deleted 0.9914 1 135

Map