F355067

General Info

Members Datasets Scaffolds Average Seq Length
242 211 484 125

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0104759|Ga0501067_0104759_11_439
Length 142
Sequence MVISEMTLHPNDSPTQARIRTPLARVRGLGSAKEGADHFWKQRVTAIANLVLVCILAGIVVHLIGADYATVKKTLAKPLVGILLILLVLSGVHHMRLGMQTIIEDYVTSEGRKIALLMLNSFFAICVALSCIFAVLKLSLGA

Samples

Sample ID Description Type Environment
1 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
44 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
63 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
64 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
99 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
112 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
113 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
114 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
119 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
128 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
129 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
130 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
133 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
134 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
135 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
148 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
149 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
150 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
151 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
152 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
153 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
159 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
160 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
161 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
162 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
163 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
164 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
165 2643221568 Rhizobium sp. Root564 Isolate Unclassified
166 2643221618 Ensifer sp. Root231 Isolate Unclassified
167 2643221626 Ensifer sp. Root31 Isolate Unclassified
168 2643221655 Ensifer sp. Root1252 Isolate Unclassified
169 2643221659 Ensifer sp. Root127 Isolate Unclassified
170 2643221698 Ensifer sp. Root142 Isolate Unclassified
171 2643221712 Ensifer sp. Root258 Isolate Unclassified
172 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
173 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
174 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
175 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
176 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
177 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
178 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
179 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
180 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
181 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
182 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
183 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
184 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
185 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
186 2844163670 Ensifer sp. 1H6 Isolate Unclassified
187 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
188 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
189 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
190 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
191 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
192 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
193 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
194 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
195 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
196 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
197 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
198 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
199 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
200 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
201 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
202 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
203 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
204 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
205 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
206 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
207 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
208 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
209 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
210 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
211 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 76.03
Metatranscriptomes 2.07
Isolates 21.9

Biome Distribution

Category Percentage (%)
Aerial Root 0.41
Bulb 0
Endosphere 7.44
Nodule 11.57
Rhizoplane 11.57
Rhizosphere 54.55
Stem 0
Stem Tuber 0
Unclassified 2.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501067_0104759 3300049583 Bacteria 1572
2 JGI24737J22298_10080090 3300001990 Unclassified 972
3 JGI25162J39368_1000879 3300002737 Bacteria 19691
4 JGI25165J46597_1001977 3300003214 Bacteria 7923
5 rootH2_10032833 3300003320 Bacteria 3553
6 Ga0055526_1000528 3300003771 Bacteria 30285
7 Ga0058692_1008528 3300003856 Bacteria 2642
8 Ga0070690_100957223 3300005330 Unclassified 672
9 Ga0070670_100000183 3300005331 Bacteria 57446
10 Ga0070682_100627334 3300005337 Bacteria 852
11 Ga0070660_100277108 3300005339 Bacteria 1372
12 Ga0070691_10365543 3300005341 Bacteria 805
13 Ga0070661_101215619 3300005344 Bacteria 630
14 Ga0070668_100199832 3300005347 Bacteria 1641
15 Ga0070673_101595244 3300005364 Bacteria 616
16 Ga0070659_100034072 3300005366 Bacteria 3960
17 Ga0070709_10079021 3300005434 Bacteria 2142
18 Ga0070701_10592031 3300005438 Bacteria 733
19 Ga0070711_101439618 3300005439 Bacteria 600
20 Ga0070705_100366466 3300005440 Bacteria 1056
21 Ga0070663_100000240 3300005455 Bacteria 27751
22 Ga0068867_102059765 3300005459 Bacteria 540
23 Ga0070679_100337678 3300005530 Bacteria 1455
24 Ga0068853_100004963 3300005539 Bacteria 10369
25 Ga0070695_100042122 3300005545 Bacteria 2897
26 Ga0070696_100102088 3300005546 Bacteria 2056
27 Ga0070693_100572313 3300005547 Bacteria 812
28 Ga0070665_101030908 3300005548 Bacteria 835
29 Ga0070665_101467519 3300005548 Bacteria 691
30 Ga0070665_101797051 3300005548 Bacteria 620
31 Ga0070704_100989986 3300005549 Bacteria 760
32 Ga0068855_100417755 3300005563 Bacteria 1467
33 Ga0068857_100012507 3300005577 Bacteria 7390
34 Ga0068856_100014117 3300005614 Bacteria 7725
35 Ga0068856_100430772 3300005614 Bacteria 1339
36 Ga0068852_101765257 3300005616 Bacteria 641
37 Ga0068864_100292958 3300005618 Bacteria 1521
38 Ga0068870_10504645 3300005840 Bacteria 807
39 Ga0068858_100184171 3300005842 Bacteria 1972
40 Ga0068860_101200907 3300005843 Bacteria 779
41 Ga0068862_100937465 3300005844 Bacteria 853
42 Ga0081455_10000371 3300005937 Bacteria 59407
43 Ga0075369_10144601 3300006186 Bacteria 1085
44 Ga0075370_10870955 3300006353 Bacteria 550
45 Ga0068865_100391258 3300006881 Bacteria 1136
46 Ga0099826_10030104 3300006948 Bacteria 3947
47 Ga0105244_10164819 3300009036 Bacteria 1057
48 Ga0105240_11255408 3300009093 Bacteria 783
49 Ga0105247_10910504 3300009101 Unclassified 680
50 Ga0105241_10062697 3300009174 Bacteria 2867
51 Ga0105238_10032342 3300009551 Bacteria 5323
52 Ga0105239_10633940 3300010375 Bacteria 1220
53 Ga0105246_10283931 3300011119 Bacteria 1329
54 Ga0157370_10292918 3300013104 Bacteria 1503
55 Ga0157369_10054912 3300013105 Bacteria 4300
56 Ga0157369_10087123 3300013105 Bacteria 3335
57 Ga0157374_11763165 3300013296 Bacteria 644
58 Ga0157378_10607300 3300013297 Bacteria 1106
59 Ga0157372_10166293 3300013307 Bacteria 2551
60 Ga0157372_12224639 3300013307 Bacteria 630
61 Ga0157375_10495624 3300013308 Bacteria 1386
62 Ga0182008_10919883 3300014497 Bacteria 516
63 Ga0213876_10740605 3300021384 Unclassified 523
64 Ga0209563_102664 3300025230 Bacteria 3946
65 Ga0209437_100057 3300025233 Bacteria 362922
66 Ga0209148_1007754 3300025254 Bacteria 2202
67 Ga0209759_1014622 3300025256 Bacteria 2065
68 Ga0209233_1000134 3300025261 Bacteria 202535
69 Ga0209455_1010448 3300025272 Bacteria 2359
70 Ga0209025_1042368 3300025294 Bacteria 1935
71 Ga0209564_1000752 3300025295 Bacteria 45914
72 Ga0207653_10281211 3300025885 Bacteria 642
73 Ga0207647_10090822 3300025904 Bacteria 1821
74 Ga0207705_10693446 3300025909 Bacteria 792
75 Ga0207654_10042128 3300025911 Bacteria 2582
76 Ga0207707_10087376 3300025912 Bacteria 2724
77 Ga0207671_10184159 3300025914 Bacteria 1626
78 Ga0207657_10090785 3300025919 Bacteria 2549
79 Ga0207652_10568868 3300025921 Bacteria 1018
80 Ga0207694_10273439 3300025924 Bacteria 1386
81 Ga0207650_10000151 3300025925 Bacteria 83229
82 Ga0207690_10624607 3300025932 Bacteria 881
83 Ga0207704_11374360 3300025938 Bacteria 605
84 Ga0207679_10314138 3300025945 Bacteria 1355
85 Ga0207667_10222078 3300025949 Bacteria 1936
86 Ga0207677_10236816 3300026023 Bacteria 1474
87 Ga0207703_10401506 3300026035 Bacteria 1272
88 Ga0207639_10124178 3300026041 Bacteria 2126
89 Ga0207639_11337174 3300026041 Bacteria 672
90 Ga0207678_10000440 3300026067 Bacteria 37762
91 Ga0207702_10014459 3300026078 Bacteria 6553
92 Ga0207702_10377901 3300026078 Bacteria 1362
93 Ga0207641_11048645 3300026088 Bacteria 813
94 Ga0207676_10153518 3300026095 Bacteria 1986
95 Ga0207674_10266529 3300026116 Bacteria 1660
96 Ga0207675_100975722 3300026118 Bacteria 865
97 Ga0207698_10398227 3300026142 Bacteria 1315
98 Ga0209371_1001857 3300027312 Bacteria 12997
99 Ga0209371_1005149 3300027312 Bacteria 5340
100 Ga0209282_1039116 3300027666 Bacteria 2833
101 Ga0268266_11465530 3300028379 Bacteria 658
102 Ga0268265_10634945 3300028380 Bacteria 1025
103 Ga0268264_10906056 3300028381 Bacteria 885
104 Ga0268256_1008786 3300030500 Bacteria 3431
105 Ga0268256_1020398 3300030500 Bacteria 1787
106 Ga0307408_101378257 3300031548 Bacteria 663
107 Ga0307408_101394494 3300031548 Bacteria 660
108 Ga0307516_10332797 3300031730 Bacteria 1187
109 Ga0373936_0065935 3300035113 Bacteria 1486
110 Ga0373935_0354836 3300035692 Bacteria 1046
111 Ga0316582_0302039 3300036647 Bacteria 1100
112 Ga0395899_0000124 3300037312 Bacteria 122011
113 Ga0395900_0000086 3300037418 Bacteria 171749
114 Ga0395900_0047566 3300037418 Bacteria 4417
115 Ga0395900_0100158 3300037418 Bacteria 2976
116 Ga0395898_0000285 3300037466 Bacteria 122279
117 Ga0395898_0525522 3300037466 Bacteria 1125
118 Ga0395905_0000133 3300037471 Bacteria 123500
119 Ga0395901_0000092 3300038443 Bacteria 121976
120 Ga0436365_0513625 3300039437 Bacteria 1647
121 Ga0436365_0610273 3300039437 Bacteria 554
122 Ga0451837_0998999 3300041494 Bacteria 702
123 Ga0466963_0078708 3300044694 Bacteria 2229
124 Ga0451576_0281274 3300045051 Bacteria 1740
125 Ga0495606_0645099 3300046507 Bacteria 513
126 Ga0495602_0250931 3300048088 Bacteria 1319
127 Ga0496100_0091138 3300048903 Bacteria 2080
128 Ga0496101_0124953 3300048904 Bacteria 1949
129 Ga0496101_1038792 3300048904 Bacteria 644
130 Ga0496102_0045861 3300048905 Bacteria 3968
131 Ga0496102_0125301 3300048905 Bacteria 2401
132 Ga0496102_0134429 3300048905 Bacteria 2317
133 Ga0496102_0275919 3300048905 Bacteria 1584
134 Ga0496104_0002253 3300048907 Bacteria 16633
135 Ga0496104_0165263 3300048907 Bacteria 2122
136 Ga0496105_0069186 3300048908 Bacteria 2917
137 Ga0496106_0027734 3300048909 Bacteria 4219
138 Ga0496106_0105151 3300048909 Bacteria 2193
139 Ga0496106_0217690 3300048909 Bacteria 1522
140 Ga0496107_0006452 3300048910 Bacteria 8068
141 Ga0496107_0377722 3300048910 Bacteria 1054
142 Ga0496108_0073643 3300048911 Bacteria 2883
143 Ga0496108_0302043 3300048911 Bacteria 1394
144 Ga0496108_0393083 3300048911 Bacteria 1211
145 Ga0496109_0052808 3300048912 Bacteria 3705
146 Ga0496109_1288860 3300048912 Bacteria 667
147 Ga0496110_0024773 3300048913 Bacteria 5119
148 Ga0496110_0276724 3300048913 Bacteria 1528
149 Ga0496112_0078918 3300048915 Bacteria 3255
150 Ga0496113_0043494 3300048916 Bacteria 3324
151 Ga0496114_0096500 3300048917 Bacteria 2517
152 Ga0496115_0010949 3300048918 Bacteria 6791
153 Ga0496115_0016288 3300048918 Bacteria 5657
154 Ga0496116_0000057 3300048919 Bacteria 281652
155 Ga0496117_0120579 3300048920 Bacteria 1612
156 Ga0496118_0074368 3300048921 Bacteria 2429
157 Ga0496119_0138800 3300048922 Bacteria 1315
158 Ga0496121_0020154 3300048924 Bacteria 6620
159 Ga0496122_0096365 3300048925 Bacteria 1995
160 Ga0496124_0104853 3300048927 Bacteria 2285
161 Ga0496126_0002222 3300048929 Bacteria 26858
162 Ga0496126_0609847 3300048929 Bacteria 859
163 Ga0501032_0151241 3300049569 Bacteria 1526
164 Ga0501033_0000518 3300049570 Bacteria 36156
165 Ga0501034_0069806 3300049571 Bacteria 3524
166 Ga0501036_1203601 3300049572 Bacteria 617
167 Ga0501042_0570199 3300049578 Bacteria 823
168 Ga0501042_0618115 3300049578 Bacteria 788
169 Ga0501047_0573047 3300049581 Bacteria 952
170 Ga0501048_0000508 3300049582 Bacteria 27268
171 Ga0501070_0659319 3300049586 Bacteria 830
172 Ga0501077_0181741 3300049593 Bacteria 1337
173 Ga0501035_0000316 3300049822 Bacteria 55833
174 Ga0501035_0149490 3300049822 Bacteria 2028
175 Ga0501035_1433821 3300049822 Unclassified 528
176 Ga0501044_0643599 3300049823 Bacteria 950
177 Ga0501045_0548254 3300049824 Bacteria 858
178 nmdc:mga03n38_413705_c1 3300050490 Bacteria 744
179 nmdc:mga00v17_147288_c1 3300050491 Bacteria 1511
180 nmdc:mga0k408_677049_c1 3300050493 Bacteria 605
181 nmdc:mga0sz30_213487_c1 3300050516 Bacteria 858
182 Ga0500595_115555 3300053119 Bacteria 760
183 Ga0500608_101911 3300053122 Bacteria 1329
184 Ga0587090_000170 3300059510 Bacteria 4514
185 Ga0587091_006705 3300059511 Bacteria 1629
186 Ga0587067_006768 3300059640 Bacteria 1613
187 Ga0587072_001139 3300059643 Bacteria 3152
188 Ga0587108_002703 3300059653 Bacteria 1207
189 Ga0501082_0444262 3300060353 Bacteria 1133
190 2511389019 2511231027 Bacteria 5013807
191 2512973697 2512875026 Bacteria 6861065
192 2514003631 2513237160 Bacteria 6650282
193 2537876649 2537561587 Bacteria 5425293
194 2616557643 2615840698 Bacteria 7319877
195 2643836717 2643221564 Bacteria 4193379
196 2643855022 2643221568 Bacteria 5187270
197 2644110058 2643221618 Bacteria 7717186
198 2644150334 2643221626 Bacteria 8069654
199 2644312938 2643221655 Bacteria 7722067
200 2644336486 2643221659 Bacteria 7890716
201 2644546132 2643221698 Bacteria 7756764
202 2644618668 2643221712 Bacteria 7729434
203 2671113537 2667528174 Bacteria 6435400
204 2757570290 2757320392 Bacteria 3737298
205 2778173690 2775507266 Bacteria 7392367
206 2802717333 2802428858 Bacteria 6636079
207 2802743181 2802428862 Bacteria 6633353
208 2802749693 2802428863 Bacteria 6410669
209 2819611180 2818991448 Bacteria 6772224
210 2838030873 2838029111 Bacteria 6603031
211 2838078270 2838074704 Bacteria 6785777
212 2841863161 2841859092 Bacteria 5436171
213 2842477605 2842475841 Bacteria 6603183
214 2842504522 2842502639 Bacteria 6604161
215 2842520101 2842515876 Bacteria 5436280
216 2842873950 2842871566 Bacteria 4827117
217 2844164257 2844163670 Bacteria 7266046
218 2899795260 2899792073 Bacteria 4926588
219 2919170644 2919166419 Bacteria 4952238
220 2919411005 2919408235 Bacteria 6149349
221 2933015639 2933011516 Bacteria 5439334
222 2937036093 2937036028 Bacteria 6846469
223 2937086382 2937084907 Bacteria 6618516
224 2941501254 2941499720 Bacteria 7599444
225 2957439754 2957437181 Bacteria 6568994
226 2960594977 2960591022 Bacteria 6622873
227 2967731930 2967728569 Bacteria 6641507
228 2970029926 2970026789 Bacteria 6785236
229 2970125856 2970122695 Bacteria 6625855
230 2970143721 2970143518 Bacteria 6446480
231 2977534677 2977530762 Bacteria 6951399
232 2978972546 2978969890 Bacteria 5400756
233 2984590799 2984587000 Bacteria 5263363
234 3004336869 3004334049 Bacteria 8449246
235 3005421685 3005416602 Bacteria 7064308
236 8004002960 8003999396 Bacteria 7063185
237 8005319611 8005314921 Bacteria 7072929
238 8005490233 8005484373 Bacteria 6297373
239 8005646890 8005645114 Bacteria 6950293
240 8005688048 8005682033 Bacteria 6726518
241 8024490789 8024486573 Bacteria 6540512
242 8054463708 8054460903 Bacteria 4872905
243 Ga0501067_0104759
244 JGI24737J22298_10080090
245 JGI25162J39368_1000879
246 JGI25165J46597_1001977
247 rootH2_10032833
248 Ga0055526_1000528
249 Ga0058692_1008528
250 Ga0070690_100957223
251 Ga0070670_100000183
252 Ga0070682_100627334
253 Ga0070660_100277108
254 Ga0070691_10365543
255 Ga0070661_101215619
256 Ga0070668_100199832
257 Ga0070673_101595244
258 Ga0070659_100034072
259 Ga0070709_10079021
260 Ga0070701_10592031
261 Ga0070711_101439618
262 Ga0070705_100366466
263 Ga0070663_100000240
264 Ga0068867_102059765
265 Ga0070679_100337678
266 Ga0068853_100004963
267 Ga0070695_100042122
268 Ga0070696_100102088
269 Ga0070693_100572313
270 Ga0070665_101030908
271 Ga0070665_101467519
272 Ga0070665_101797051
273 Ga0070704_100989986
274 Ga0068855_100417755
275 Ga0068857_100012507
276 Ga0068856_100014117
277 Ga0068856_100430772
278 Ga0068852_101765257
279 Ga0068864_100292958
280 Ga0068870_10504645
281 Ga0068858_100184171
282 Ga0068860_101200907
283 Ga0068862_100937465
284 Ga0081455_10000371
285 Ga0075369_10144601
286 Ga0075370_10870955
287 Ga0068865_100391258
288 Ga0099826_10030104
289 Ga0105244_10164819
290 Ga0105240_11255408
291 Ga0105247_10910504
292 Ga0105241_10062697
293 Ga0105238_10032342
294 Ga0105239_10633940
295 Ga0105246_10283931
296 Ga0157370_10292918
297 Ga0157369_10054912
298 Ga0157369_10087123
299 Ga0157374_11763165
300 Ga0157378_10607300
301 Ga0157372_10166293
302 Ga0157372_12224639
303 Ga0157375_10495624
304 Ga0182008_10919883
305 Ga0213876_10740605
306 Ga0209563_102664
307 Ga0209437_100057
308 Ga0209148_1007754
309 Ga0209759_1014622
310 Ga0209233_1000134
311 Ga0209455_1010448
312 Ga0209025_1042368
313 Ga0209564_1000752
314 Ga0207653_10281211
315 Ga0207647_10090822
316 Ga0207705_10693446
317 Ga0207654_10042128
318 Ga0207707_10087376
319 Ga0207671_10184159
320 Ga0207657_10090785
321 Ga0207652_10568868
322 Ga0207694_10273439
323 Ga0207650_10000151
324 Ga0207690_10624607
325 Ga0207704_11374360
326 Ga0207679_10314138
327 Ga0207667_10222078
328 Ga0207677_10236816
329 Ga0207703_10401506
330 Ga0207639_10124178
331 Ga0207639_11337174
332 Ga0207678_10000440
333 Ga0207702_10014459
334 Ga0207702_10377901
335 Ga0207641_11048645
336 Ga0207676_10153518
337 Ga0207674_10266529
338 Ga0207675_100975722
339 Ga0207698_10398227
340 Ga0209371_1001857
341 Ga0209371_1005149
342 Ga0209282_1039116
343 Ga0268266_11465530
344 Ga0268265_10634945
345 Ga0268264_10906056
346 Ga0268256_1008786
347 Ga0268256_1020398
348 Ga0307408_101378257
349 Ga0307408_101394494
350 Ga0307516_10332797
351 Ga0373936_0065935
352 Ga0373935_0354836
353 Ga0316582_0302039
354 Ga0395899_0000124
355 Ga0395900_0000086
356 Ga0395900_0047566
357 Ga0395900_0100158
358 Ga0395898_0000285
359 Ga0395898_0525522
360 Ga0395905_0000133
361 Ga0395901_0000092
362 Ga0436365_0513625
363 Ga0436365_0610273
364 Ga0451837_0998999
365 Ga0466963_0078708
366 Ga0451576_0281274
367 Ga0495606_0645099
368 Ga0495602_0250931
369 Ga0496100_0091138
370 Ga0496101_0124953
371 Ga0496101_1038792
372 Ga0496102_0045861
373 Ga0496102_0125301
374 Ga0496102_0134429
375 Ga0496102_0275919
376 Ga0496104_0002253
377 Ga0496104_0165263
378 Ga0496105_0069186
379 Ga0496106_0027734
380 Ga0496106_0105151
381 Ga0496106_0217690
382 Ga0496107_0006452
383 Ga0496107_0377722
384 Ga0496108_0073643
385 Ga0496108_0302043
386 Ga0496108_0393083
387 Ga0496109_0052808
388 Ga0496109_1288860
389 Ga0496110_0024773
390 Ga0496110_0276724
391 Ga0496112_0078918
392 Ga0496113_0043494
393 Ga0496114_0096500
394 Ga0496115_0010949
395 Ga0496115_0016288
396 Ga0496116_0000057
397 Ga0496117_0120579
398 Ga0496118_0074368
399 Ga0496119_0138800
400 Ga0496121_0020154
401 Ga0496122_0096365
402 Ga0496124_0104853
403 Ga0496126_0002222
404 Ga0496126_0609847
405 Ga0501032_0151241
406 Ga0501033_0000518
407 Ga0501034_0069806
408 Ga0501036_1203601
409 Ga0501042_0570199
410 Ga0501042_0618115
411 Ga0501047_0573047
412 Ga0501048_0000508
413 Ga0501070_0659319
414 Ga0501077_0181741
415 Ga0501035_0000316
416 Ga0501035_0149490
417 Ga0501035_1433821
418 Ga0501044_0643599
419 Ga0501045_0548254
420 nmdc:mga03n38_413705_c1
421 nmdc:mga00v17_147288_c1
422 nmdc:mga0k408_677049_c1
423 nmdc:mga0sz30_213487_c1
424 Ga0500595_115555
425 Ga0500608_101911
426 Ga0587090_000170
427 Ga0587091_006705
428 Ga0587067_006768
429 Ga0587072_001139
430 Ga0587108_002703
431 Ga0501082_0444262
432 2511389019
433 2512973697
434 2514003631
435 2537876649
436 2616557643
437 2643836717
438 2643855022
439 2644110058
440 2644150334
441 2644312938
442 2644336486
443 2644546132
444 2644618668
445 2671113537
446 2757570290
447 2778173690
448 2802717333
449 2802743181
450 2802749693
451 2819611180
452 2838030873
453 2838078270
454 2841863161
455 2842477605
456 2842504522
457 2842520101
458 2842873950
459 2844164257
460 2899795260
461 2919170644
462 2919411005
463 2933015639
464 2937036093
465 2937086382
466 2941501254
467 2957439754
468 2960594977
469 2967731930
470 2970029926
471 2970125856
472 2970143721
473 2977534677
474 2978972546
475 2984590799
476 3004336869
477 3005421685
478 8004002960
479 8005319611
480 8005490233
481 8005646890
482 8005688048
483 8024490789
484 8054463708

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01127

Sdh_cyt

Succinate dehydrogenase/Fumarate reductase transmembrane subunit

17

129

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2acz-assembly1.cif.gz_D complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site 0.9011 17 118
2wu5-assembly1.cif.gz_H crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd his71met mutant 0.8492 17 118
2wu5-assembly1.cif.gz_H crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd his71met mutant 0.8202 17 118
7jz2-assembly1.cif.gz_D succinate: quinone oxidoreductase sqr from e.coli k12 0.8145 20 123
2acz-assembly1.cif.gz_D complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site 0.8133 17 118
ID Description Score Start End Superfamily
2aczD01 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.9011 17 118 1.20.1300.10
2ws3H00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8936 17 118 1.20.1300.10
2aczD01 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8698 17 118 1.20.1300.10
2ws3H00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8627 17 118 1.20.1300.10
af_P0AC44_1_115_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8571 17 118 1.20.1300.10
ID Description Score Start End GO Terms
AF-A0A251WMT3-F1-model_v4 deleted 0.9811 26 123
AF-A0A537NV84-F1-model_v4 Succinate dehydrogenase, hydrophobic membrane anchor protein 0.9801 30 123 GO:0006099
GO:0016020
GO:0020037
AF-A0A537NCS2-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.9758 16 123 GO:0006099
GO:0016020
GO:0020037
GO:0046872
AF-A0A2E4I3Q9-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.973 24 120 GO:0006099
GO:0016020
GO:0020037
GO:0046872
AF-A0A6J4L7T2-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.9727 27 120 GO:0006099
GO:0016020
GO:0020037
GO:0046872

Map