F354841
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 242 | 148 | 242 | 183 |
Family's Representative Sequence
| Representative Sequence | 3300035170|Ga0373943_0329736|Ga0373943_0329736_201_782 |
| Length | 193 |
| Sequence | MRGNRAELAMTNPVRGAVDSLANSRGRSMRHIAVGLGLAVGAVALSALMARLNAPTQDDAEIYSDYEERAELDVKPRSKAFSMIWPPLFMVLTLSGLRIWNAPRSAARAQALTLWGTVQALNAVWMALGPKRLGGQLAAAVASLGAAMAYVWRARRVDLPAANMVAPYVGWIGFANVLSEELWRRNAPPQTLH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 22 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 24 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 25 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 26 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 27 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 28 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 29 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 30 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 31 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 32 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 34 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 50 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 84 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 85 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 86 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 87 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 88 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 89 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 90 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 91 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 92 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 93 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 94 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 95 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 96 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 97 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 98 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 99 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 100 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 101 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 102 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 115 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 116 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 117 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 118 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 119 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 120 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 121 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 122 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 123 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 124 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 125 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 126 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 127 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 128 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 129 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 130 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 131 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 132 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 133 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 134 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 135 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 136 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 137 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 138 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 139 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 140 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 141 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 142 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 143 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 144 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 145 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 146 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 147 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 148 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.68 |
| Nodule | 0 |
| Rhizoplane | 6.2 |
| Rhizosphere | 80.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10036248 | 3300005327 | Bacteria | 3975 |
| 2 | Ga0070670_100000013 | 3300005331 | Bacteria | 250768 |
| 3 | Ga0070666_10020388 | 3300005335 | Bacteria | 4285 |
| 4 | Ga0070680_100183334 | 3300005336 | Bacteria | 1763 |
| 5 | Ga0070680_100204870 | 3300005336 | Bacteria | 1664 |
| 6 | Ga0068868_100352497 | 3300005338 | Bacteria | 1261 |
| 7 | Ga0070660_100106047 | 3300005339 | Bacteria | 2231 |
| 8 | Ga0070660_100295861 | 3300005339 | Bacteria | 1326 |
| 9 | Ga0070660_100620915 | 3300005339 | Bacteria | 904 |
| 10 | Ga0070660_100767519 | 3300005339 | Bacteria | 810 |
| 11 | Ga0070691_10008549 | 3300005341 | Bacteria | 4688 |
| 12 | Ga0070668_100016480 | 3300005347 | Bacteria | 5526 |
| 13 | Ga0070668_100023831 | 3300005347 | Bacteria | 4633 |
| 14 | Ga0070669_101050358 | 3300005353 | Bacteria | 700 |
| 15 | Ga0070671_100044034 | 3300005355 | Bacteria | 3708 |
| 16 | Ga0070671_100069305 | 3300005355 | Bacteria | 2942 |
| 17 | Ga0070674_100896154 | 3300005356 | Unclassified | 772 |
| 18 | Ga0070659_100018115 | 3300005366 | Bacteria | 5311 |
| 19 | Ga0070659_100098392 | 3300005366 | Bacteria | 2352 |
| 20 | Ga0070667_100014270 | 3300005367 | Bacteria | 6562 |
| 21 | Ga0070667_100029289 | 3300005367 | Bacteria | 4587 |
| 22 | Ga0070663_100020412 | 3300005455 | Bacteria | 4388 |
| 23 | Ga0070678_100019052 | 3300005456 | Bacteria | 4463 |
| 24 | Ga0070662_100265572 | 3300005457 | Bacteria | 1384 |
| 25 | Ga0070662_100768610 | 3300005457 | Unclassified | 818 |
| 26 | Ga0070681_10024266 | 3300005458 | Bacteria | 6104 |
| 27 | Ga0070681_10025956 | 3300005458 | Bacteria | 5890 |
| 28 | Ga0070681_10088637 | 3300005458 | Bacteria | 3045 |
| 29 | Ga0070679_100033598 | 3300005530 | Bacteria | 5079 |
| 30 | Ga0070679_100211243 | 3300005530 | Bacteria | 1904 |
| 31 | Ga0068853_100013001 | 3300005539 | Bacteria | 6787 |
| 32 | Ga0068853_100237912 | 3300005539 | Bacteria | 1668 |
| 33 | Ga0070665_100001028 | 3300005548 | Bacteria | 34986 |
| 34 | Ga0070665_100020888 | 3300005548 | Bacteria | 6580 |
| 35 | Ga0070665_100035576 | 3300005548 | Bacteria | 5008 |
| 36 | Ga0068855_100036799 | 3300005563 | Bacteria | 5823 |
| 37 | Ga0068855_100037088 | 3300005563 | Bacteria | 5800 |
| 38 | Ga0068855_100397108 | 3300005563 | Bacteria | 1512 |
| 39 | Ga0068855_100485824 | 3300005563 | Bacteria | 1344 |
| 40 | Ga0068855_101100679 | 3300005563 | Unclassified | 830 |
| 41 | Ga0070664_100324064 | 3300005564 | Bacteria | 1397 |
| 42 | Ga0068857_100242429 | 3300005577 | Bacteria | 1651 |
| 43 | Ga0068856_100131343 | 3300005614 | Bacteria | 2509 |
| 44 | Ga0068859_100052214 | 3300005617 | Bacteria | 4109 |
| 45 | Ga0068864_100000453 | 3300005618 | Bacteria | 35448 |
| 46 | Ga0068864_100016914 | 3300005618 | Bacteria | 6077 |
| 47 | Ga0068861_100102591 | 3300005719 | Bacteria | 2278 |
| 48 | Ga0068863_100000423 | 3300005841 | Bacteria | 42817 |
| 49 | Ga0068863_100080639 | 3300005841 | Bacteria | 3082 |
| 50 | Ga0068863_100513529 | 3300005841 | Bacteria | 1181 |
| 51 | Ga0068863_100586576 | 3300005841 | Bacteria | 1102 |
| 52 | Ga0068858_100007627 | 3300005842 | Bacteria | 10451 |
| 53 | Ga0068860_100000167 | 3300005843 | Bacteria | 108234 |
| 54 | Ga0068862_100014392 | 3300005844 | Bacteria | 6563 |
| 55 | Ga0068862_100139721 | 3300005844 | Bacteria | 2149 |
| 56 | Ga0068862_100216149 | 3300005844 | Bacteria | 1734 |
| 57 | Ga0070717_10157295 | 3300006028 | Bacteria | 1970 |
| 58 | Ga0070717_10212621 | 3300006028 | Bacteria | 1698 |
| 59 | Ga0068865_100044623 | 3300006881 | Bacteria | 3035 |
| 60 | Ga0097620_100052215 | 3300006931 | Bacteria | 4109 |
| 61 | Ga0105240_10005496 | 3300009093 | Bacteria | 18888 |
| 62 | Ga0105240_10042848 | 3300009093 | Bacteria | 5765 |
| 63 | Ga0105240_10135396 | 3300009093 | Bacteria | 2951 |
| 64 | Ga0105240_10320874 | 3300009093 | Bacteria | 1766 |
| 65 | Ga0105240_10344069 | 3300009093 | Bacteria | 1693 |
| 66 | Ga0105240_10730989 | 3300009093 | Bacteria | 1078 |
| 67 | Ga0105240_10967096 | 3300009093 | Bacteria | 912 |
| 68 | Ga0105248_10000661 | 3300009177 | Bacteria | 39161 |
| 69 | Ga0105248_10086901 | 3300009177 | Bacteria | 3519 |
| 70 | Ga0105248_10130137 | 3300009177 | Bacteria | 2839 |
| 71 | Ga0105237_10514027 | 3300009545 | Bacteria | 1204 |
| 72 | Ga0105238_10009053 | 3300009551 | Bacteria | 9961 |
| 73 | Ga0105238_10025713 | 3300009551 | Bacteria | 6003 |
| 74 | Ga0105238_10036991 | 3300009551 | Bacteria | 4963 |
| 75 | Ga0105238_10082180 | 3300009551 | Bacteria | 3211 |
| 76 | Ga0105238_11471477 | 3300009551 | Bacteria | 709 |
| 77 | Ga0105249_10023878 | 3300009553 | Bacteria | 5492 |
| 78 | Ga0105249_10617535 | 3300009553 | Bacteria | 1140 |
| 79 | Ga0105239_10822977 | 3300010375 | Bacteria | 1064 |
| 80 | Ga0157370_10412481 | 3300013104 | Unclassified | 1243 |
| 81 | Ga0157370_10542636 | 3300013104 | Bacteria | 1066 |
| 82 | Ga0157369_10652858 | 3300013105 | Bacteria | 1085 |
| 83 | Ga0157374_10122287 | 3300013296 | Bacteria | 2513 |
| 84 | Ga0157374_10531513 | 3300013296 | Bacteria | 1183 |
| 85 | Ga0163162_10227844 | 3300013306 | Bacteria | 1994 |
| 86 | Ga0163162_10775896 | 3300013306 | Bacteria | 1077 |
| 87 | Ga0157372_10431090 | 3300013307 | Bacteria | 1537 |
| 88 | Ga0157375_10132915 | 3300013308 | Bacteria | 2609 |
| 89 | Ga0163163_10079205 | 3300014325 | Bacteria | 3284 |
| 90 | Ga0163163_10085567 | 3300014325 | Bacteria | 3161 |
| 91 | Ga0163163_10169796 | 3300014325 | Bacteria | 2228 |
| 92 | Ga0157379_10789476 | 3300014968 | Bacteria | 896 |
| 93 | Ga0213876_10043735 | 3300021384 | Bacteria | 2367 |
| 94 | Ga0207680_10303464 | 3300025903 | Bacteria | 1113 |
| 95 | Ga0207705_10002746 | 3300025909 | Bacteria | 13489 |
| 96 | Ga0207705_10136019 | 3300025909 | Bacteria | 1832 |
| 97 | Ga0207707_10026958 | 3300025912 | Bacteria | 5022 |
| 98 | Ga0207707_10178863 | 3300025912 | Bacteria | 1852 |
| 99 | Ga0207695_10003006 | 3300025913 | Bacteria | 24241 |
| 100 | Ga0207695_10003703 | 3300025913 | Bacteria | 21297 |
| 101 | Ga0207695_10085194 | 3300025913 | Bacteria | 3189 |
| 102 | Ga0207695_10095202 | 3300025913 | Bacteria | 2983 |
| 103 | Ga0207695_10155937 | 3300025913 | Bacteria | 2218 |
| 104 | Ga0207695_10241212 | 3300025913 | Bacteria | 1709 |
| 105 | Ga0207695_10658641 | 3300025913 | Bacteria | 928 |
| 106 | Ga0207660_10001373 | 3300025917 | Bacteria | 16319 |
| 107 | Ga0207660_10044510 | 3300025917 | Bacteria | 3123 |
| 108 | Ga0207660_10097150 | 3300025917 | Bacteria | 2194 |
| 109 | Ga0207657_10007334 | 3300025919 | Bacteria | 11313 |
| 110 | Ga0207657_10120375 | 3300025919 | Bacteria | 2160 |
| 111 | Ga0207657_10127247 | 3300025919 | Bacteria | 2091 |
| 112 | Ga0207652_10019197 | 3300025921 | Bacteria | 5618 |
| 113 | Ga0207652_10145853 | 3300025921 | Bacteria | 2118 |
| 114 | Ga0207694_10010410 | 3300025924 | Bacteria | 7011 |
| 115 | Ga0207694_10231402 | 3300025924 | Bacteria | 1509 |
| 116 | Ga0207694_10508867 | 3300025924 | Bacteria | 1009 |
| 117 | Ga0207650_10000074 | 3300025925 | Bacteria | 134837 |
| 118 | Ga0207644_10009249 | 3300025931 | Bacteria | 6464 |
| 119 | Ga0207690_10000352 | 3300025932 | Bacteria | 30589 |
| 120 | Ga0207690_10000650 | 3300025932 | Bacteria | 22303 |
| 121 | Ga0207706_10121948 | 3300025933 | Bacteria | 2292 |
| 122 | Ga0207706_10234975 | 3300025933 | Bacteria | 1603 |
| 123 | Ga0207704_10734751 | 3300025938 | Bacteria | 820 |
| 124 | Ga0207711_10000316 | 3300025941 | Bacteria | 51683 |
| 125 | Ga0207711_10023673 | 3300025941 | Bacteria | 5142 |
| 126 | Ga0207711_10048286 | 3300025941 | Bacteria | 3642 |
| 127 | Ga0207679_10522944 | 3300025945 | Bacteria | 1061 |
| 128 | Ga0207667_10016972 | 3300025949 | Bacteria | 8214 |
| 129 | Ga0207667_10030907 | 3300025949 | Bacteria | 5787 |
| 130 | Ga0207667_10061585 | 3300025949 | Bacteria | 3925 |
| 131 | Ga0207667_10187271 | 3300025949 | Bacteria | 2124 |
| 132 | Ga0207667_10421858 | 3300025949 | Bacteria | 1357 |
| 133 | Ga0207712_10000835 | 3300025961 | Bacteria | 22611 |
| 134 | Ga0207712_10436922 | 3300025961 | Bacteria | 1107 |
| 135 | Ga0207668_10000001 | 3300025972 | Bacteria | 266091 |
| 136 | Ga0207668_10000093 | 3300025972 | Bacteria | 64280 |
| 137 | Ga0207658_10000266 | 3300025986 | Bacteria | 55102 |
| 138 | Ga0207658_10020077 | 3300025986 | Bacteria | 4625 |
| 139 | Ga0207677_10409295 | 3300026023 | Bacteria | 1152 |
| 140 | Ga0207703_10005094 | 3300026035 | Bacteria | 10628 |
| 141 | Ga0207639_10013635 | 3300026041 | Bacteria | 5697 |
| 142 | Ga0207639_10444511 | 3300026041 | Bacteria | 1176 |
| 143 | Ga0207639_10971176 | 3300026041 | Bacteria | 795 |
| 144 | Ga0207678_10152985 | 3300026067 | Bacteria | 1970 |
| 145 | Ga0207678_10419068 | 3300026067 | Bacteria | 1161 |
| 146 | Ga0207702_10104438 | 3300026078 | Bacteria | 2507 |
| 147 | Ga0207641_10000830 | 3300026088 | Bacteria | 32877 |
| 148 | Ga0207641_10047875 | 3300026088 | Bacteria | 3607 |
| 149 | Ga0207641_10234512 | 3300026088 | Bacteria | 1707 |
| 150 | Ga0207641_10577469 | 3300026088 | Bacteria | 1099 |
| 151 | Ga0207676_10000073 | 3300026095 | Bacteria | 101510 |
| 152 | Ga0207676_10388377 | 3300026095 | Bacteria | 1301 |
| 153 | Ga0207676_10491893 | 3300026095 | Bacteria | 1163 |
| 154 | Ga0207676_10877002 | 3300026095 | Unclassified | 879 |
| 155 | Ga0207674_10421024 | 3300026116 | Bacteria | 1290 |
| 156 | Ga0207675_100205552 | 3300026118 | Bacteria | 1892 |
| 157 | Ga0207683_10124994 | 3300026121 | Bacteria | 2311 |
| 158 | Ga0207698_10552834 | 3300026142 | Bacteria | 1128 |
| 159 | Ga0268266_10000189 | 3300028379 | Bacteria | 109217 |
| 160 | Ga0268266_10000289 | 3300028379 | Bacteria | 82515 |
| 161 | Ga0268266_10063632 | 3300028379 | Bacteria | 3184 |
| 162 | Ga0268265_10002313 | 3300028380 | Bacteria | 14498 |
| 163 | Ga0268265_10187784 | 3300028380 | Bacteria | 1782 |
| 164 | Ga0268265_10213434 | 3300028380 | Bacteria | 1683 |
| 165 | Ga0268265_10841959 | 3300028380 | Unclassified | 897 |
| 166 | Ga0268264_10000068 | 3300028381 | Bacteria | 275708 |
| 167 | Ga0307517_10005913 | 3300028786 | Bacteria | 18260 |
| 168 | Ga0265327_10002474 | 3300031251 | Bacteria | 19424 |
| 169 | Ga0307513_10005691 | 3300031456 | Bacteria | 16403 |
| 170 | Ga0307513_10006289 | 3300031456 | Bacteria | 15552 |
| 171 | Ga0307508_10234283 | 3300031616 | Bacteria | 1434 |
| 172 | Ga0307510_10007326 | 3300033180 | Bacteria | 13142 |
| 173 | Ga0373936_0001185 | 3300035113 | Bacteria | 9380 |
| 174 | Ga0373943_0317650 | 3300035170 | Unclassified | 887 |
| 175 | Ga0373943_0329736 | 3300035170 | Bacteria | 871 |
| 176 | Ga0373946_0011640 | 3300035171 | Bacteria | 3288 |
| 177 | Ga0373927_0001477 | 3300035695 | Bacteria | 17700 |
| 178 | Ga0373947_0308596 | 3300035725 | Bacteria | 1056 |
| 179 | Ga0373925_0000003 | 3300037068 | Bacteria | 362401 |
| 180 | Ga0395899_0215289 | 3300037312 | Bacteria | 1333 |
| 181 | Ga0395905_0007741 | 3300037471 | Bacteria | 10656 |
| 182 | Ga0395901_1049589 | 3300038443 | Unclassified | 788 |
| 183 | Ga0436365_0859304 | 3300039437 | Bacteria | 3274 |
| 184 | Ga0436365_1624259 | 3300039437 | Bacteria | 1365 |
| 185 | Ga0466965_0200354 | 3300044683 | Bacteria | 1059 |
| 186 | Ga0466968_0081866 | 3300044735 | Bacteria | 1420 |
| 187 | Ga0466970_0120826 | 3300044765 | Bacteria | 1435 |
| 188 | Ga0466957_0897735 | 3300044842 | Bacteria | 633 |
| 189 | Ga0495583_0015717 | 3300046506 | Bacteria | 4102 |
| 190 | Ga0495583_0102938 | 3300046506 | Bacteria | 1217 |
| 191 | Ga0495628_0144776 | 3300046516 | Bacteria | 1812 |
| 192 | Ga0495630_0188824 | 3300046517 | Bacteria | 1572 |
| 193 | Ga0495645_0148607 | 3300046543 | Bacteria | 1630 |
| 194 | Ga0495668_0255472 | 3300046616 | Bacteria | 959 |
| 195 | Ga0495611_0001744 | 3300046648 | Bacteria | 10530 |
| 196 | Ga0495625_0261654 | 3300046660 | Bacteria | 1119 |
| 197 | Ga0495659_0352075 | 3300046664 | Bacteria | 629 |
| 198 | Ga0495669_0083284 | 3300046684 | Bacteria | 1470 |
| 199 | Ga0495672_0093616 | 3300047320 | Bacteria | 1645 |
| 200 | Ga0495677_0123468 | 3300047445 | Bacteria | 988 |
| 201 | Ga0495681_0058903 | 3300047470 | Bacteria | 1778 |
| 202 | Ga0496100_0309698 | 3300048903 | Bacteria | 1184 |
| 203 | Ga0496102_0071611 | 3300048905 | Bacteria | 3183 |
| 204 | Ga0496102_0135150 | 3300048905 | Bacteria | 2310 |
| 205 | Ga0496102_0206232 | 3300048905 | Bacteria | 1853 |
| 206 | Ga0496103_0100118 | 3300048906 | Bacteria | 1834 |
| 207 | Ga0496104_0361155 | 3300048907 | Bacteria | 1365 |
| 208 | Ga0496108_0035751 | 3300048911 | Bacteria | 4131 |
| 209 | Ga0496109_0264207 | 3300048912 | Bacteria | 1621 |
| 210 | Ga0496110_0354785 | 3300048913 | Bacteria | 1336 |
| 211 | Ga0496112_0148473 | 3300048915 | Bacteria | 2312 |
| 212 | Ga0496112_0184423 | 3300048915 | Bacteria | 2050 |
| 213 | Ga0496113_0825666 | 3300048916 | Bacteria | 736 |
| 214 | Ga0496115_0001097 | 3300048918 | Bacteria | 19591 |
| 215 | Ga0496115_0002362 | 3300048918 | Bacteria | 13536 |
| 216 | Ga0496115_0091793 | 3300048918 | Bacteria | 2482 |
| 217 | Ga0496117_0046356 | 3300048920 | Bacteria | 3127 |
| 218 | Ga0496118_0005744 | 3300048921 | Bacteria | 13955 |
| 219 | Ga0496121_0000397 | 3300048924 | Bacteria | 87422 |
| 220 | Ga0501047_0010382 | 3300049581 | Bacteria | 8811 |
| 221 | Ga0501048_0270310 | 3300049582 | Bacteria | 1208 |
| 222 | Ga0500635_0000060 | 3300053080 | Bacteria | 72066 |
| 223 | Ga0500643_014037 | 3300053087 | Bacteria | 2801 |
| 224 | Ga0500647_0108020 | 3300053091 | Bacteria | 1325 |
| 225 | Ga0500641_0113950 | 3300053096 | Bacteria | 1164 |
| 226 | Ga0500650_0290252 | 3300053098 | Bacteria | 726 |
| 227 | Ga0500556_0130289 | 3300053104 | Bacteria | 985 |
| 228 | Ga0500562_001087 | 3300053108 | Bacteria | 6677 |
| 229 | Ga0500562_013071 | 3300053108 | Bacteria | 2115 |
| 230 | Ga0500569_001440 | 3300053109 | Bacteria | 4491 |
| 231 | Ga0500572_104564 | 3300053111 | Bacteria | 907 |
| 232 | Ga0500595_010051 | 3300053119 | Bacteria | 3780 |
| 233 | Ga0500607_113995 | 3300053121 | Bacteria | 1320 |
| 234 | Ga0500608_000296 | 3300053122 | Bacteria | 19335 |
| 235 | Ga0500590_015803 | 3300053148 | Bacteria | 3898 |
| 236 | Ga0500620_014158 | 3300053155 | Bacteria | 2219 |
| 237 | Ga0500624_005396 | 3300053157 | Bacteria | 1699 |
| 238 | Ga0500638_124629 | 3300053162 | Bacteria | 1175 |
| 239 | Ga0500636_0029329 | 3300053177 | Bacteria | 3250 |
| 240 | Ga0500637_0035839 | 3300053178 | Bacteria | 2783 |
| 241 | Ga0500625_010506 | 3300053729 | Bacteria | 4167 |
| 242 | Ga0500601_005386 | 3300053737 | Bacteria | 1400 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037312 | Ga0395899_0215289 | Ga0395899_0215289_855_1322 | 155 |
| 2 | 3300053104 | Ga0500556_0130289 | Ga0500556_0130289_361_915 | 157 |
| 3 | 3300009093 | Ga0105240_10005496 | Ga0105240_100054969 | 165 |
| 4 | 3300009553 | Ga0105249_10617535 | Ga0105249_106175352 | 165 |
| 5 | 3300013296 | Ga0157374_10531513 | Ga0157374_105315131 | 165 |
| 6 | 3300013308 | Ga0157375_10132915 | Ga0157375_101329152 | 165 |
| 7 | 3300014325 | Ga0163163_10169796 | Ga0163163_101697961 | 165 |
| 8 | 3300046648 | Ga0495611_0001744 | Ga0495611_0001744_2688_3185 | 165 |
| 9 | 3300046664 | Ga0495659_0352075 | Ga0495659_0352075_103_600 | 165 |
| 10 | 3300047470 | Ga0495681_0058903 | Ga0495681_0058903_676_1173 | 165 |
| 11 | 3300048905 | Ga0496102_0206232 | Ga0496102_0206232_912_1409 | 165 |
| 12 | 3300048907 | Ga0496104_0361155 | Ga0496104_0361155_379_876 | 165 |
| 13 | 3300048911 | Ga0496108_0035751 | Ga0496108_0035751_2318_2815 | 165 |
| 14 | 3300048912 | Ga0496109_0264207 | Ga0496109_0264207_1001_1498 | 165 |
| 15 | 3300048915 | Ga0496112_0148473 | Ga0496112_0148473_988_1485 | 165 |
| 16 | 3300048918 | Ga0496115_0091793 | Ga0496115_0091793_1331_1891 | 166 |
| 17 | 3300046517 | Ga0495630_0188824 | Ga0495630_0188824_127_684 | 170 |
| 18 | 3300009093 | Ga0105240_10730989 | Ga0105240_107309892 | 176 |
| 19 | 3300049581 | Ga0501047_0010382 | Ga0501047_0010382_1726_2268 | 176 |
| 20 | 3300049582 | Ga0501048_0270310 | Ga0501048_0270310_294_836 | 176 |
| 21 | 3300053096 | Ga0500641_0113950 | Ga0500641_0113950_515_1048 | 176 |
| 22 | 3300053108 | Ga0500562_001087 | Ga0500562_001087_4584_5129 | 180 |
| 23 | 3300053087 | Ga0500643_014037 | Ga0500643_014037_1521_2066 | 181 |
| 24 | 3300053121 | Ga0500607_113995 | Ga0500607_113995_443_988 | 181 |
| 25 | 3300053148 | Ga0500590_015803 | Ga0500590_015803_842_1387 | 181 |
| 26 | 3300031251 | Ga0265327_10002474 | Ga0265327_100024742 | 182 |
| 27 | 3300005355 | Ga0070671_100069305 | Ga0070671_1000693052 | 183 |
| 28 | 3300005455 | Ga0070663_100020412 | Ga0070663_1000204124 | 183 |
| 29 | 3300005563 | Ga0068855_100397108 | Ga0068855_1003971083 | 183 |
| 30 | 3300005614 | Ga0068856_100131343 | Ga0068856_1001313432 | 183 |
| 31 | 3300009551 | Ga0105238_11471477 | Ga0105238_114714771 | 183 |
| 32 | 3300010375 | Ga0105239_10822977 | Ga0105239_108229771 | 183 |
| 33 | 3300025924 | Ga0207694_10508867 | Ga0207694_105088671 | 183 |
| 34 | 3300025931 | Ga0207644_10009249 | Ga0207644_100092492 | 183 |
| 35 | 3300026067 | Ga0207678_10152985 | Ga0207678_101529853 | 183 |
| 36 | 3300026067 | Ga0207678_10419068 | Ga0207678_104190682 | 183 |
| 37 | 3300026078 | Ga0207702_10104438 | Ga0207702_101044382 | 183 |
| 38 | 3300026121 | Ga0207683_10124994 | Ga0207683_101249941 | 183 |
| 39 | 3300046506 | Ga0495583_0015717 | Ga0495583_0015717_2040_2594 | 183 |
| 40 | 3300046660 | Ga0495625_0261654 | Ga0495625_0261654_539_1093 | 183 |
| 41 | 3300046684 | Ga0495669_0083284 | Ga0495669_0083284_129_683 | 183 |
| 42 | 3300005327 | Ga0070658_10036248 | Ga0070658_100362485 | 184 |
| 43 | 3300005331 | Ga0070670_100000013 | Ga0070670_100000013205 | 184 |
| 44 | 3300005335 | Ga0070666_10020388 | Ga0070666_100203884 | 184 |
| 45 | 3300005336 | Ga0070680_100183334 | Ga0070680_1001833342 | 184 |
| 46 | 3300005336 | Ga0070680_100204870 | Ga0070680_1002048702 | 184 |
| 47 | 3300005338 | Ga0068868_100352497 | Ga0068868_1003524972 | 184 |
| 48 | 3300005339 | Ga0070660_100106047 | Ga0070660_1001060472 | 184 |
| 49 | 3300005339 | Ga0070660_100295861 | Ga0070660_1002958612 | 184 |
| 50 | 3300005339 | Ga0070660_100620915 | Ga0070660_1006209151 | 184 |
| 51 | 3300005339 | Ga0070660_100767519 | Ga0070660_1007675191 | 184 |
| 52 | 3300005341 | Ga0070691_10008549 | Ga0070691_100085494 | 184 |
| 53 | 3300005347 | Ga0070668_100016480 | Ga0070668_1000164805 | 184 |
| 54 | 3300005347 | Ga0070668_100023831 | Ga0070668_1000238315 | 184 |
| 55 | 3300005353 | Ga0070669_101050358 | Ga0070669_1010503581 | 184 |
| 56 | 3300005355 | Ga0070671_100044034 | Ga0070671_1000440344 | 184 |
| 57 | 3300005356 | Ga0070674_100896154 | Ga0070674_1008961541 | 184 |
| 58 | 3300005366 | Ga0070659_100018115 | Ga0070659_1000181151 | 184 |
| 59 | 3300005366 | Ga0070659_100098392 | Ga0070659_1000983922 | 184 |
| 60 | 3300005367 | Ga0070667_100014270 | Ga0070667_1000142704 | 184 |
| 61 | 3300005367 | Ga0070667_100029289 | Ga0070667_1000292894 | 184 |
| 62 | 3300005456 | Ga0070678_100019052 | Ga0070678_1000190524 | 184 |
| 63 | 3300005457 | Ga0070662_100265572 | Ga0070662_1002655722 | 184 |
| 64 | 3300005457 | Ga0070662_100768610 | Ga0070662_1007686101 | 184 |
| 65 | 3300005458 | Ga0070681_10024266 | Ga0070681_100242667 | 184 |
| 66 | 3300005458 | Ga0070681_10025956 | Ga0070681_100259566 | 184 |
| 67 | 3300005458 | Ga0070681_10088637 | Ga0070681_100886374 | 184 |
| 68 | 3300005530 | Ga0070679_100033598 | Ga0070679_1000335985 | 184 |
| 69 | 3300005530 | Ga0070679_100211243 | Ga0070679_1002112433 | 184 |
| 70 | 3300005539 | Ga0068853_100013001 | Ga0068853_1000130014 | 184 |
| 71 | 3300005539 | Ga0068853_100237912 | Ga0068853_1002379122 | 184 |
| 72 | 3300005548 | Ga0070665_100001028 | Ga0070665_10000102818 | 184 |
| 73 | 3300005548 | Ga0070665_100020888 | Ga0070665_1000208885 | 184 |
| 74 | 3300005548 | Ga0070665_100035576 | Ga0070665_1000355765 | 184 |
| 75 | 3300005563 | Ga0068855_100036799 | Ga0068855_1000367992 | 184 |
| 76 | 3300005563 | Ga0068855_100037088 | Ga0068855_1000370884 | 184 |
| 77 | 3300005563 | Ga0068855_100485824 | Ga0068855_1004858242 | 184 |
| 78 | 3300005563 | Ga0068855_101100679 | Ga0068855_1011006791 | 184 |
| 79 | 3300005564 | Ga0070664_100324064 | Ga0070664_1003240642 | 184 |
| 80 | 3300005577 | Ga0068857_100242429 | Ga0068857_1002424293 | 184 |
| 81 | 3300005617 | Ga0068859_100052214 | Ga0068859_1000522143 | 184 |
| 82 | 3300005618 | Ga0068864_100000453 | Ga0068864_10000045326 | 184 |
| 83 | 3300005618 | Ga0068864_100016914 | Ga0068864_1000169147 | 184 |
| 84 | 3300005719 | Ga0068861_100102591 | Ga0068861_1001025912 | 184 |
| 85 | 3300005841 | Ga0068863_100000423 | Ga0068863_10000042313 | 184 |
| 86 | 3300005841 | Ga0068863_100080639 | Ga0068863_1000806392 | 184 |
| 87 | 3300005841 | Ga0068863_100513529 | Ga0068863_1005135292 | 184 |
| 88 | 3300005841 | Ga0068863_100586576 | Ga0068863_1005865762 | 184 |
| 89 | 3300005842 | Ga0068858_100007627 | Ga0068858_1000076276 | 184 |
| 90 | 3300005843 | Ga0068860_100000167 | Ga0068860_10000016716 | 184 |
| 91 | 3300005844 | Ga0068862_100014392 | Ga0068862_1000143925 | 184 |
| 92 | 3300005844 | Ga0068862_100139721 | Ga0068862_1001397213 | 184 |
| 93 | 3300005844 | Ga0068862_100216149 | Ga0068862_1002161492 | 184 |
| 94 | 3300006028 | Ga0070717_10157295 | Ga0070717_101572952 | 184 |
| 95 | 3300006028 | Ga0070717_10212621 | Ga0070717_102126212 | 184 |
| 96 | 3300006881 | Ga0068865_100044623 | Ga0068865_1000446235 | 184 |
| 97 | 3300006931 | Ga0097620_100052215 | Ga0097620_1000522153 | 184 |
| 98 | 3300009093 | Ga0105240_10042848 | Ga0105240_100428484 | 184 |
| 99 | 3300009093 | Ga0105240_10135396 | Ga0105240_101353963 | 184 |
| 100 | 3300009093 | Ga0105240_10320874 | Ga0105240_103208742 | 184 |
| 101 | 3300009093 | Ga0105240_10344069 | Ga0105240_103440692 | 184 |
| 102 | 3300009093 | Ga0105240_10967096 | Ga0105240_109670961 | 184 |
| 103 | 3300009177 | Ga0105248_10000661 | Ga0105248_1000066121 | 184 |
| 104 | 3300009177 | Ga0105248_10086901 | Ga0105248_100869015 | 184 |
| 105 | 3300009177 | Ga0105248_10130137 | Ga0105248_101301372 | 184 |
| 106 | 3300009545 | Ga0105237_10514027 | Ga0105237_105140272 | 184 |
| 107 | 3300009551 | Ga0105238_10009053 | Ga0105238_100090534 | 184 |
| 108 | 3300009551 | Ga0105238_10025713 | Ga0105238_100257136 | 184 |
| 109 | 3300009551 | Ga0105238_10036991 | Ga0105238_100369916 | 184 |
| 110 | 3300009551 | Ga0105238_10082180 | Ga0105238_100821803 | 184 |
| 111 | 3300009553 | Ga0105249_10023878 | Ga0105249_100238784 | 184 |
| 112 | 3300013104 | Ga0157370_10412481 | Ga0157370_104124813 | 184 |
| 113 | 3300013104 | Ga0157370_10542636 | Ga0157370_105426362 | 184 |
| 114 | 3300013105 | Ga0157369_10652858 | Ga0157369_106528582 | 184 |
| 115 | 3300013296 | Ga0157374_10122287 | Ga0157374_101222873 | 184 |
| 116 | 3300013306 | Ga0163162_10227844 | Ga0163162_102278442 | 184 |
| 117 | 3300013306 | Ga0163162_10775896 | Ga0163162_107758961 | 184 |
| 118 | 3300013307 | Ga0157372_10431090 | Ga0157372_104310902 | 184 |
| 119 | 3300014325 | Ga0163163_10079205 | Ga0163163_100792054 | 184 |
| 120 | 3300014325 | Ga0163163_10085567 | Ga0163163_100855674 | 184 |
| 121 | 3300014968 | Ga0157379_10789476 | Ga0157379_107894762 | 184 |
| 122 | 3300021384 | Ga0213876_10043735 | Ga0213876_100437353 | 184 |
| 123 | 3300025903 | Ga0207680_10303464 | Ga0207680_103034642 | 184 |
| 124 | 3300025909 | Ga0207705_10002746 | Ga0207705_100027468 | 184 |
| 125 | 3300025909 | Ga0207705_10136019 | Ga0207705_101360192 | 184 |
| 126 | 3300025912 | Ga0207707_10026958 | Ga0207707_100269585 | 184 |
| 127 | 3300025912 | Ga0207707_10178863 | Ga0207707_101788633 | 184 |
| 128 | 3300025913 | Ga0207695_10003006 | Ga0207695_1000300610 | 184 |
| 129 | 3300025913 | Ga0207695_10003703 | Ga0207695_100037038 | 184 |
| 130 | 3300025913 | Ga0207695_10085194 | Ga0207695_100851942 | 184 |
| 131 | 3300025913 | Ga0207695_10095202 | Ga0207695_100952022 | 184 |
| 132 | 3300025913 | Ga0207695_10155937 | Ga0207695_101559372 | 184 |
| 133 | 3300025913 | Ga0207695_10241212 | Ga0207695_102412122 | 184 |
| 134 | 3300025913 | Ga0207695_10658641 | Ga0207695_106586412 | 184 |
| 135 | 3300025917 | Ga0207660_10001373 | Ga0207660_1000137315 | 184 |
| 136 | 3300025917 | Ga0207660_10044510 | Ga0207660_100445104 | 184 |
| 137 | 3300025917 | Ga0207660_10097150 | Ga0207660_100971502 | 184 |
| 138 | 3300025919 | Ga0207657_10007334 | Ga0207657_100073348 | 184 |
| 139 | 3300025919 | Ga0207657_10120375 | Ga0207657_101203754 | 184 |
| 140 | 3300025919 | Ga0207657_10127247 | Ga0207657_101272474 | 184 |
| 141 | 3300025921 | Ga0207652_10019197 | Ga0207652_100191977 | 184 |
| 142 | 3300025921 | Ga0207652_10145853 | Ga0207652_101458532 | 184 |
| 143 | 3300025924 | Ga0207694_10010410 | Ga0207694_100104103 | 184 |
| 144 | 3300025924 | Ga0207694_10231402 | Ga0207694_102314022 | 184 |
| 145 | 3300025925 | Ga0207650_10000074 | Ga0207650_1000007418 | 184 |
| 146 | 3300025932 | Ga0207690_10000352 | Ga0207690_1000035228 | 184 |
| 147 | 3300025932 | Ga0207690_10000650 | Ga0207690_1000065018 | 184 |
| 148 | 3300025933 | Ga0207706_10121948 | Ga0207706_101219482 | 184 |
| 149 | 3300025933 | Ga0207706_10234975 | Ga0207706_102349752 | 184 |
| 150 | 3300025938 | Ga0207704_10734751 | Ga0207704_107347511 | 184 |
| 151 | 3300025941 | Ga0207711_10000316 | Ga0207711_1000031637 | 184 |
| 152 | 3300025941 | Ga0207711_10023673 | Ga0207711_100236732 | 184 |
| 153 | 3300025941 | Ga0207711_10048286 | Ga0207711_100482863 | 184 |
| 154 | 3300025945 | Ga0207679_10522944 | Ga0207679_105229442 | 184 |
| 155 | 3300025949 | Ga0207667_10016972 | Ga0207667_100169727 | 184 |
| 156 | 3300025949 | Ga0207667_10030907 | Ga0207667_100309071 | 184 |
| 157 | 3300025949 | Ga0207667_10061585 | Ga0207667_100615852 | 184 |
| 158 | 3300025949 | Ga0207667_10187271 | Ga0207667_101872712 | 184 |
| 159 | 3300025949 | Ga0207667_10421858 | Ga0207667_104218582 | 184 |
| 160 | 3300025961 | Ga0207712_10000835 | Ga0207712_100008354 | 184 |
| 161 | 3300025961 | Ga0207712_10436922 | Ga0207712_104369222 | 184 |
| 162 | 3300025972 | Ga0207668_10000001 | Ga0207668_1000000191 | 184 |
| 163 | 3300025972 | Ga0207668_10000093 | Ga0207668_1000009316 | 184 |
| 164 | 3300025986 | Ga0207658_10000266 | Ga0207658_100002664 | 184 |
| 165 | 3300025986 | Ga0207658_10020077 | Ga0207658_100200774 | 184 |
| 166 | 3300026023 | Ga0207677_10409295 | Ga0207677_104092951 | 184 |
| 167 | 3300026035 | Ga0207703_10005094 | Ga0207703_100050947 | 184 |
| 168 | 3300026041 | Ga0207639_10013635 | Ga0207639_100136355 | 184 |
| 169 | 3300026041 | Ga0207639_10444511 | Ga0207639_104445112 | 184 |
| 170 | 3300026041 | Ga0207639_10971176 | Ga0207639_109711762 | 184 |
| 171 | 3300026088 | Ga0207641_10000830 | Ga0207641_100008303 | 184 |
| 172 | 3300026088 | Ga0207641_10047875 | Ga0207641_100478752 | 184 |
| 173 | 3300026088 | Ga0207641_10234512 | Ga0207641_102345123 | 184 |
| 174 | 3300026088 | Ga0207641_10577469 | Ga0207641_105774692 | 184 |
| 175 | 3300026095 | Ga0207676_10000073 | Ga0207676_1000007390 | 184 |
| 176 | 3300026095 | Ga0207676_10388377 | Ga0207676_103883772 | 184 |
| 177 | 3300026095 | Ga0207676_10491893 | Ga0207676_104918932 | 184 |
| 178 | 3300026095 | Ga0207676_10877002 | Ga0207676_108770021 | 184 |
| 179 | 3300026116 | Ga0207674_10421024 | Ga0207674_104210242 | 184 |
| 180 | 3300026118 | Ga0207675_100205552 | Ga0207675_1002055523 | 184 |
| 181 | 3300026142 | Ga0207698_10552834 | Ga0207698_105528342 | 184 |
| 182 | 3300028379 | Ga0268266_10000189 | Ga0268266_1000018918 | 184 |
| 183 | 3300028379 | Ga0268266_10000289 | Ga0268266_1000028994 | 184 |
| 184 | 3300028379 | Ga0268266_10063632 | Ga0268266_100636324 | 184 |
| 185 | 3300028380 | Ga0268265_10002313 | Ga0268265_100023137 | 184 |
| 186 | 3300028380 | Ga0268265_10187784 | Ga0268265_101877842 | 184 |
| 187 | 3300028380 | Ga0268265_10213434 | Ga0268265_102134343 | 184 |
| 188 | 3300028380 | Ga0268265_10841959 | Ga0268265_108419592 | 184 |
| 189 | 3300028381 | Ga0268264_10000068 | Ga0268264_10000068110 | 184 |
| 190 | 3300028786 | Ga0307517_10005913 | Ga0307517_1000591311 | 184 |
| 191 | 3300031456 | Ga0307513_10005691 | Ga0307513_100056919 | 184 |
| 192 | 3300031456 | Ga0307513_10006289 | Ga0307513_100062897 | 184 |
| 193 | 3300031616 | Ga0307508_10234283 | Ga0307508_102342831 | 184 |
| 194 | 3300033180 | Ga0307510_10007326 | Ga0307510_1000732615 | 184 |
| 195 | 3300035113 | Ga0373936_0001185 | Ga0373936_0001185_8475_9032 | 184 |
| 196 | 3300035170 | Ga0373943_0317650 | Ga0373943_0317650_274_831 | 184 |
| 197 | 3300035170 | Ga0373943_0329736 | Ga0373943_0329736_201_782 | 184 |
| 198 | 3300035171 | Ga0373946_0011640 | Ga0373946_0011640_2431_3012 | 184 |
| 199 | 3300035695 | Ga0373927_0001477 | Ga0373927_0001477_1279_1860 | 184 |
| 200 | 3300035725 | Ga0373947_0308596 | Ga0373947_0308596_308_889 | 184 |
| 201 | 3300037068 | Ga0373925_0000003 | Ga0373925_0000003_3032_3613 | 184 |
| 202 | 3300037471 | Ga0395905_0007741 | Ga0395905_0007741_920_1477 | 184 |
| 203 | 3300038443 | Ga0395901_1049589 | Ga0395901_1049589_150_707 | 184 |
| 204 | 3300039437 | Ga0436365_0859304 | Ga0436365_0859304_1777_2331 | 184 |
| 205 | 3300039437 | Ga0436365_1624259 | Ga0436365_1624259_574_1128 | 184 |
| 206 | 3300044683 | Ga0466965_0200354 | Ga0466965_0200354_492_1049 | 184 |
| 207 | 3300044735 | Ga0466968_0081866 | Ga0466968_0081866_34_588 | 184 |
| 208 | 3300044765 | Ga0466970_0120826 | Ga0466970_0120826_447_1004 | 184 |
| 209 | 3300044842 | Ga0466957_0897735 | Ga0466957_0897735_33_590 | 184 |
| 210 | 3300046506 | Ga0495583_0102938 | Ga0495583_0102938_70_624 | 184 |
| 211 | 3300046516 | Ga0495628_0144776 | Ga0495628_0144776_1248_1802 | 184 |
| 212 | 3300046543 | Ga0495645_0148607 | Ga0495645_0148607_97_654 | 184 |
| 213 | 3300046616 | Ga0495668_0255472 | Ga0495668_0255472_27_584 | 184 |
| 214 | 3300047320 | Ga0495672_0093616 | Ga0495672_0093616_1020_1577 | 184 |
| 215 | 3300047445 | Ga0495677_0123468 | Ga0495677_0123468_326_883 | 184 |
| 216 | 3300048903 | Ga0496100_0309698 | Ga0496100_0309698_174_731 | 184 |
| 217 | 3300048905 | Ga0496102_0071611 | Ga0496102_0071611_2469_3026 | 184 |
| 218 | 3300048905 | Ga0496102_0135150 | Ga0496102_0135150_567_1121 | 184 |
| 219 | 3300048906 | Ga0496103_0100118 | Ga0496103_0100118_1194_1748 | 184 |
| 220 | 3300048913 | Ga0496110_0354785 | Ga0496110_0354785_73_627 | 184 |
| 221 | 3300048915 | Ga0496112_0184423 | Ga0496112_0184423_628_1185 | 184 |
| 222 | 3300048916 | Ga0496113_0825666 | Ga0496113_0825666_64_621 | 184 |
| 223 | 3300048918 | Ga0496115_0001097 | Ga0496115_0001097_11356_11913 | 184 |
| 224 | 3300048918 | Ga0496115_0002362 | Ga0496115_0002362_1999_2553 | 184 |
| 225 | 3300048920 | Ga0496117_0046356 | Ga0496117_0046356_1929_2483 | 184 |
| 226 | 3300048921 | Ga0496118_0005744 | Ga0496118_0005744_9203_9757 | 184 |
| 227 | 3300048924 | Ga0496121_0000397 | Ga0496121_0000397_5129_5683 | 184 |
| 228 | 3300053080 | Ga0500635_0000060 | Ga0500635_0000060_58534_59088 | 184 |
| 229 | 3300053091 | Ga0500647_0108020 | Ga0500647_0108020_66_620 | 184 |
| 230 | 3300053098 | Ga0500650_0290252 | Ga0500650_0290252_28_582 | 184 |
| 231 | 3300053108 | Ga0500562_013071 | Ga0500562_013071_1209_1763 | 184 |
| 232 | 3300053109 | Ga0500569_001440 | Ga0500569_001440_284_838 | 184 |
| 233 | 3300053111 | Ga0500572_104564 | Ga0500572_104564_295_849 | 184 |
| 234 | 3300053119 | Ga0500595_010051 | Ga0500595_010051_32_586 | 184 |
| 235 | 3300053122 | Ga0500608_000296 | Ga0500608_000296_5222_5776 | 184 |
| 236 | 3300053155 | Ga0500620_014158 | Ga0500620_014158_546_1100 | 184 |
| 237 | 3300053157 | Ga0500624_005396 | Ga0500624_005396_905_1459 | 184 |
| 238 | 3300053162 | Ga0500638_124629 | Ga0500638_124629_480_1034 | 184 |
| 239 | 3300053177 | Ga0500636_0029329 | Ga0500636_0029329_636_1190 | 184 |
| 240 | 3300053178 | Ga0500637_0035839 | Ga0500637_0035839_956_1510 | 184 |
| 241 | 3300053729 | Ga0500625_010506 | Ga0500625_010506_2806_3360 | 184 |
| 242 | 3300053737 | Ga0500601_005386 | Ga0500601_005386_381_935 | 184 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar