F354841

General Info

Members Datasets Scaffolds Average Seq Length
242 148 242 183

Family's Representative Sequence

Representative Sequence 3300035170|Ga0373943_0329736|Ga0373943_0329736_201_782
Length 193
Sequence MRGNRAELAMTNPVRGAVDSLANSRGRSMRHIAVGLGLAVGAVALSALMARLNAPTQDDAEIYSDYEERAELDVKPRSKAFSMIWPPLFMVLTLSGLRIWNAPRSAARAQALTLWGTVQALNAVWMALGPKRLGGQLAAAVASLGAAMAYVWRARRVDLPAANMVAPYVGWIGFANVLSEELWRRNAPPQTLH

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
87 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
88 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
89 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
90 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
103 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
110 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
111 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
112 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
113 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
114 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
125 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
126 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
130 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
131 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
132 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
133 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
134 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
135 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
136 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
137 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
138 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
139 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
140 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
141 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
142 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
143 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
144 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
145 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
146 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
147 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
148 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.68
Nodule 0
Rhizoplane 6.2
Rhizosphere 80.58
Stem 0
Stem Tuber 0
Unclassified 4.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10036248 3300005327 Bacteria 3975
2 Ga0070670_100000013 3300005331 Bacteria 250768
3 Ga0070666_10020388 3300005335 Bacteria 4285
4 Ga0070680_100183334 3300005336 Bacteria 1763
5 Ga0070680_100204870 3300005336 Bacteria 1664
6 Ga0068868_100352497 3300005338 Bacteria 1261
7 Ga0070660_100106047 3300005339 Bacteria 2231
8 Ga0070660_100295861 3300005339 Bacteria 1326
9 Ga0070660_100620915 3300005339 Bacteria 904
10 Ga0070660_100767519 3300005339 Bacteria 810
11 Ga0070691_10008549 3300005341 Bacteria 4688
12 Ga0070668_100016480 3300005347 Bacteria 5526
13 Ga0070668_100023831 3300005347 Bacteria 4633
14 Ga0070669_101050358 3300005353 Bacteria 700
15 Ga0070671_100044034 3300005355 Bacteria 3708
16 Ga0070671_100069305 3300005355 Bacteria 2942
17 Ga0070674_100896154 3300005356 Unclassified 772
18 Ga0070659_100018115 3300005366 Bacteria 5311
19 Ga0070659_100098392 3300005366 Bacteria 2352
20 Ga0070667_100014270 3300005367 Bacteria 6562
21 Ga0070667_100029289 3300005367 Bacteria 4587
22 Ga0070663_100020412 3300005455 Bacteria 4388
23 Ga0070678_100019052 3300005456 Bacteria 4463
24 Ga0070662_100265572 3300005457 Bacteria 1384
25 Ga0070662_100768610 3300005457 Unclassified 818
26 Ga0070681_10024266 3300005458 Bacteria 6104
27 Ga0070681_10025956 3300005458 Bacteria 5890
28 Ga0070681_10088637 3300005458 Bacteria 3045
29 Ga0070679_100033598 3300005530 Bacteria 5079
30 Ga0070679_100211243 3300005530 Bacteria 1904
31 Ga0068853_100013001 3300005539 Bacteria 6787
32 Ga0068853_100237912 3300005539 Bacteria 1668
33 Ga0070665_100001028 3300005548 Bacteria 34986
34 Ga0070665_100020888 3300005548 Bacteria 6580
35 Ga0070665_100035576 3300005548 Bacteria 5008
36 Ga0068855_100036799 3300005563 Bacteria 5823
37 Ga0068855_100037088 3300005563 Bacteria 5800
38 Ga0068855_100397108 3300005563 Bacteria 1512
39 Ga0068855_100485824 3300005563 Bacteria 1344
40 Ga0068855_101100679 3300005563 Unclassified 830
41 Ga0070664_100324064 3300005564 Bacteria 1397
42 Ga0068857_100242429 3300005577 Bacteria 1651
43 Ga0068856_100131343 3300005614 Bacteria 2509
44 Ga0068859_100052214 3300005617 Bacteria 4109
45 Ga0068864_100000453 3300005618 Bacteria 35448
46 Ga0068864_100016914 3300005618 Bacteria 6077
47 Ga0068861_100102591 3300005719 Bacteria 2278
48 Ga0068863_100000423 3300005841 Bacteria 42817
49 Ga0068863_100080639 3300005841 Bacteria 3082
50 Ga0068863_100513529 3300005841 Bacteria 1181
51 Ga0068863_100586576 3300005841 Bacteria 1102
52 Ga0068858_100007627 3300005842 Bacteria 10451
53 Ga0068860_100000167 3300005843 Bacteria 108234
54 Ga0068862_100014392 3300005844 Bacteria 6563
55 Ga0068862_100139721 3300005844 Bacteria 2149
56 Ga0068862_100216149 3300005844 Bacteria 1734
57 Ga0070717_10157295 3300006028 Bacteria 1970
58 Ga0070717_10212621 3300006028 Bacteria 1698
59 Ga0068865_100044623 3300006881 Bacteria 3035
60 Ga0097620_100052215 3300006931 Bacteria 4109
61 Ga0105240_10005496 3300009093 Bacteria 18888
62 Ga0105240_10042848 3300009093 Bacteria 5765
63 Ga0105240_10135396 3300009093 Bacteria 2951
64 Ga0105240_10320874 3300009093 Bacteria 1766
65 Ga0105240_10344069 3300009093 Bacteria 1693
66 Ga0105240_10730989 3300009093 Bacteria 1078
67 Ga0105240_10967096 3300009093 Bacteria 912
68 Ga0105248_10000661 3300009177 Bacteria 39161
69 Ga0105248_10086901 3300009177 Bacteria 3519
70 Ga0105248_10130137 3300009177 Bacteria 2839
71 Ga0105237_10514027 3300009545 Bacteria 1204
72 Ga0105238_10009053 3300009551 Bacteria 9961
73 Ga0105238_10025713 3300009551 Bacteria 6003
74 Ga0105238_10036991 3300009551 Bacteria 4963
75 Ga0105238_10082180 3300009551 Bacteria 3211
76 Ga0105238_11471477 3300009551 Bacteria 709
77 Ga0105249_10023878 3300009553 Bacteria 5492
78 Ga0105249_10617535 3300009553 Bacteria 1140
79 Ga0105239_10822977 3300010375 Bacteria 1064
80 Ga0157370_10412481 3300013104 Unclassified 1243
81 Ga0157370_10542636 3300013104 Bacteria 1066
82 Ga0157369_10652858 3300013105 Bacteria 1085
83 Ga0157374_10122287 3300013296 Bacteria 2513
84 Ga0157374_10531513 3300013296 Bacteria 1183
85 Ga0163162_10227844 3300013306 Bacteria 1994
86 Ga0163162_10775896 3300013306 Bacteria 1077
87 Ga0157372_10431090 3300013307 Bacteria 1537
88 Ga0157375_10132915 3300013308 Bacteria 2609
89 Ga0163163_10079205 3300014325 Bacteria 3284
90 Ga0163163_10085567 3300014325 Bacteria 3161
91 Ga0163163_10169796 3300014325 Bacteria 2228
92 Ga0157379_10789476 3300014968 Bacteria 896
93 Ga0213876_10043735 3300021384 Bacteria 2367
94 Ga0207680_10303464 3300025903 Bacteria 1113
95 Ga0207705_10002746 3300025909 Bacteria 13489
96 Ga0207705_10136019 3300025909 Bacteria 1832
97 Ga0207707_10026958 3300025912 Bacteria 5022
98 Ga0207707_10178863 3300025912 Bacteria 1852
99 Ga0207695_10003006 3300025913 Bacteria 24241
100 Ga0207695_10003703 3300025913 Bacteria 21297
101 Ga0207695_10085194 3300025913 Bacteria 3189
102 Ga0207695_10095202 3300025913 Bacteria 2983
103 Ga0207695_10155937 3300025913 Bacteria 2218
104 Ga0207695_10241212 3300025913 Bacteria 1709
105 Ga0207695_10658641 3300025913 Bacteria 928
106 Ga0207660_10001373 3300025917 Bacteria 16319
107 Ga0207660_10044510 3300025917 Bacteria 3123
108 Ga0207660_10097150 3300025917 Bacteria 2194
109 Ga0207657_10007334 3300025919 Bacteria 11313
110 Ga0207657_10120375 3300025919 Bacteria 2160
111 Ga0207657_10127247 3300025919 Bacteria 2091
112 Ga0207652_10019197 3300025921 Bacteria 5618
113 Ga0207652_10145853 3300025921 Bacteria 2118
114 Ga0207694_10010410 3300025924 Bacteria 7011
115 Ga0207694_10231402 3300025924 Bacteria 1509
116 Ga0207694_10508867 3300025924 Bacteria 1009
117 Ga0207650_10000074 3300025925 Bacteria 134837
118 Ga0207644_10009249 3300025931 Bacteria 6464
119 Ga0207690_10000352 3300025932 Bacteria 30589
120 Ga0207690_10000650 3300025932 Bacteria 22303
121 Ga0207706_10121948 3300025933 Bacteria 2292
122 Ga0207706_10234975 3300025933 Bacteria 1603
123 Ga0207704_10734751 3300025938 Bacteria 820
124 Ga0207711_10000316 3300025941 Bacteria 51683
125 Ga0207711_10023673 3300025941 Bacteria 5142
126 Ga0207711_10048286 3300025941 Bacteria 3642
127 Ga0207679_10522944 3300025945 Bacteria 1061
128 Ga0207667_10016972 3300025949 Bacteria 8214
129 Ga0207667_10030907 3300025949 Bacteria 5787
130 Ga0207667_10061585 3300025949 Bacteria 3925
131 Ga0207667_10187271 3300025949 Bacteria 2124
132 Ga0207667_10421858 3300025949 Bacteria 1357
133 Ga0207712_10000835 3300025961 Bacteria 22611
134 Ga0207712_10436922 3300025961 Bacteria 1107
135 Ga0207668_10000001 3300025972 Bacteria 266091
136 Ga0207668_10000093 3300025972 Bacteria 64280
137 Ga0207658_10000266 3300025986 Bacteria 55102
138 Ga0207658_10020077 3300025986 Bacteria 4625
139 Ga0207677_10409295 3300026023 Bacteria 1152
140 Ga0207703_10005094 3300026035 Bacteria 10628
141 Ga0207639_10013635 3300026041 Bacteria 5697
142 Ga0207639_10444511 3300026041 Bacteria 1176
143 Ga0207639_10971176 3300026041 Bacteria 795
144 Ga0207678_10152985 3300026067 Bacteria 1970
145 Ga0207678_10419068 3300026067 Bacteria 1161
146 Ga0207702_10104438 3300026078 Bacteria 2507
147 Ga0207641_10000830 3300026088 Bacteria 32877
148 Ga0207641_10047875 3300026088 Bacteria 3607
149 Ga0207641_10234512 3300026088 Bacteria 1707
150 Ga0207641_10577469 3300026088 Bacteria 1099
151 Ga0207676_10000073 3300026095 Bacteria 101510
152 Ga0207676_10388377 3300026095 Bacteria 1301
153 Ga0207676_10491893 3300026095 Bacteria 1163
154 Ga0207676_10877002 3300026095 Unclassified 879
155 Ga0207674_10421024 3300026116 Bacteria 1290
156 Ga0207675_100205552 3300026118 Bacteria 1892
157 Ga0207683_10124994 3300026121 Bacteria 2311
158 Ga0207698_10552834 3300026142 Bacteria 1128
159 Ga0268266_10000189 3300028379 Bacteria 109217
160 Ga0268266_10000289 3300028379 Bacteria 82515
161 Ga0268266_10063632 3300028379 Bacteria 3184
162 Ga0268265_10002313 3300028380 Bacteria 14498
163 Ga0268265_10187784 3300028380 Bacteria 1782
164 Ga0268265_10213434 3300028380 Bacteria 1683
165 Ga0268265_10841959 3300028380 Unclassified 897
166 Ga0268264_10000068 3300028381 Bacteria 275708
167 Ga0307517_10005913 3300028786 Bacteria 18260
168 Ga0265327_10002474 3300031251 Bacteria 19424
169 Ga0307513_10005691 3300031456 Bacteria 16403
170 Ga0307513_10006289 3300031456 Bacteria 15552
171 Ga0307508_10234283 3300031616 Bacteria 1434
172 Ga0307510_10007326 3300033180 Bacteria 13142
173 Ga0373936_0001185 3300035113 Bacteria 9380
174 Ga0373943_0317650 3300035170 Unclassified 887
175 Ga0373943_0329736 3300035170 Bacteria 871
176 Ga0373946_0011640 3300035171 Bacteria 3288
177 Ga0373927_0001477 3300035695 Bacteria 17700
178 Ga0373947_0308596 3300035725 Bacteria 1056
179 Ga0373925_0000003 3300037068 Bacteria 362401
180 Ga0395899_0215289 3300037312 Bacteria 1333
181 Ga0395905_0007741 3300037471 Bacteria 10656
182 Ga0395901_1049589 3300038443 Unclassified 788
183 Ga0436365_0859304 3300039437 Bacteria 3274
184 Ga0436365_1624259 3300039437 Bacteria 1365
185 Ga0466965_0200354 3300044683 Bacteria 1059
186 Ga0466968_0081866 3300044735 Bacteria 1420
187 Ga0466970_0120826 3300044765 Bacteria 1435
188 Ga0466957_0897735 3300044842 Bacteria 633
189 Ga0495583_0015717 3300046506 Bacteria 4102
190 Ga0495583_0102938 3300046506 Bacteria 1217
191 Ga0495628_0144776 3300046516 Bacteria 1812
192 Ga0495630_0188824 3300046517 Bacteria 1572
193 Ga0495645_0148607 3300046543 Bacteria 1630
194 Ga0495668_0255472 3300046616 Bacteria 959
195 Ga0495611_0001744 3300046648 Bacteria 10530
196 Ga0495625_0261654 3300046660 Bacteria 1119
197 Ga0495659_0352075 3300046664 Bacteria 629
198 Ga0495669_0083284 3300046684 Bacteria 1470
199 Ga0495672_0093616 3300047320 Bacteria 1645
200 Ga0495677_0123468 3300047445 Bacteria 988
201 Ga0495681_0058903 3300047470 Bacteria 1778
202 Ga0496100_0309698 3300048903 Bacteria 1184
203 Ga0496102_0071611 3300048905 Bacteria 3183
204 Ga0496102_0135150 3300048905 Bacteria 2310
205 Ga0496102_0206232 3300048905 Bacteria 1853
206 Ga0496103_0100118 3300048906 Bacteria 1834
207 Ga0496104_0361155 3300048907 Bacteria 1365
208 Ga0496108_0035751 3300048911 Bacteria 4131
209 Ga0496109_0264207 3300048912 Bacteria 1621
210 Ga0496110_0354785 3300048913 Bacteria 1336
211 Ga0496112_0148473 3300048915 Bacteria 2312
212 Ga0496112_0184423 3300048915 Bacteria 2050
213 Ga0496113_0825666 3300048916 Bacteria 736
214 Ga0496115_0001097 3300048918 Bacteria 19591
215 Ga0496115_0002362 3300048918 Bacteria 13536
216 Ga0496115_0091793 3300048918 Bacteria 2482
217 Ga0496117_0046356 3300048920 Bacteria 3127
218 Ga0496118_0005744 3300048921 Bacteria 13955
219 Ga0496121_0000397 3300048924 Bacteria 87422
220 Ga0501047_0010382 3300049581 Bacteria 8811
221 Ga0501048_0270310 3300049582 Bacteria 1208
222 Ga0500635_0000060 3300053080 Bacteria 72066
223 Ga0500643_014037 3300053087 Bacteria 2801
224 Ga0500647_0108020 3300053091 Bacteria 1325
225 Ga0500641_0113950 3300053096 Bacteria 1164
226 Ga0500650_0290252 3300053098 Bacteria 726
227 Ga0500556_0130289 3300053104 Bacteria 985
228 Ga0500562_001087 3300053108 Bacteria 6677
229 Ga0500562_013071 3300053108 Bacteria 2115
230 Ga0500569_001440 3300053109 Bacteria 4491
231 Ga0500572_104564 3300053111 Bacteria 907
232 Ga0500595_010051 3300053119 Bacteria 3780
233 Ga0500607_113995 3300053121 Bacteria 1320
234 Ga0500608_000296 3300053122 Bacteria 19335
235 Ga0500590_015803 3300053148 Bacteria 3898
236 Ga0500620_014158 3300053155 Bacteria 2219
237 Ga0500624_005396 3300053157 Bacteria 1699
238 Ga0500638_124629 3300053162 Bacteria 1175
239 Ga0500636_0029329 3300053177 Bacteria 3250
240 Ga0500637_0035839 3300053178 Bacteria 2783
241 Ga0500625_010506 3300053729 Bacteria 4167
242 Ga0500601_005386 3300053737 Bacteria 1400

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0215289 Ga0395899_0215289_855_1322 155
2 3300053104 Ga0500556_0130289 Ga0500556_0130289_361_915 157
3 3300009093 Ga0105240_10005496 Ga0105240_100054969 165
4 3300009553 Ga0105249_10617535 Ga0105249_106175352 165
5 3300013296 Ga0157374_10531513 Ga0157374_105315131 165
6 3300013308 Ga0157375_10132915 Ga0157375_101329152 165
7 3300014325 Ga0163163_10169796 Ga0163163_101697961 165
8 3300046648 Ga0495611_0001744 Ga0495611_0001744_2688_3185 165
9 3300046664 Ga0495659_0352075 Ga0495659_0352075_103_600 165
10 3300047470 Ga0495681_0058903 Ga0495681_0058903_676_1173 165
11 3300048905 Ga0496102_0206232 Ga0496102_0206232_912_1409 165
12 3300048907 Ga0496104_0361155 Ga0496104_0361155_379_876 165
13 3300048911 Ga0496108_0035751 Ga0496108_0035751_2318_2815 165
14 3300048912 Ga0496109_0264207 Ga0496109_0264207_1001_1498 165
15 3300048915 Ga0496112_0148473 Ga0496112_0148473_988_1485 165
16 3300048918 Ga0496115_0091793 Ga0496115_0091793_1331_1891 166
17 3300046517 Ga0495630_0188824 Ga0495630_0188824_127_684 170
18 3300009093 Ga0105240_10730989 Ga0105240_107309892 176
19 3300049581 Ga0501047_0010382 Ga0501047_0010382_1726_2268 176
20 3300049582 Ga0501048_0270310 Ga0501048_0270310_294_836 176
21 3300053096 Ga0500641_0113950 Ga0500641_0113950_515_1048 176
22 3300053108 Ga0500562_001087 Ga0500562_001087_4584_5129 180
23 3300053087 Ga0500643_014037 Ga0500643_014037_1521_2066 181
24 3300053121 Ga0500607_113995 Ga0500607_113995_443_988 181
25 3300053148 Ga0500590_015803 Ga0500590_015803_842_1387 181
26 3300031251 Ga0265327_10002474 Ga0265327_100024742 182
27 3300005355 Ga0070671_100069305 Ga0070671_1000693052 183
28 3300005455 Ga0070663_100020412 Ga0070663_1000204124 183
29 3300005563 Ga0068855_100397108 Ga0068855_1003971083 183
30 3300005614 Ga0068856_100131343 Ga0068856_1001313432 183
31 3300009551 Ga0105238_11471477 Ga0105238_114714771 183
32 3300010375 Ga0105239_10822977 Ga0105239_108229771 183
33 3300025924 Ga0207694_10508867 Ga0207694_105088671 183
34 3300025931 Ga0207644_10009249 Ga0207644_100092492 183
35 3300026067 Ga0207678_10152985 Ga0207678_101529853 183
36 3300026067 Ga0207678_10419068 Ga0207678_104190682 183
37 3300026078 Ga0207702_10104438 Ga0207702_101044382 183
38 3300026121 Ga0207683_10124994 Ga0207683_101249941 183
39 3300046506 Ga0495583_0015717 Ga0495583_0015717_2040_2594 183
40 3300046660 Ga0495625_0261654 Ga0495625_0261654_539_1093 183
41 3300046684 Ga0495669_0083284 Ga0495669_0083284_129_683 183
42 3300005327 Ga0070658_10036248 Ga0070658_100362485 184
43 3300005331 Ga0070670_100000013 Ga0070670_100000013205 184
44 3300005335 Ga0070666_10020388 Ga0070666_100203884 184
45 3300005336 Ga0070680_100183334 Ga0070680_1001833342 184
46 3300005336 Ga0070680_100204870 Ga0070680_1002048702 184
47 3300005338 Ga0068868_100352497 Ga0068868_1003524972 184
48 3300005339 Ga0070660_100106047 Ga0070660_1001060472 184
49 3300005339 Ga0070660_100295861 Ga0070660_1002958612 184
50 3300005339 Ga0070660_100620915 Ga0070660_1006209151 184
51 3300005339 Ga0070660_100767519 Ga0070660_1007675191 184
52 3300005341 Ga0070691_10008549 Ga0070691_100085494 184
53 3300005347 Ga0070668_100016480 Ga0070668_1000164805 184
54 3300005347 Ga0070668_100023831 Ga0070668_1000238315 184
55 3300005353 Ga0070669_101050358 Ga0070669_1010503581 184
56 3300005355 Ga0070671_100044034 Ga0070671_1000440344 184
57 3300005356 Ga0070674_100896154 Ga0070674_1008961541 184
58 3300005366 Ga0070659_100018115 Ga0070659_1000181151 184
59 3300005366 Ga0070659_100098392 Ga0070659_1000983922 184
60 3300005367 Ga0070667_100014270 Ga0070667_1000142704 184
61 3300005367 Ga0070667_100029289 Ga0070667_1000292894 184
62 3300005456 Ga0070678_100019052 Ga0070678_1000190524 184
63 3300005457 Ga0070662_100265572 Ga0070662_1002655722 184
64 3300005457 Ga0070662_100768610 Ga0070662_1007686101 184
65 3300005458 Ga0070681_10024266 Ga0070681_100242667 184
66 3300005458 Ga0070681_10025956 Ga0070681_100259566 184
67 3300005458 Ga0070681_10088637 Ga0070681_100886374 184
68 3300005530 Ga0070679_100033598 Ga0070679_1000335985 184
69 3300005530 Ga0070679_100211243 Ga0070679_1002112433 184
70 3300005539 Ga0068853_100013001 Ga0068853_1000130014 184
71 3300005539 Ga0068853_100237912 Ga0068853_1002379122 184
72 3300005548 Ga0070665_100001028 Ga0070665_10000102818 184
73 3300005548 Ga0070665_100020888 Ga0070665_1000208885 184
74 3300005548 Ga0070665_100035576 Ga0070665_1000355765 184
75 3300005563 Ga0068855_100036799 Ga0068855_1000367992 184
76 3300005563 Ga0068855_100037088 Ga0068855_1000370884 184
77 3300005563 Ga0068855_100485824 Ga0068855_1004858242 184
78 3300005563 Ga0068855_101100679 Ga0068855_1011006791 184
79 3300005564 Ga0070664_100324064 Ga0070664_1003240642 184
80 3300005577 Ga0068857_100242429 Ga0068857_1002424293 184
81 3300005617 Ga0068859_100052214 Ga0068859_1000522143 184
82 3300005618 Ga0068864_100000453 Ga0068864_10000045326 184
83 3300005618 Ga0068864_100016914 Ga0068864_1000169147 184
84 3300005719 Ga0068861_100102591 Ga0068861_1001025912 184
85 3300005841 Ga0068863_100000423 Ga0068863_10000042313 184
86 3300005841 Ga0068863_100080639 Ga0068863_1000806392 184
87 3300005841 Ga0068863_100513529 Ga0068863_1005135292 184
88 3300005841 Ga0068863_100586576 Ga0068863_1005865762 184
89 3300005842 Ga0068858_100007627 Ga0068858_1000076276 184
90 3300005843 Ga0068860_100000167 Ga0068860_10000016716 184
91 3300005844 Ga0068862_100014392 Ga0068862_1000143925 184
92 3300005844 Ga0068862_100139721 Ga0068862_1001397213 184
93 3300005844 Ga0068862_100216149 Ga0068862_1002161492 184
94 3300006028 Ga0070717_10157295 Ga0070717_101572952 184
95 3300006028 Ga0070717_10212621 Ga0070717_102126212 184
96 3300006881 Ga0068865_100044623 Ga0068865_1000446235 184
97 3300006931 Ga0097620_100052215 Ga0097620_1000522153 184
98 3300009093 Ga0105240_10042848 Ga0105240_100428484 184
99 3300009093 Ga0105240_10135396 Ga0105240_101353963 184
100 3300009093 Ga0105240_10320874 Ga0105240_103208742 184
101 3300009093 Ga0105240_10344069 Ga0105240_103440692 184
102 3300009093 Ga0105240_10967096 Ga0105240_109670961 184
103 3300009177 Ga0105248_10000661 Ga0105248_1000066121 184
104 3300009177 Ga0105248_10086901 Ga0105248_100869015 184
105 3300009177 Ga0105248_10130137 Ga0105248_101301372 184
106 3300009545 Ga0105237_10514027 Ga0105237_105140272 184
107 3300009551 Ga0105238_10009053 Ga0105238_100090534 184
108 3300009551 Ga0105238_10025713 Ga0105238_100257136 184
109 3300009551 Ga0105238_10036991 Ga0105238_100369916 184
110 3300009551 Ga0105238_10082180 Ga0105238_100821803 184
111 3300009553 Ga0105249_10023878 Ga0105249_100238784 184
112 3300013104 Ga0157370_10412481 Ga0157370_104124813 184
113 3300013104 Ga0157370_10542636 Ga0157370_105426362 184
114 3300013105 Ga0157369_10652858 Ga0157369_106528582 184
115 3300013296 Ga0157374_10122287 Ga0157374_101222873 184
116 3300013306 Ga0163162_10227844 Ga0163162_102278442 184
117 3300013306 Ga0163162_10775896 Ga0163162_107758961 184
118 3300013307 Ga0157372_10431090 Ga0157372_104310902 184
119 3300014325 Ga0163163_10079205 Ga0163163_100792054 184
120 3300014325 Ga0163163_10085567 Ga0163163_100855674 184
121 3300014968 Ga0157379_10789476 Ga0157379_107894762 184
122 3300021384 Ga0213876_10043735 Ga0213876_100437353 184
123 3300025903 Ga0207680_10303464 Ga0207680_103034642 184
124 3300025909 Ga0207705_10002746 Ga0207705_100027468 184
125 3300025909 Ga0207705_10136019 Ga0207705_101360192 184
126 3300025912 Ga0207707_10026958 Ga0207707_100269585 184
127 3300025912 Ga0207707_10178863 Ga0207707_101788633 184
128 3300025913 Ga0207695_10003006 Ga0207695_1000300610 184
129 3300025913 Ga0207695_10003703 Ga0207695_100037038 184
130 3300025913 Ga0207695_10085194 Ga0207695_100851942 184
131 3300025913 Ga0207695_10095202 Ga0207695_100952022 184
132 3300025913 Ga0207695_10155937 Ga0207695_101559372 184
133 3300025913 Ga0207695_10241212 Ga0207695_102412122 184
134 3300025913 Ga0207695_10658641 Ga0207695_106586412 184
135 3300025917 Ga0207660_10001373 Ga0207660_1000137315 184
136 3300025917 Ga0207660_10044510 Ga0207660_100445104 184
137 3300025917 Ga0207660_10097150 Ga0207660_100971502 184
138 3300025919 Ga0207657_10007334 Ga0207657_100073348 184
139 3300025919 Ga0207657_10120375 Ga0207657_101203754 184
140 3300025919 Ga0207657_10127247 Ga0207657_101272474 184
141 3300025921 Ga0207652_10019197 Ga0207652_100191977 184
142 3300025921 Ga0207652_10145853 Ga0207652_101458532 184
143 3300025924 Ga0207694_10010410 Ga0207694_100104103 184
144 3300025924 Ga0207694_10231402 Ga0207694_102314022 184
145 3300025925 Ga0207650_10000074 Ga0207650_1000007418 184
146 3300025932 Ga0207690_10000352 Ga0207690_1000035228 184
147 3300025932 Ga0207690_10000650 Ga0207690_1000065018 184
148 3300025933 Ga0207706_10121948 Ga0207706_101219482 184
149 3300025933 Ga0207706_10234975 Ga0207706_102349752 184
150 3300025938 Ga0207704_10734751 Ga0207704_107347511 184
151 3300025941 Ga0207711_10000316 Ga0207711_1000031637 184
152 3300025941 Ga0207711_10023673 Ga0207711_100236732 184
153 3300025941 Ga0207711_10048286 Ga0207711_100482863 184
154 3300025945 Ga0207679_10522944 Ga0207679_105229442 184
155 3300025949 Ga0207667_10016972 Ga0207667_100169727 184
156 3300025949 Ga0207667_10030907 Ga0207667_100309071 184
157 3300025949 Ga0207667_10061585 Ga0207667_100615852 184
158 3300025949 Ga0207667_10187271 Ga0207667_101872712 184
159 3300025949 Ga0207667_10421858 Ga0207667_104218582 184
160 3300025961 Ga0207712_10000835 Ga0207712_100008354 184
161 3300025961 Ga0207712_10436922 Ga0207712_104369222 184
162 3300025972 Ga0207668_10000001 Ga0207668_1000000191 184
163 3300025972 Ga0207668_10000093 Ga0207668_1000009316 184
164 3300025986 Ga0207658_10000266 Ga0207658_100002664 184
165 3300025986 Ga0207658_10020077 Ga0207658_100200774 184
166 3300026023 Ga0207677_10409295 Ga0207677_104092951 184
167 3300026035 Ga0207703_10005094 Ga0207703_100050947 184
168 3300026041 Ga0207639_10013635 Ga0207639_100136355 184
169 3300026041 Ga0207639_10444511 Ga0207639_104445112 184
170 3300026041 Ga0207639_10971176 Ga0207639_109711762 184
171 3300026088 Ga0207641_10000830 Ga0207641_100008303 184
172 3300026088 Ga0207641_10047875 Ga0207641_100478752 184
173 3300026088 Ga0207641_10234512 Ga0207641_102345123 184
174 3300026088 Ga0207641_10577469 Ga0207641_105774692 184
175 3300026095 Ga0207676_10000073 Ga0207676_1000007390 184
176 3300026095 Ga0207676_10388377 Ga0207676_103883772 184
177 3300026095 Ga0207676_10491893 Ga0207676_104918932 184
178 3300026095 Ga0207676_10877002 Ga0207676_108770021 184
179 3300026116 Ga0207674_10421024 Ga0207674_104210242 184
180 3300026118 Ga0207675_100205552 Ga0207675_1002055523 184
181 3300026142 Ga0207698_10552834 Ga0207698_105528342 184
182 3300028379 Ga0268266_10000189 Ga0268266_1000018918 184
183 3300028379 Ga0268266_10000289 Ga0268266_1000028994 184
184 3300028379 Ga0268266_10063632 Ga0268266_100636324 184
185 3300028380 Ga0268265_10002313 Ga0268265_100023137 184
186 3300028380 Ga0268265_10187784 Ga0268265_101877842 184
187 3300028380 Ga0268265_10213434 Ga0268265_102134343 184
188 3300028380 Ga0268265_10841959 Ga0268265_108419592 184
189 3300028381 Ga0268264_10000068 Ga0268264_10000068110 184
190 3300028786 Ga0307517_10005913 Ga0307517_1000591311 184
191 3300031456 Ga0307513_10005691 Ga0307513_100056919 184
192 3300031456 Ga0307513_10006289 Ga0307513_100062897 184
193 3300031616 Ga0307508_10234283 Ga0307508_102342831 184
194 3300033180 Ga0307510_10007326 Ga0307510_1000732615 184
195 3300035113 Ga0373936_0001185 Ga0373936_0001185_8475_9032 184
196 3300035170 Ga0373943_0317650 Ga0373943_0317650_274_831 184
197 3300035170 Ga0373943_0329736 Ga0373943_0329736_201_782 184
198 3300035171 Ga0373946_0011640 Ga0373946_0011640_2431_3012 184
199 3300035695 Ga0373927_0001477 Ga0373927_0001477_1279_1860 184
200 3300035725 Ga0373947_0308596 Ga0373947_0308596_308_889 184
201 3300037068 Ga0373925_0000003 Ga0373925_0000003_3032_3613 184
202 3300037471 Ga0395905_0007741 Ga0395905_0007741_920_1477 184
203 3300038443 Ga0395901_1049589 Ga0395901_1049589_150_707 184
204 3300039437 Ga0436365_0859304 Ga0436365_0859304_1777_2331 184
205 3300039437 Ga0436365_1624259 Ga0436365_1624259_574_1128 184
206 3300044683 Ga0466965_0200354 Ga0466965_0200354_492_1049 184
207 3300044735 Ga0466968_0081866 Ga0466968_0081866_34_588 184
208 3300044765 Ga0466970_0120826 Ga0466970_0120826_447_1004 184
209 3300044842 Ga0466957_0897735 Ga0466957_0897735_33_590 184
210 3300046506 Ga0495583_0102938 Ga0495583_0102938_70_624 184
211 3300046516 Ga0495628_0144776 Ga0495628_0144776_1248_1802 184
212 3300046543 Ga0495645_0148607 Ga0495645_0148607_97_654 184
213 3300046616 Ga0495668_0255472 Ga0495668_0255472_27_584 184
214 3300047320 Ga0495672_0093616 Ga0495672_0093616_1020_1577 184
215 3300047445 Ga0495677_0123468 Ga0495677_0123468_326_883 184
216 3300048903 Ga0496100_0309698 Ga0496100_0309698_174_731 184
217 3300048905 Ga0496102_0071611 Ga0496102_0071611_2469_3026 184
218 3300048905 Ga0496102_0135150 Ga0496102_0135150_567_1121 184
219 3300048906 Ga0496103_0100118 Ga0496103_0100118_1194_1748 184
220 3300048913 Ga0496110_0354785 Ga0496110_0354785_73_627 184
221 3300048915 Ga0496112_0184423 Ga0496112_0184423_628_1185 184
222 3300048916 Ga0496113_0825666 Ga0496113_0825666_64_621 184
223 3300048918 Ga0496115_0001097 Ga0496115_0001097_11356_11913 184
224 3300048918 Ga0496115_0002362 Ga0496115_0002362_1999_2553 184
225 3300048920 Ga0496117_0046356 Ga0496117_0046356_1929_2483 184
226 3300048921 Ga0496118_0005744 Ga0496118_0005744_9203_9757 184
227 3300048924 Ga0496121_0000397 Ga0496121_0000397_5129_5683 184
228 3300053080 Ga0500635_0000060 Ga0500635_0000060_58534_59088 184
229 3300053091 Ga0500647_0108020 Ga0500647_0108020_66_620 184
230 3300053098 Ga0500650_0290252 Ga0500650_0290252_28_582 184
231 3300053108 Ga0500562_013071 Ga0500562_013071_1209_1763 184
232 3300053109 Ga0500569_001440 Ga0500569_001440_284_838 184
233 3300053111 Ga0500572_104564 Ga0500572_104564_295_849 184
234 3300053119 Ga0500595_010051 Ga0500595_010051_32_586 184
235 3300053122 Ga0500608_000296 Ga0500608_000296_5222_5776 184
236 3300053155 Ga0500620_014158 Ga0500620_014158_546_1100 184
237 3300053157 Ga0500624_005396 Ga0500624_005396_905_1459 184
238 3300053162 Ga0500638_124629 Ga0500638_124629_480_1034 184
239 3300053177 Ga0500636_0029329 Ga0500636_0029329_636_1190 184
240 3300053178 Ga0500637_0035839 Ga0500637_0035839_956_1510 184
241 3300053729 Ga0500625_010506 Ga0500625_010506_2806_3360 184
242 3300053737 Ga0500601_005386 Ga0500601_005386_381_935 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03073

TspO_MBR

TspO/MBR family

33

184

0.85

Feature Viewer

pLDDT pTM Quality
50.37 0.34 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map