F354800

General Info

Members Datasets Scaffolds Average Seq Length
242 127 484 173

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100109288|Ga0307408_1001092882
Length 198
Sequence VPIVAALAAVLFILLLAIVLMPLSLFQRYRVGTMRRLARGWVATVNLTAIVLSIGIFLFSAALTSIWVPGAFSYSLAGLLAGCACGLLGLALTRWEASPHSLHYTPNRWLVLIITFVVTARVLYGFWRSWHAWQSGLQGGTWFVEAGVAGSLGAGAIVLGYYLIFWVGVRRRLKAHRRQFGIGESPMPPSRGFARRVR

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
95 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
96 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
97 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
98 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
99 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
100 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
101 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
104 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
105 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
106 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
107 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
108 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
109 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
110 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
111 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
112 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
113 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
114 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
115 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
116 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
117 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
118 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
121 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
125 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
126 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
127 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.44
Nodule 0
Rhizoplane 0.41
Rhizosphere 90.08
Stem 0
Stem Tuber 0
Unclassified 21.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100109288 3300031548 Bacteria 2121
2 Ga0065707_10251772 3300005295 Unclassified 1123
3 Ga0070676_10059230 3300005328 Bacteria 2271
4 Ga0070690_100368562 3300005330 Bacteria 1047
5 Ga0070670_100035674 3300005331 Bacteria 4281
6 Ga0070670_100038972 3300005331 Bacteria 4086
7 Ga0070670_100114349 3300005331 Bacteria 2327
8 Ga0070670_100739731 3300005331 Bacteria 886
9 Ga0070677_10552837 3300005333 Unclassified 631
10 Ga0070680_100069364 3300005336 Unclassified 2895
11 Ga0070680_100108840 3300005336 Bacteria 2306
12 Ga0070692_10623940 3300005345 Unclassified 716
13 Ga0070668_100435234 3300005347 Bacteria 1125
14 Ga0070668_100612995 3300005347 Bacteria 953
15 Ga0070669_100176137 3300005353 Bacteria 1670
16 Ga0070675_100193560 3300005354 Bacteria 1763
17 Ga0070671_100002933 3300005355 Bacteria 13262
18 Ga0070674_100003222 3300005356 Bacteria 9105
19 Ga0070674_100987845 3300005356 Unclassified 738
20 Ga0070674_101132235 3300005356 Unclassified 692
21 Ga0070673_100024077 3300005364 Bacteria 4458
22 Ga0070659_100593746 3300005366 Unclassified 951
23 Ga0070667_100121841 3300005367 Bacteria 2269
24 Ga0070667_100674601 3300005367 Bacteria 955
25 Ga0070701_10058904 3300005438 Bacteria 2017
26 Ga0070700_100013295 3300005441 Bacteria 4623
27 Ga0070663_100039522 3300005455 Bacteria 3297
28 Ga0070678_100303258 3300005456 Bacteria 1358
29 Ga0070678_100437631 3300005456 Bacteria 1143
30 Ga0070662_100216802 3300005457 Bacteria 1525
31 Ga0070662_100237564 3300005457 Bacteria 1460
32 Ga0070662_100582666 3300005457 Bacteria 940
33 Ga0070662_100828439 3300005457 Bacteria 787
34 Ga0070706_100144882 3300005467 Unclassified 2218
35 Ga0070706_100197094 3300005467 Bacteria 1881
36 Ga0070707_100561619 3300005468 Unclassified 1103
37 Ga0070698_100131378 3300005471 Bacteria 2459
38 Ga0070684_100353728 3300005535 Bacteria 1351
39 Ga0070672_100200941 3300005543 Bacteria 1667
40 Ga0070665_100119755 3300005548 Bacteria 2634
41 Ga0070665_100653110 3300005548 Bacteria 1065
42 Ga0070704_100130089 3300005549 Bacteria 1949
43 Ga0070664_100214944 3300005564 Unclassified 1719
44 Ga0068857_100407829 3300005577 Bacteria 1265
45 Ga0068854_100269115 3300005578 Bacteria 1367
46 Ga0068852_100509626 3300005616 Unclassified 1199
47 Ga0068859_101141177 3300005617 Unclassified 858
48 Ga0068864_100062018 3300005618 Bacteria 3239
49 Ga0068861_100222820 3300005719 Bacteria 1595
50 Ga0068861_100280109 3300005719 Unclassified 1435
51 Ga0068858_100975011 3300005842 Unclassified 830
52 Ga0075365_10125114 3300006038 Bacteria 1776
53 Ga0075364_10044237 3300006051 Bacteria 2896
54 Ga0075364_10195601 3300006051 Bacteria 1370
55 Ga0075367_10017136 3300006178 Bacteria 3971
56 Ga0075367_10239397 3300006178 Bacteria 1137
57 Ga0075366_10186280 3300006195 Unclassified 1261
58 Ga0075370_10088163 3300006353 Bacteria 1789
59 Ga0075428_100007007 3300006844 Bacteria 12498
60 Ga0075428_100020570 3300006844 Bacteria 7307
61 Ga0075428_100030929 3300006844 Bacteria 5920
62 Ga0075428_100036476 3300006844 Bacteria 5415
63 Ga0075428_100065003 3300006844 Bacteria 3995
64 Ga0075428_100194763 3300006844 Bacteria 2192
65 Ga0075428_100372325 3300006844 Unclassified 1531
66 Ga0075428_100532741 3300006844 Unclassified 1256
67 Ga0075428_101605359 3300006844 Unclassified 680
68 Ga0075430_100033784 3300006846 Bacteria 4340
69 Ga0075430_100087333 3300006846 Bacteria 2610
70 Ga0075430_100160484 3300006846 Bacteria 1871
71 Ga0075430_100570939 3300006846 Unclassified 933
72 Ga0075430_100698835 3300006846 Bacteria 836
73 Ga0075430_100810076 3300006846 Unclassified 772
74 Ga0075431_100003702 3300006847 Bacteria 14851
75 Ga0075431_100007959 3300006847 Bacteria 10568
76 Ga0075431_100019853 3300006847 Bacteria 6862
77 Ga0075431_100030614 3300006847 Bacteria 5544
78 Ga0075431_100340752 3300006847 Bacteria 1509
79 Ga0075434_100143628 3300006871 Bacteria 2407
80 Ga0075434_100657397 3300006871 Unclassified 1066
81 Ga0075429_100021074 3300006880 Bacteria 5653
82 Ga0075429_100028156 3300006880 Bacteria 4878
83 Ga0075429_100440678 3300006880 Bacteria 1141
84 Ga0075429_100666439 3300006880 Unclassified 911
85 Ga0097620_101141207 3300006931 Unclassified 858
86 Ga0111539_10002545 3300009094 Bacteria 24146
87 Ga0111539_10011473 3300009094 Bacteria 11121
88 Ga0111539_10062243 3300009094 Bacteria 4418
89 Ga0111539_10158708 3300009094 Bacteria 2646
90 Ga0111539_10254487 3300009094 Bacteria 2045
91 Ga0111539_10489524 3300009094 Unclassified 1432
92 Ga0111539_11949478 3300009094 Bacteria 681
93 Ga0114129_10024483 3300009147 Bacteria 8554
94 Ga0114129_10222781 3300009147 Bacteria 2544
95 Ga0114129_10439975 3300009147 Bacteria 1712
96 Ga0114129_10466762 3300009147 Bacteria 1654
97 Ga0114129_10688332 3300009147 Unclassified 1315
98 Ga0114129_10998441 3300009147 Unclassified 1054
99 Ga0105243_10229810 3300009148 Bacteria 1645
100 Ga0105243_10291297 3300009148 Bacteria 1475
101 Ga0105248_12159438 3300009177 Unclassified 633
102 Ga0105249_10108747 3300009553 Bacteria 2618
103 Ga0163163_10433768 3300014325 Bacteria 1373
104 Ga0157380_10008912 3300014326 Bacteria 7168
105 Ga0157380_10012925 3300014326 Bacteria 6068
106 Ga0157380_10080996 3300014326 Unclassified 2654
107 Ga0157380_10159981 3300014326 Bacteria 1956
108 Ga0157380_10241515 3300014326 Bacteria 1629
109 Ga0157380_10307334 3300014326 Bacteria 1464
110 Ga0157380_10913133 3300014326 Unclassified 905
111 Ga0157377_10069552 3300014745 Bacteria 2031
112 Ga0157376_10810282 3300014969 Bacteria 950
113 Ga0163161_10051741 3300017792 Bacteria 2976
114 Ga0213876_10001052 3300021384 Bacteria 17812
115 Ga0213876_10153913 3300021384 Unclassified 1223
116 Ga0207656_10243117 3300025321 Bacteria 880
117 Ga0207682_10120997 3300025893 Bacteria 1161
118 Ga0207645_10187700 3300025907 Bacteria 1358
119 Ga0207643_10425361 3300025908 Unclassified 842
120 Ga0207684_10117344 3300025910 Unclassified 2280
121 Ga0207684_10300303 3300025910 Bacteria 1384
122 Ga0207660_10134264 3300025917 Bacteria 1887
123 Ga0207681_10206937 3300025923 Bacteria 1510
124 Ga0207681_10847247 3300025923 Bacteria 764
125 Ga0207694_10290578 3300025924 Bacteria 1344
126 Ga0207650_10368891 3300025925 Bacteria 1184
127 Ga0207650_10908033 3300025925 Bacteria 748
128 Ga0207659_10026223 3300025926 Bacteria 3930
129 Ga0207644_10031445 3300025931 Bacteria 3698
130 Ga0207706_10137610 3300025933 Bacteria 2148
131 Ga0207669_10049704 3300025937 Bacteria 2501
132 Ga0207669_10550718 3300025937 Bacteria 931
133 Ga0207691_10143841 3300025940 Bacteria 2100
134 Ga0207668_10238015 3300025972 Bacteria 1471
135 Ga0207668_10280119 3300025972 Bacteria 1367
136 Ga0207668_10297465 3300025972 Bacteria 1331
137 Ga0207678_10060070 3300026067 Bacteria 3270
138 Ga0207678_10163161 3300026067 Unclassified 1903
139 Ga0207708_10025021 3300026075 Bacteria 4515
140 Ga0207708_10164095 3300026075 Bacteria 1756
141 Ga0207676_10048158 3300026095 Bacteria 3308
142 Ga0207675_100277520 3300026118 Bacteria 1628
143 Ga0207675_100945444 3300026118 Bacteria 879
144 Ga0207683_10218183 3300026121 Bacteria 1737
145 Ga0207683_10529982 3300026121 Bacteria 1089
146 Ga0209813_10052236 3300027866 Bacteria 1281
147 Ga0207428_10004668 3300027907 Bacteria 12980
148 Ga0207428_10009427 3300027907 Bacteria 8749
149 Ga0207428_10110244 3300027907 Unclassified 2119
150 Ga0207428_10387816 3300027907 Unclassified 1024
151 Ga0268266_10663136 3300028379 Bacteria 1004
152 Ga0268265_10504636 3300028380 Bacteria 1140
153 Ga0307408_100107800 3300031548 Bacteria 2134
154 Ga0307408_100176705 3300031548 Bacteria 1709
155 Ga0307408_100691410 3300031548 Bacteria 916
156 Ga0307413_10230894 3300031824 Unclassified 1359
157 Ga0307413_10378726 3300031824 Bacteria 1102
158 Ga0307410_10431316 3300031852 Bacteria 1071
159 Ga0307406_10365669 3300031901 Bacteria 1132
160 Ga0307412_10237746 3300031911 Archaea 1407
161 Ga0307409_100542320 3300031995 Bacteria 1140
162 Ga0307409_101318612 3300031995 Bacteria 747
163 Ga0307409_101667340 3300031995 Bacteria 666
164 Ga0307416_100014715 3300032002 Bacteria 5375
165 Ga0307416_100036561 3300032002 Bacteria 3768
166 Ga0307416_100346404 3300032002 Unclassified 1501
167 Ga0307416_102969984 3300032002 Bacteria 567
168 Ga0307414_10260984 3300032004 Bacteria 1446
169 Ga0307414_11260750 3300032004 Bacteria 685
170 Ga0307411_10131118 3300032005 Unclassified 1832
171 Ga0307411_10318894 3300032005 Bacteria 1254
172 Ga0307411_11048329 3300032005 Unclassified 732
173 Ga0436365_0246402 3300039437 Bacteria 5001
174 Ga0436365_0507482 3300039437 Unclassified 4126
175 Ga0451807_0718801 3300041486 Bacteria 1859
176 Ga0451853_3582165 3300041512 Bacteria 1075
177 Ga0439433_0062542 3300041999 Bacteria 889
178 Ga0439445_0094146 3300042004 Bacteria 846
179 Ga0439462_0029986 3300042015 Bacteria 1439
180 Ga0439462_0066503 3300042015 Bacteria 977
181 Ga0450896_001919 3300042133 Bacteria 2637
182 Ga0439446_0073091 3300042156 Unclassified 1052
183 Ga0439464_0070636 3300042439 Unclassified 1033
184 Ga0450918_075641 3300042531 Bacteria 637
185 Ga0501037_0954143 3300049573 Bacteria 560
186 Ga0501040_0780266 3300049576 Bacteria 691
187 Ga0501072_0382468 3300049588 Bacteria 1117
188 Ga0501074_0168023 3300049590 Viruses 1566
189 Ga0501075_0045327 3300049591 Viruses 3301
190 Ga0501076_0065104 3300049592 Bacteria 2906
191 Ga0501077_0137868 3300049593 Bacteria 1547
192 Ga0501077_0659406 3300049593 Unclassified 672
193 Ga0501249_046966 3300049679 Bacteria 987
194 Ga0501258_019487 3300049687 Unclassified 788
195 Ga0501221_094174 3300049704 Unclassified 736
196 Ga0501081_0734334 3300049743 Unclassified 742
197 Ga0501283_003840 3300049779 Bacteria 2006
198 Ga0501045_0852998 3300049824 Unclassified 670
199 nmdc:mga00v17_163361_c1 3300050491 Bacteria 1434
200 nmdc:mga0k408_130928_c1 3300050493 Bacteria 1489
201 nmdc:mga0k408_212713_c1 3300050493 Bacteria 708
202 nmdc:mga0k408_213858_c1 3300050493 Unclassified 1151
203 nmdc:mga0k408_38905_c1 3300050493 Bacteria 2731
204 nmdc:mga0k408_45620_c1 3300050493 Bacteria 2529
205 nmdc:mga06z11_66935_c1 3300050494 Bacteria 1890
206 nmdc:mga04h51_44723_c1 3300050495 Bacteria 1461
207 nmdc:mga07m45_24680_c1 3300050496 Bacteria 1379
208 nmdc:mga05p37_190268_c1 3300050507 Bacteria 2492
209 nmdc:mga05p37_354929_c1 3300050507 Bacteria 1725
210 nmdc:mga05p37_469894_c1 3300050507 Bacteria 1451
211 nmdc:mga05p37_607112_c1 3300050507 Unclassified 1234
212 nmdc:mga05p37_75236_c1 3300050507 Bacteria 4156
213 nmdc:mga05p37_835484_c1 3300050507 Bacteria 1002
214 nmdc:mga05p37_994915_c1 3300050507 Bacteria 892
215 nmdc:mga09592_262414_c1 3300050508 Bacteria 1498
216 nmdc:mga09592_32498_c1 3300050508 Unclassified 4350
217 nmdc:mga09592_434166_c1 3300050508 Bacteria 1134
218 nmdc:mga09592_6264_c1 3300050508 Bacteria 9687
219 nmdc:mga0qj67_133214_c1 3300050509 Bacteria 2013
220 nmdc:mga0qj67_594163_c1 3300050509 Bacteria 886
221 nmdc:mga0qj67_657719_c1 3300050509 Bacteria 836
222 nmdc:mga0qj67_69772_c1 3300050509 Bacteria 2803
223 nmdc:mga0qj67_86780_c1 3300050509 Bacteria 2511
224 nmdc:mga06r32_182619_c1 3300050510 Bacteria 2084
225 nmdc:mga06r32_30593_c1 3300050510 Bacteria 5052
226 nmdc:mga06r32_452739_c1 3300050510 Bacteria 1263
227 nmdc:mga06r32_49849_c1 3300050510 Bacteria 4005
228 nmdc:mga06r32_60161_c1 3300050510 Bacteria 3655
229 nmdc:mga06r32_81424_c1 3300050510 Bacteria 3153
230 nmdc:mga08y16_1332_c1 3300050511 Bacteria 24611
231 nmdc:mga08y16_13811_c1 3300050511 Bacteria 8500
232 nmdc:mga08y16_139448_c1 3300050511 Unclassified 2521
233 nmdc:mga08y16_197451_c1 3300050511 Bacteria 2085
234 nmdc:mga08y16_403770_c1 3300050511 Bacteria 1398
235 nmdc:mga08y16_434_c1 3300050511 Bacteria 38502
236 nmdc:mga08y16_771331_c1 3300050511 Bacteria 956
237 nmdc:mga0n895_141048_c1 3300050512 Bacteria 2438
238 Ga0500555_019306 3300053103 Bacteria 1963
239 Ga0501084_0160760 3300054114 Viruses 1895
240 Ga0501084_0640466 3300054114 Bacteria 897
241 Ga0501082_0236553 3300060353 Unclassified 1590
242 Ga0501082_0751741 3300060353 Bacteria 853
243 Ga0307408_100109288
244 Ga0065707_10251772
245 Ga0070676_10059230
246 Ga0070690_100368562
247 Ga0070670_100035674
248 Ga0070670_100038972
249 Ga0070670_100114349
250 Ga0070670_100739731
251 Ga0070677_10552837
252 Ga0070680_100069364
253 Ga0070680_100108840
254 Ga0070692_10623940
255 Ga0070668_100435234
256 Ga0070668_100612995
257 Ga0070669_100176137
258 Ga0070675_100193560
259 Ga0070671_100002933
260 Ga0070674_100003222
261 Ga0070674_100987845
262 Ga0070674_101132235
263 Ga0070673_100024077
264 Ga0070659_100593746
265 Ga0070667_100121841
266 Ga0070667_100674601
267 Ga0070701_10058904
268 Ga0070700_100013295
269 Ga0070663_100039522
270 Ga0070678_100303258
271 Ga0070678_100437631
272 Ga0070662_100216802
273 Ga0070662_100237564
274 Ga0070662_100582666
275 Ga0070662_100828439
276 Ga0070706_100144882
277 Ga0070706_100197094
278 Ga0070707_100561619
279 Ga0070698_100131378
280 Ga0070684_100353728
281 Ga0070672_100200941
282 Ga0070665_100119755
283 Ga0070665_100653110
284 Ga0070704_100130089
285 Ga0070664_100214944
286 Ga0068857_100407829
287 Ga0068854_100269115
288 Ga0068852_100509626
289 Ga0068859_101141177
290 Ga0068864_100062018
291 Ga0068861_100222820
292 Ga0068861_100280109
293 Ga0068858_100975011
294 Ga0075365_10125114
295 Ga0075364_10044237
296 Ga0075364_10195601
297 Ga0075367_10017136
298 Ga0075367_10239397
299 Ga0075366_10186280
300 Ga0075370_10088163
301 Ga0075428_100007007
302 Ga0075428_100020570
303 Ga0075428_100030929
304 Ga0075428_100036476
305 Ga0075428_100065003
306 Ga0075428_100194763
307 Ga0075428_100372325
308 Ga0075428_100532741
309 Ga0075428_101605359
310 Ga0075430_100033784
311 Ga0075430_100087333
312 Ga0075430_100160484
313 Ga0075430_100570939
314 Ga0075430_100698835
315 Ga0075430_100810076
316 Ga0075431_100003702
317 Ga0075431_100007959
318 Ga0075431_100019853
319 Ga0075431_100030614
320 Ga0075431_100340752
321 Ga0075434_100143628
322 Ga0075434_100657397
323 Ga0075429_100021074
324 Ga0075429_100028156
325 Ga0075429_100440678
326 Ga0075429_100666439
327 Ga0097620_101141207
328 Ga0111539_10002545
329 Ga0111539_10011473
330 Ga0111539_10062243
331 Ga0111539_10158708
332 Ga0111539_10254487
333 Ga0111539_10489524
334 Ga0111539_11949478
335 Ga0114129_10024483
336 Ga0114129_10222781
337 Ga0114129_10439975
338 Ga0114129_10466762
339 Ga0114129_10688332
340 Ga0114129_10998441
341 Ga0105243_10229810
342 Ga0105243_10291297
343 Ga0105248_12159438
344 Ga0105249_10108747
345 Ga0163163_10433768
346 Ga0157380_10008912
347 Ga0157380_10012925
348 Ga0157380_10080996
349 Ga0157380_10159981
350 Ga0157380_10241515
351 Ga0157380_10307334
352 Ga0157380_10913133
353 Ga0157377_10069552
354 Ga0157376_10810282
355 Ga0163161_10051741
356 Ga0213876_10001052
357 Ga0213876_10153913
358 Ga0207656_10243117
359 Ga0207682_10120997
360 Ga0207645_10187700
361 Ga0207643_10425361
362 Ga0207684_10117344
363 Ga0207684_10300303
364 Ga0207660_10134264
365 Ga0207681_10206937
366 Ga0207681_10847247
367 Ga0207694_10290578
368 Ga0207650_10368891
369 Ga0207650_10908033
370 Ga0207659_10026223
371 Ga0207644_10031445
372 Ga0207706_10137610
373 Ga0207669_10049704
374 Ga0207669_10550718
375 Ga0207691_10143841
376 Ga0207668_10238015
377 Ga0207668_10280119
378 Ga0207668_10297465
379 Ga0207678_10060070
380 Ga0207678_10163161
381 Ga0207708_10025021
382 Ga0207708_10164095
383 Ga0207676_10048158
384 Ga0207675_100277520
385 Ga0207675_100945444
386 Ga0207683_10218183
387 Ga0207683_10529982
388 Ga0209813_10052236
389 Ga0207428_10004668
390 Ga0207428_10009427
391 Ga0207428_10110244
392 Ga0207428_10387816
393 Ga0268266_10663136
394 Ga0268265_10504636
395 Ga0307408_100107800
396 Ga0307408_100176705
397 Ga0307408_100691410
398 Ga0307413_10230894
399 Ga0307413_10378726
400 Ga0307410_10431316
401 Ga0307406_10365669
402 Ga0307412_10237746
403 Ga0307409_100542320
404 Ga0307409_101318612
405 Ga0307409_101667340
406 Ga0307416_100014715
407 Ga0307416_100036561
408 Ga0307416_100346404
409 Ga0307416_102969984
410 Ga0307414_10260984
411 Ga0307414_11260750
412 Ga0307411_10131118
413 Ga0307411_10318894
414 Ga0307411_11048329
415 Ga0436365_0246402
416 Ga0436365_0507482
417 Ga0451807_0718801
418 Ga0451853_3582165
419 Ga0439433_0062542
420 Ga0439445_0094146
421 Ga0439462_0029986
422 Ga0439462_0066503
423 Ga0450896_001919
424 Ga0439446_0073091
425 Ga0439464_0070636
426 Ga0450918_075641
427 Ga0501037_0954143
428 Ga0501040_0780266
429 Ga0501072_0382468
430 Ga0501074_0168023
431 Ga0501075_0045327
432 Ga0501076_0065104
433 Ga0501077_0137868
434 Ga0501077_0659406
435 Ga0501249_046966
436 Ga0501258_019487
437 Ga0501221_094174
438 Ga0501081_0734334
439 Ga0501283_003840
440 Ga0501045_0852998
441 nmdc:mga00v17_163361_c1
442 nmdc:mga0k408_130928_c1
443 nmdc:mga0k408_212713_c1
444 nmdc:mga0k408_213858_c1
445 nmdc:mga0k408_38905_c1
446 nmdc:mga0k408_45620_c1
447 nmdc:mga06z11_66935_c1
448 nmdc:mga04h51_44723_c1
449 nmdc:mga07m45_24680_c1
450 nmdc:mga05p37_190268_c1
451 nmdc:mga05p37_354929_c1
452 nmdc:mga05p37_469894_c1
453 nmdc:mga05p37_607112_c1
454 nmdc:mga05p37_75236_c1
455 nmdc:mga05p37_835484_c1
456 nmdc:mga05p37_994915_c1
457 nmdc:mga09592_262414_c1
458 nmdc:mga09592_32498_c1
459 nmdc:mga09592_434166_c1
460 nmdc:mga09592_6264_c1
461 nmdc:mga0qj67_133214_c1
462 nmdc:mga0qj67_594163_c1
463 nmdc:mga0qj67_657719_c1
464 nmdc:mga0qj67_69772_c1
465 nmdc:mga0qj67_86780_c1
466 nmdc:mga06r32_182619_c1
467 nmdc:mga06r32_30593_c1
468 nmdc:mga06r32_452739_c1
469 nmdc:mga06r32_49849_c1
470 nmdc:mga06r32_60161_c1
471 nmdc:mga06r32_81424_c1
472 nmdc:mga08y16_1332_c1
473 nmdc:mga08y16_13811_c1
474 nmdc:mga08y16_139448_c1
475 nmdc:mga08y16_197451_c1
476 nmdc:mga08y16_403770_c1
477 nmdc:mga08y16_434_c1
478 nmdc:mga08y16_771331_c1
479 nmdc:mga0n895_141048_c1
480 Ga0500555_019306
481 Ga0501084_0160760
482 Ga0501084_0640466
483 Ga0501082_0236553
484 Ga0501082_0751741

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5k3i-assembly3.cif.gz_F crystal structure of acyl-coa oxidase-1 in caenorhabditis elegans complexed with fad and atp 0.5342 103 159
5k3i-assembly2.cif.gz_C crystal structure of acyl-coa oxidase-1 in caenorhabditis elegans complexed with fad and atp 0.5339 103 159
5nx9-assembly1.cif.gz_C crystal structure of neanderthal adenylosuccinate lyase (adsl) in complex with its products amp and fumarate 0.46 60 157
4nb5-assembly1.cif.gz_C crystal structure of a transcriptional regulator 0.4598 76 152
2j91-assembly1.cif.gz_C crystal structure of human adenylosuccinate lyase in complex with amp 0.4573 60 157
ID Description Score Start End Superfamily
af_Q2FYT5_1_136_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5478 11 163 1.20.1250.20
af_Q2FYT5_1_136_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5301 11 163 1.20.1250.20
af_Q400M3_12_327_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4982 96 169 1.20.1070.10
af_Q2PRA1_18_312_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4771 102 172 1.20.1070.10
af_Q2PRF3_21_313_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4693 102 171 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A1J1ENH2-F1-model_v4 deleted 0.9315 2 173
AF-A0A4Q3A8S8-F1-model_v4 deleted 0.9137 2 167
AF-A0A1C3NLU0-F1-model_v4 DUF1453 domain-containing protein 0.9104 5 168 GO:0016020
AF-A0A8B5Z2S1-F1-model_v4 DUF1453 domain-containing protein 0.9078 5 168 GO:0016020
AF-A0A1J1ENH2-F1-model_v4 deleted 0.9059 2 173

Map