F354395

General Info

Members Datasets Scaffolds Average Seq Length
242 150 484 780

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100011240|Ga0070674_1000112403
Length 832
Sequence MLKFFAAATFAGALVLTPAAGIPSLAQAVDGGRGAVSQSPPLESPAESGTATRARAAXXGDDQAAAIDQHKLDAIEPLVQEAIADKKLPGAVVLVGRGDRLLYQKAIGHRALVPSTEQMTLDTMFDLASLTKVVATTTSVMMLVERGKLRLSDRVATFVPGFERYGKADITIRHLLTHTSGLRPDLDLAEAWTGSDTAIALAIEEVPTTPPGQRFVYSDINFFLLGDVVRRVSGLTLDKFAKQEIFDPLGMKDTSFLPAESLRPRIAPTEACLPFSWPCEGGERQMLRGVVHDPTARRMGGVAGHAGLFSTAADMAIFCRMLLGGGAYHGTRVLSPLTVEKMTSPVPGADPNVRGLGWDIDSSYSSNRGELLPIGSFGHTGFTGTSLWIDPATGMFVVFLSNRVHPDGKGDVTPLRARVATIAASAMLTDPPAGANRAWTGRDFGPSGTVPPPAPREPVMTGLDVLRSQGFALLQGKRVGLITNHTGRARDGAAAIDLLHDAKNVKLVALFGPEHGIRGVLDANVPAETDARTGLPIHSLYGDTRRPTAAMLEGIDTLVIDLQDIGVRFYTYMTTMAFAMEEAAKRKVPVVVLDRPNPVNGYQVEGPLLDKTELSFIGYFPMPIRHGMTIGELARLFNGENKIGAELTVVPLKNWRRDDWYDDTGLPWINPSPNMRNLNQATLYPGIGAIEYSNISVGRGTDTPFEQVGAPWIDGVRLAELLNARKVPGIRFYPVRFTPAASKFSGEECQGVFMVVTDRAALRPVRVGLEIAGALQKLYGSQFDLEASYRLLGSKESIARIRSGDDPAAVAASWAAAESRWRLMRSQYLLYR

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
127 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
135 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
136 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
137 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
140 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
145 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
146 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
147 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
148 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
149 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.2
Nodule 0
Rhizoplane 3.72
Rhizosphere 88.43
Stem 0
Stem Tuber 0
Unclassified 4.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_100011240 3300005356 Bacteria 5443
2 Ga0065712_10069525 3300005290 Bacteria 7120
3 Ga0065707_10003931 3300005295 Bacteria 5677
4 Ga0070676_10011244 3300005328 Bacteria 4867
5 Ga0070683_100000010 3300005329 Bacteria 287444
6 Ga0070670_100000063 3300005331 Bacteria 110425
7 Ga0070670_100001936 3300005331 Bacteria 16947
8 Ga0070670_100073639 3300005331 Bacteria 2933
9 Ga0068868_100000823 3300005338 Bacteria 21052
10 Ga0068868_100023914 3300005338 Unclassified 4630
11 Ga0070691_10002038 3300005341 Bacteria 8921
12 Ga0070668_100062437 3300005347 Bacteria 2886
13 Ga0070669_100001000 3300005353 Bacteria 20586
14 Ga0070675_100015400 3300005354 Bacteria 6044
15 Ga0070671_100059648 3300005355 Bacteria 3175
16 Ga0070674_100005391 3300005356 Bacteria 7381
17 Ga0070714_100010564 3300005435 Bacteria 7303
18 Ga0070713_100002198 3300005436 Bacteria 12635
19 Ga0070713_100033353 3300005436 Unclassified 4123
20 Ga0070701_10018090 3300005438 Bacteria 3307
21 Ga0070708_100025490 3300005445 Bacteria 5055
22 Ga0070681_10000547 3300005458 Bacteria 31011
23 Ga0070681_10043589 3300005458 Bacteria 4493
24 Ga0070681_10068171 3300005458 Unclassified 3525
25 Ga0068867_100010618 3300005459 Bacteria 6497
26 Ga0070707_100004448 3300005468 Bacteria 13129
27 Ga0070698_100006665 3300005471 Bacteria 12523
28 Ga0070699_100001623 3300005518 Bacteria 20510
29 Ga0070699_100038452 3300005518 Bacteria 4143
30 Ga0070679_100034971 3300005530 Unclassified 4983
31 Ga0070684_100000068 3300005535 Bacteria 65538
32 Ga0070684_100000259 3300005535 Bacteria 36750
33 Ga0070684_100006305 3300005535 Bacteria 9165
34 Ga0070684_100014171 3300005535 Bacteria 6449
35 Ga0068853_100044915 3300005539 Bacteria 3783
36 Ga0070672_100015190 3300005543 Bacteria 5475
37 Ga0070696_100065145 3300005546 Bacteria 2554
38 Ga0070693_100009904 3300005547 Bacteria 4757
39 Ga0070665_100004997 3300005548 Bacteria 13753
40 Ga0070665_100008928 3300005548 Bacteria 10155
41 Ga0070704_100044341 3300005549 Bacteria 3090
42 Ga0068855_100000212 3300005563 Bacteria 73927
43 Ga0068855_100012756 3300005563 Bacteria 10134
44 Ga0070664_100000408 3300005564 Bacteria 32016
45 Ga0070664_100001596 3300005564 Bacteria 18130
46 Ga0068857_100000487 3300005577 Bacteria 28376
47 Ga0068857_100008874 3300005577 Bacteria 8708
48 Ga0068854_100004009 3300005578 Bacteria 9243
49 Ga0068854_100049111 3300005578 Unclassified 3013
50 Ga0068856_100001039 3300005614 Bacteria 29492
51 Ga0068856_100003760 3300005614 Bacteria 15219
52 Ga0070702_100016074 3300005615 Bacteria 3833
53 Ga0068859_100000212 3300005617 Bacteria 58021
54 Ga0068864_100001262 3300005618 Bacteria 21046
55 Ga0068864_100005355 3300005618 Bacteria 10514
56 Ga0068861_100008536 3300005719 Bacteria 7052
57 Ga0068870_10013251 3300005840 Bacteria 3872
58 Ga0068858_100001341 3300005842 Bacteria 25378
59 Ga0068858_100006021 3300005842 Bacteria 11828
60 Ga0068858_100041319 3300005842 Unclassified 4276
61 Ga0068862_100025947 3300005844 Bacteria 4923
62 Ga0070717_10000107 3300006028 Bacteria 65970
63 Ga0070717_10008835 3300006028 Bacteria 7546
64 Ga0070717_10052194 3300006028 Bacteria 3367
65 Ga0070712_100001992 3300006175 Bacteria 12506
66 Ga0075362_10001039 3300006177 Bacteria 8553
67 Ga0075367_10008754 3300006178 Bacteria 5258
68 Ga0075366_10015287 3300006195 Bacteria 4396
69 Ga0075366_10017663 3300006195 Bacteria 4109
70 Ga0097621_100001330 3300006237 Bacteria 17006
71 Ga0068871_100000213 3300006358 Bacteria 40516
72 Ga0068871_100014030 3300006358 Bacteria 5960
73 Ga0075428_100011577 3300006844 Bacteria 9814
74 Ga0075428_100031142 3300006844 Bacteria 5899
75 Ga0075428_100031346 3300006844 Bacteria 5878
76 Ga0075428_100057992 3300006844 Bacteria 4239
77 Ga0075430_100011181 3300006846 Bacteria 7609
78 Ga0068865_100039617 3300006881 Unclassified 3197
79 Ga0097620_100000212 3300006931 Bacteria 58021
80 Ga0105240_10066788 3300009093 Bacteria 4460
81 Ga0105240_10115820 3300009093 Bacteria 3235
82 Ga0111539_10007871 3300009094 Bacteria 13603
83 Ga0111539_10007904 3300009094 Bacteria 13569
84 Ga0111539_10085830 3300009094 Bacteria 3699
85 Ga0105245_10000066 3300009098 Bacteria 109321
86 Ga0105245_10031738 3300009098 Bacteria 4676
87 Ga0105245_10095760 3300009098 Bacteria 2739
88 Ga0114129_10002915 3300009147 Bacteria 23932
89 Ga0114129_10003301 3300009147 Bacteria 22655
90 Ga0114129_10005237 3300009147 Bacteria 18273
91 Ga0114129_10006858 3300009147 Bacteria 16189
92 Ga0114129_10017517 3300009147 Bacteria 10198
93 Ga0114129_10037854 3300009147 Bacteria 6808
94 Ga0114129_10063904 3300009147 Bacteria 5136
95 Ga0105248_10005550 3300009177 Bacteria 13860
96 Ga0105248_10005658 3300009177 Bacteria 13729
97 Ga0105248_10176192 3300009177 Bacteria 2410
98 Ga0105238_10000001 3300009551 Bacteria 2036163
99 Ga0105238_10000064 3300009551 Bacteria 122380
100 Ga0105238_10019565 3300009551 Bacteria 6894
101 Ga0105249_10002529 3300009553 Bacteria 15827
102 Ga0105239_10056367 3300010375 Bacteria 4310
103 Ga0105239_10061882 3300010375 Bacteria 4109
104 Ga0157370_10023273 3300013104 Bacteria 6152
105 Ga0157369_10000483 3300013105 Bacteria 52815
106 Ga0157369_10000506 3300013105 Bacteria 51297
107 Ga0157369_10053184 3300013105 Unclassified 4378
108 Ga0157374_10000010 3300013296 Bacteria 505635
109 Ga0157374_10000140 3300013296 Bacteria 65420
110 Ga0157374_10000142 3300013296 Bacteria 64898
111 Ga0157374_10003656 3300013296 Bacteria 12937
112 Ga0157374_10007674 3300013296 Bacteria 9212
113 Ga0157378_10000021 3300013297 Bacteria 130704
114 Ga0157378_10000135 3300013297 Bacteria 69913
115 Ga0157378_10000239 3300013297 Bacteria 53624
116 Ga0157378_10000284 3300013297 Bacteria 49359
117 Ga0157378_10019638 3300013297 Bacteria 5940
118 Ga0157372_10000378 3300013307 Bacteria 49389
119 Ga0157372_10000450 3300013307 Bacteria 45152
120 Ga0157372_10001046 3300013307 Bacteria 30268
121 Ga0157372_10041220 3300013307 Bacteria 5104
122 Ga0157375_10000020 3300013308 Bacteria 251840
123 Ga0157375_10034435 3300013308 Bacteria 4825
124 Ga0163163_10004382 3300014325 Bacteria 12029
125 Ga0157380_10024568 3300014326 Bacteria 4562
126 Ga0157380_10039999 3300014326 Bacteria 3649
127 Ga0157377_10000019 3300014745 Bacteria 171658
128 Ga0157379_10008982 3300014968 Bacteria 8712
129 Ga0157376_10000020 3300014969 Bacteria 246318
130 Ga0213876_10000012 3300021384 Bacteria 396530
131 Ga0207697_10000030 3300025315 Bacteria 51253
132 Ga0207682_10008659 3300025893 Bacteria 4022
133 Ga0207688_10000192 3300025901 Bacteria 27058
134 Ga0207688_10019554 3300025901 Bacteria 3692
135 Ga0207645_10003284 3300025907 Bacteria 12333
136 Ga0207645_10027363 3300025907 Bacteria 3683
137 Ga0207707_10000842 3300025912 Bacteria 30128
138 Ga0207707_10014495 3300025912 Bacteria 6863
139 Ga0207693_10003144 3300025915 Bacteria 14192
140 Ga0207662_10005439 3300025918 Bacteria 6793
141 Ga0207649_10006750 3300025920 Bacteria 6235
142 Ga0207652_10005463 3300025921 Bacteria 10315
143 Ga0207652_10077111 3300025921 Bacteria 2908
144 Ga0207646_10020555 3300025922 Bacteria 6115
145 Ga0207694_10000001 3300025924 Bacteria 4078485
146 Ga0207694_10001302 3300025924 Bacteria 21509
147 Ga0207650_10000270 3300025925 Bacteria 54684
148 Ga0207650_10016776 3300025925 Bacteria 5121
149 Ga0207650_10053962 3300025925 Bacteria 2980
150 Ga0207687_10000003 3300025927 Bacteria 875159
151 Ga0207700_10009771 3300025928 Bacteria 6015
152 Ga0207706_10115613 3300025933 Bacteria 2359
153 Ga0207669_10011220 3300025937 Bacteria 4352
154 Ga0207665_10000679 3300025939 Bacteria 22942
155 Ga0207691_10026879 3300025940 Bacteria 5399
156 Ga0207691_10051220 3300025940 Bacteria 3776
157 Ga0207711_10011897 3300025941 Bacteria 7232
158 Ga0207711_10013570 3300025941 Bacteria 6766
159 Ga0207661_10000001 3300025944 Bacteria 937688
160 Ga0207661_10023907 3300025944 Bacteria 4623
161 Ga0207679_10011731 3300025945 Bacteria 5690
162 Ga0207667_10005383 3300025949 Bacteria 15604
163 Ga0207667_10016112 3300025949 Bacteria 8455
164 Ga0207667_10023208 3300025949 Bacteria 6833
165 Ga0207703_10044999 3300026035 Bacteria 3549
166 Ga0207703_10053680 3300026035 Unclassified 3276
167 Ga0207678_10021267 3300026067 Bacteria 5688
168 Ga0207708_10012968 3300026075 Bacteria 6215
169 Ga0207702_10000219 3300026078 Bacteria 66719
170 Ga0207702_10002340 3300026078 Bacteria 18096
171 Ga0207702_10008924 3300026078 Bacteria 8453
172 Ga0207702_10055244 3300026078 Bacteria 3367
173 Ga0207648_10023540 3300026089 Bacteria 5515
174 Ga0207676_10003918 3300026095 Bacteria 10507
175 Ga0207676_10012365 3300026095 Bacteria 6114
176 Ga0207676_10014816 3300026095 Bacteria 5617
177 Ga0207674_10000190 3300026116 Bacteria 75394
178 Ga0207674_10014473 3300026116 Bacteria 8710
179 Ga0207675_100009675 3300026118 Bacteria 9021
180 Ga0207675_100045935 3300026118 Bacteria 4080
181 Ga0207683_10015499 3300026121 Bacteria 6489
182 Ga0207683_10042096 3300026121 Bacteria 3989
183 Ga0207683_10048585 3300026121 Bacteria 3715
184 Ga0268266_10004231 3300028379 Bacteria 13821
185 Ga0268265_10010746 3300028380 Bacteria 6181
186 Ga0307511_10016847 3300030521 Bacteria 7032
187 Ga0307408_100033127 3300031548 Bacteria 3607
188 Ga0307413_10029778 3300031824 Bacteria 3059
189 Ga0307406_10032769 3300031901 Bacteria 3174
190 Ga0307409_100055328 3300031995 Bacteria 3062
191 Ga0307414_10009013 3300032004 Bacteria 5705
192 Ga0373937_0000331 3300036401 Bacteria 44847
193 Ga0436365_1563063 3300039437 Bacteria 118713
194 Ga0436363_0851978 3300039450 Bacteria 4630
195 Ga0436362_0335568 3300039453 Bacteria 3646
196 Ga0451577_0001677 3300042876 Bacteria 28601
197 Ga0451576_0081340 3300045051 Bacteria 3369
198 Ga0495580_0025565 3300046472 Unclassified 4315
199 Ga0495582_0001167 3300046473 Bacteria 14787
200 Ga0495658_0013263 3300046683 Bacteria 4194
201 Ga0496102_0014836 3300048905 Bacteria 6778
202 Ga0496103_0050000 3300048906 Bacteria 2586
203 Ga0496104_0009851 3300048907 Bacteria 8527
204 Ga0496104_0104199 3300048907 Unclassified 2718
205 Ga0496110_0007881 3300048913 Bacteria 8530
206 Ga0496110_0016526 3300048913 Bacteria 6162
207 Ga0496112_0002640 3300048915 Bacteria 14486
208 Ga0496112_0037994 3300048915 Bacteria 4700
209 Ga0496113_0020443 3300048916 Bacteria 4654
210 Ga0501072_0041912 3300049588 Bacteria 3596
211 Ga0501072_0052081 3300049588 Bacteria 3223
212 Ga0501075_0009471 3300049591 Bacteria 6816
213 Ga0501075_0066540 3300049591 Bacteria 2719
214 Ga0501076_0020466 3300049592 Bacteria 5066
215 Ga0501079_0031775 3300049741 Bacteria 4057
216 Ga0501045_0019223 3300049824 Bacteria 4867
217 nmdc:mga03683_1028_c1 3300050489 Bacteria 8131
218 nmdc:mga00v17_3646_c1 3300050491 Bacteria 7957
219 nmdc:mga00v17_3975_c1 3300050491 Bacteria 7629
220 nmdc:mga0yw44_25108_c1 3300050492 Bacteria 3383
221 nmdc:mga0k408_38106_c1 3300050493 Bacteria 2760
222 nmdc:mga06z11_30759_c1 3300050494 Bacteria 2601
223 nmdc:mga07m45_1867_c1 3300050496 Bacteria 9733
224 nmdc:mga07m45_5121_c1 3300050496 Bacteria 6493
225 nmdc:mga05p37_130434_c1 3300050507 Bacteria 3084
226 nmdc:mga05p37_16297_c1 3300050507 Bacteria 8945
227 nmdc:mga05p37_26054_c1 3300050507 Bacteria 7110
228 nmdc:mga05p37_3120_c1 3300050507 Bacteria 19261
229 nmdc:mga05p37_3447_c1 3300050507 Bacteria 18462
230 nmdc:mga05p37_5421_c1 3300050507 Bacteria 14991
231 nmdc:mga09592_76989_c1 3300050508 Unclassified 2837
232 nmdc:mga0qj67_37132_c1 3300050509 Bacteria 3815
233 nmdc:mga06r32_55859_c1 3300050510 Bacteria 3788
234 nmdc:mga08y16_3282_c1 3300050511 Bacteria 16767
235 nmdc:mga0n895_163704_c1 3300050512 Bacteria 2256
236 nmdc:mga08x19_3704_c1 3300050514 Bacteria 9101
237 nmdc:mga0a205_31598_c1 3300050515 Bacteria 2720
238 Ga0495655_0000167 3300053083 Bacteria 12388
239 Ga0500555_000418 3300053103 Bacteria 17735
240 Ga0500616_0001685 3300053153 Bacteria 20354
241 Ga0500645_000251 3300053730 Bacteria 39552
242 Ga0501084_0018709 3300054114 Bacteria 5768
243 Ga0070674_100011240
244 Ga0065712_10069525
245 Ga0065707_10003931
246 Ga0070676_10011244
247 Ga0070683_100000010
248 Ga0070670_100000063
249 Ga0070670_100001936
250 Ga0070670_100073639
251 Ga0068868_100000823
252 Ga0068868_100023914
253 Ga0070691_10002038
254 Ga0070668_100062437
255 Ga0070669_100001000
256 Ga0070675_100015400
257 Ga0070671_100059648
258 Ga0070674_100005391
259 Ga0070714_100010564
260 Ga0070713_100002198
261 Ga0070713_100033353
262 Ga0070701_10018090
263 Ga0070708_100025490
264 Ga0070681_10000547
265 Ga0070681_10043589
266 Ga0070681_10068171
267 Ga0068867_100010618
268 Ga0070707_100004448
269 Ga0070698_100006665
270 Ga0070699_100001623
271 Ga0070699_100038452
272 Ga0070679_100034971
273 Ga0070684_100000068
274 Ga0070684_100000259
275 Ga0070684_100006305
276 Ga0070684_100014171
277 Ga0068853_100044915
278 Ga0070672_100015190
279 Ga0070696_100065145
280 Ga0070693_100009904
281 Ga0070665_100004997
282 Ga0070665_100008928
283 Ga0070704_100044341
284 Ga0068855_100000212
285 Ga0068855_100012756
286 Ga0070664_100000408
287 Ga0070664_100001596
288 Ga0068857_100000487
289 Ga0068857_100008874
290 Ga0068854_100004009
291 Ga0068854_100049111
292 Ga0068856_100001039
293 Ga0068856_100003760
294 Ga0070702_100016074
295 Ga0068859_100000212
296 Ga0068864_100001262
297 Ga0068864_100005355
298 Ga0068861_100008536
299 Ga0068870_10013251
300 Ga0068858_100001341
301 Ga0068858_100006021
302 Ga0068858_100041319
303 Ga0068862_100025947
304 Ga0070717_10000107
305 Ga0070717_10008835
306 Ga0070717_10052194
307 Ga0070712_100001992
308 Ga0075362_10001039
309 Ga0075367_10008754
310 Ga0075366_10015287
311 Ga0075366_10017663
312 Ga0097621_100001330
313 Ga0068871_100000213
314 Ga0068871_100014030
315 Ga0075428_100011577
316 Ga0075428_100031142
317 Ga0075428_100031346
318 Ga0075428_100057992
319 Ga0075430_100011181
320 Ga0068865_100039617
321 Ga0097620_100000212
322 Ga0105240_10066788
323 Ga0105240_10115820
324 Ga0111539_10007871
325 Ga0111539_10007904
326 Ga0111539_10085830
327 Ga0105245_10000066
328 Ga0105245_10031738
329 Ga0105245_10095760
330 Ga0114129_10002915
331 Ga0114129_10003301
332 Ga0114129_10005237
333 Ga0114129_10006858
334 Ga0114129_10017517
335 Ga0114129_10037854
336 Ga0114129_10063904
337 Ga0105248_10005550
338 Ga0105248_10005658
339 Ga0105248_10176192
340 Ga0105238_10000001
341 Ga0105238_10000064
342 Ga0105238_10019565
343 Ga0105249_10002529
344 Ga0105239_10056367
345 Ga0105239_10061882
346 Ga0157370_10023273
347 Ga0157369_10000483
348 Ga0157369_10000506
349 Ga0157369_10053184
350 Ga0157374_10000010
351 Ga0157374_10000140
352 Ga0157374_10000142
353 Ga0157374_10003656
354 Ga0157374_10007674
355 Ga0157378_10000021
356 Ga0157378_10000135
357 Ga0157378_10000239
358 Ga0157378_10000284
359 Ga0157378_10019638
360 Ga0157372_10000378
361 Ga0157372_10000450
362 Ga0157372_10001046
363 Ga0157372_10041220
364 Ga0157375_10000020
365 Ga0157375_10034435
366 Ga0163163_10004382
367 Ga0157380_10024568
368 Ga0157380_10039999
369 Ga0157377_10000019
370 Ga0157379_10008982
371 Ga0157376_10000020
372 Ga0213876_10000012
373 Ga0207697_10000030
374 Ga0207682_10008659
375 Ga0207688_10000192
376 Ga0207688_10019554
377 Ga0207645_10003284
378 Ga0207645_10027363
379 Ga0207707_10000842
380 Ga0207707_10014495
381 Ga0207693_10003144
382 Ga0207662_10005439
383 Ga0207649_10006750
384 Ga0207652_10005463
385 Ga0207652_10077111
386 Ga0207646_10020555
387 Ga0207694_10000001
388 Ga0207694_10001302
389 Ga0207650_10000270
390 Ga0207650_10016776
391 Ga0207650_10053962
392 Ga0207687_10000003
393 Ga0207700_10009771
394 Ga0207706_10115613
395 Ga0207669_10011220
396 Ga0207665_10000679
397 Ga0207691_10026879
398 Ga0207691_10051220
399 Ga0207711_10011897
400 Ga0207711_10013570
401 Ga0207661_10000001
402 Ga0207661_10023907
403 Ga0207679_10011731
404 Ga0207667_10005383
405 Ga0207667_10016112
406 Ga0207667_10023208
407 Ga0207703_10044999
408 Ga0207703_10053680
409 Ga0207678_10021267
410 Ga0207708_10012968
411 Ga0207702_10000219
412 Ga0207702_10002340
413 Ga0207702_10008924
414 Ga0207702_10055244
415 Ga0207648_10023540
416 Ga0207676_10003918
417 Ga0207676_10012365
418 Ga0207676_10014816
419 Ga0207674_10000190
420 Ga0207674_10014473
421 Ga0207675_100009675
422 Ga0207675_100045935
423 Ga0207683_10015499
424 Ga0207683_10042096
425 Ga0207683_10048585
426 Ga0268266_10004231
427 Ga0268265_10010746
428 Ga0307511_10016847
429 Ga0307408_100033127
430 Ga0307413_10029778
431 Ga0307406_10032769
432 Ga0307409_100055328
433 Ga0307414_10009013
434 Ga0373937_0000331
435 Ga0436365_1563063
436 Ga0436363_0851978
437 Ga0436362_0335568
438 Ga0451577_0001677
439 Ga0451576_0081340
440 Ga0495580_0025565
441 Ga0495582_0001167
442 Ga0495658_0013263
443 Ga0496102_0014836
444 Ga0496103_0050000
445 Ga0496104_0009851
446 Ga0496104_0104199
447 Ga0496110_0007881
448 Ga0496110_0016526
449 Ga0496112_0002640
450 Ga0496112_0037994
451 Ga0496113_0020443
452 Ga0501072_0041912
453 Ga0501072_0052081
454 Ga0501075_0009471
455 Ga0501075_0066540
456 Ga0501076_0020466
457 Ga0501079_0031775
458 Ga0501045_0019223
459 nmdc:mga03683_1028_c1
460 nmdc:mga00v17_3646_c1
461 nmdc:mga00v17_3975_c1
462 nmdc:mga0yw44_25108_c1
463 nmdc:mga0k408_38106_c1
464 nmdc:mga06z11_30759_c1
465 nmdc:mga07m45_1867_c1
466 nmdc:mga07m45_5121_c1
467 nmdc:mga05p37_130434_c1
468 nmdc:mga05p37_16297_c1
469 nmdc:mga05p37_26054_c1
470 nmdc:mga05p37_3120_c1
471 nmdc:mga05p37_3447_c1
472 nmdc:mga05p37_5421_c1
473 nmdc:mga09592_76989_c1
474 nmdc:mga0qj67_37132_c1
475 nmdc:mga06r32_55859_c1
476 nmdc:mga08y16_3282_c1
477 nmdc:mga0n895_163704_c1
478 nmdc:mga08x19_3704_c1
479 nmdc:mga0a205_31598_c1
480 Ga0495655_0000167
481 Ga0500555_000418
482 Ga0500616_0001685
483 Ga0500645_000251
484 Ga0501084_0018709

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07075

NamZ_N

Exo-beta-N-acetylmuramidase NamZ, N-terminal

479

679

0.99

PF20732

NamZ_C

Exo-beta-N-acetylmuramidase NamZ, C-terminal

682

831

0.98

PF00144

Beta-lactamase

Beta-lactamase

75

421

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4k05-assembly1.cif.gz_A crystal structure of a duf1343 family protein (bf0371) from bacteroides fragilis nctc 9343 at 1.65 a resolution 0.9019 444 801
4jja-assembly1.cif.gz_A crystal structure of a duf1343 family protein (bf0379) from bacteroides fragilis nctc 9343 at 1.30 a resolution 0.8768 443 805
4k05-assembly1.cif.gz_A crystal structure of a duf1343 family protein (bf0371) from bacteroides fragilis nctc 9343 at 1.65 a resolution 0.841 444 801
4jja-assembly1.cif.gz_A crystal structure of a duf1343 family protein (bf0379) from bacteroides fragilis nctc 9343 at 1.30 a resolution 0.8365 443 805
8dc1-assembly1.cif.gz_A structural and biochemical characterization of l. interrogans lsa45 reveals a penicillin-binding protein with esterase activity 0.8215 53 416
ID Description Score Start End Superfamily
4k05B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Uncharacterised protein PF07075, DUF1343 0.942 444 658 3.40.50.12170
4k05B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Uncharacterised protein PF07075, DUF1343 0.8601 444 658 3.40.50.12170
af_Q8T2U3_27_449_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8601 56 413 3.40.710.10
af_P77619_23_410_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8479 36 393 3.40.710.10
af_P72041_31_410_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.7901 57 414 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A2V9BHW5-F1-model_v4 DUF1343 domain-containing protein 0.9937 563 805 GO:0033922
AF-A0A7V8SXS8-F1-model_v4 DUF1343 domain-containing protein 0.9887 446 805 GO:0033922
AF-A0A2V8SUR8-F1-model_v4 DUF1343 domain-containing protein 0.9876 524 803 GO:0033922
AF-A0A7W1FDD2-F1-model_v4 DUF1343 domain-containing protein 0.9862 541 805 GO:0033922
AF-A0A2V9P357-F1-model_v4 DUF1343 domain-containing protein 0.9853 444 803 GO:0033922

Map