F354337

General Info

Members Datasets Scaffolds Average Seq Length
242 126 242 364

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100028277|Ga0070683_1000282774
Length 405
Sequence MQNFDMRKGTLILPNVRIVNVPLGTRSYEIKIGPGLLRDLGRHCAALKLGNRCAVISDRNVAPRYAKVVQASLKKAGLQSVLITVPAGETAKSVKVVEQCYDALAKHRLERKSFIVALGGGVVGDLAGFVAATYLRGIAFVQVPTTLLAQVDSSVGGKVGVNLKAGKNLVGAFHQPRLVLCDIDTLRTLPIREFRAGLAEVIKYGIIYDAALFERLEHELPKLLKREPKTLTEVIARCCEIKADVVSQDETESGLRAILNFGHTIGHAIENISGYGKYLHGEAISIGQVAAAMLSAVMLRLNKDEANRISLIFGRAGLPTTIPLNASQCKKLLAAMRLDKKVSGGEVKFVLADKIGKVVWGQSVPDWMIQLAFDFVSQKPKAGTLTVPTIAEISTIMPDGTFAPR

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
51 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
52 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
53 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
54 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
55 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
56 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
59 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
60 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
61 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
62 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
63 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
64 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
65 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
66 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
67 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
68 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
73 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
74 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
75 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
76 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
77 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
78 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
79 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
80 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
81 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
89 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
93 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
94 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
95 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
96 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
97 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
98 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
102 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
103 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
104 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
105 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
106 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
107 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
111 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
112 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
113 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
116 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.83
Rhizosphere 96.69
Stem 0
Stem Tuber 0
Unclassified 2.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10138414 3300003320 Bacteria 2273
2 rootL2_10049362 3300003322 Bacteria 4722
3 rootH1_10073407 3300003323 Unclassified 4663
4 rootH1_10130291 3300003323 Bacteria 4332
5 rootH1_10218559 3300003323 Bacteria 2410
6 Ga0070683_100028277 3300005329 Bacteria 5066
7 Ga0070690_100026314 3300005330 Bacteria 3588
8 Ga0068868_100302335 3300005338 Bacteria 1359
9 Ga0070660_100142424 3300005339 Bacteria 1924
10 Ga0070688_100011545 3300005365 Bacteria 4911
11 Ga0070714_100009977 3300005435 Bacteria 7490
12 Ga0070713_100354654 3300005436 Bacteria 1361
13 Ga0070711_100031290 3300005439 Bacteria 3532
14 Ga0070681_10261795 3300005458 Bacteria 1641
15 Ga0068867_100275189 3300005459 Bacteria 1378
16 Ga0070685_10009665 3300005466 Bacteria 4993
17 Ga0070672_100337343 3300005543 Bacteria 1283
18 Ga0068855_100048356 3300005563 Bacteria 5020
19 Ga0068855_100051888 3300005563 Bacteria 4831
20 Ga0068855_100156483 3300005563 Bacteria 2589
21 Ga0068857_100002196 3300005577 Bacteria 15888
22 Ga0068856_100000264 3300005614 Bacteria 57155
23 Ga0068856_100016909 3300005614 Bacteria 7069
24 Ga0068859_100024591 3300005617 Bacteria 6043
25 Ga0068859_100113995 3300005617 Bacteria 2767
26 Ga0068859_100144618 3300005617 Bacteria 2452
27 Ga0068859_100467069 3300005617 Bacteria 1358
28 Ga0068864_100274185 3300005618 Bacteria 1573
29 Ga0068863_100021811 3300005841 Bacteria 6112
30 Ga0068863_100124656 3300005841 Bacteria 2457
31 Ga0097621_100080070 3300006237 Bacteria 2716
32 Ga0068871_100031056 3300006358 Bacteria 4210
33 Ga0068871_100401391 3300006358 Bacteria 1221
34 Ga0075428_100001486 3300006844 Bacteria 25071
35 Ga0075430_100065766 3300006846 Bacteria 3045
36 Ga0075431_100043646 3300006847 Bacteria 4624
37 Ga0097620_100024591 3300006931 Bacteria 6043
38 Ga0097620_100113997 3300006931 Bacteria 2767
39 Ga0097620_100144607 3300006931 Bacteria 2452
40 Ga0097620_100467083 3300006931 Bacteria 1358
41 Ga0105240_10022584 3300009093 Bacteria 8337
42 Ga0105240_10125786 3300009093 Bacteria 3081
43 Ga0105240_10266113 3300009093 Bacteria 1976
44 Ga0111539_10008568 3300009094 Bacteria 12983
45 Ga0111539_10171963 3300009094 Bacteria 2531
46 Ga0111539_10333078 3300009094 Bacteria 1767
47 Ga0105238_10007302 3300009551 Bacteria 11063
48 Ga0105238_10008944 3300009551 Bacteria 10022
49 Ga0157370_10077126 3300013104 Bacteria 3140
50 Ga0157374_10172644 3300013296 Bacteria 2109
51 Ga0157378_10466463 3300013297 Bacteria 1256
52 Ga0157372_10094143 3300013307 Bacteria 3410
53 Ga0157375_10000038 3300013308 Bacteria 171905
54 Ga0163163_10000064 3300014325 Bacteria 117551
55 Ga0163163_10153506 3300014325 Bacteria 2346
56 Ga0207707_10077135 3300025912 Bacteria 2908
57 Ga0207695_10088298 3300025913 Bacteria 3121
58 Ga0207695_10104436 3300025913 Bacteria 2822
59 Ga0207663_10023397 3300025916 Bacteria 3545
60 Ga0207652_10334670 3300025921 Unclassified 1367
61 Ga0207694_10004798 3300025924 Bacteria 10494
62 Ga0207694_10007749 3300025924 Bacteria 8130
63 Ga0207700_10311995 3300025928 Bacteria 1361
64 Ga0207670_10043484 3300025936 Bacteria 2967
65 Ga0207661_10157609 3300025944 Bacteria 1968
66 Ga0207667_10065126 3300025949 Bacteria 3802
67 Ga0207702_10004146 3300026078 Bacteria 12989
68 Ga0207702_10087304 3300026078 Bacteria 2723
69 Ga0207641_10072125 3300026088 Bacteria 2973
70 Ga0207674_10016144 3300026116 Bacteria 8182
71 Ga0207675_100281850 3300026118 Bacteria 1615
72 Ga0265337_1001107 3300028556 Bacteria 13831
73 Ga0265337_1006500 3300028556 Bacteria 4499
74 Ga0265319_1000179 3300028563 Bacteria 48318
75 Ga0265319_1020745 3300028563 Bacteria 2427
76 Ga0265319_1023668 3300028563 Bacteria 2223
77 Ga0265319_1038386 3300028563 Bacteria 1628
78 Ga0265319_1047911 3300028563 Bacteria 1420
79 Ga0265334_10003988 3300028573 Bacteria 6629
80 Ga0265334_10015185 3300028573 Bacteria 3203
81 Ga0265318_10046318 3300028577 Bacteria 1642
82 Ga0265323_10000005 3300028653 Bacteria 196003
83 Ga0265323_10000055 3300028653 Bacteria 61774
84 Ga0265323_10001806 3300028653 Bacteria 10164
85 Ga0265322_10000526 3300028654 Bacteria 14761
86 Ga0265322_10000994 3300028654 Bacteria 9833
87 Ga0265336_10011908 3300028666 Bacteria 2942
88 Ga0265336_10019392 3300028666 Bacteria 2194
89 Ga0265336_10033555 3300028666 Bacteria 1589
90 Ga0265338_10000009 3300028800 Bacteria 448611
91 Ga0265338_10000312 3300028800 Bacteria 87999
92 Ga0265338_10000552 3300028800 Bacteria 65513
93 Ga0265338_10000660 3300028800 Bacteria 59683
94 Ga0265338_10000774 3300028800 Bacteria 54489
95 Ga0265338_10001116 3300028800 Bacteria 44580
96 Ga0265338_10004362 3300028800 Bacteria 19148
97 Ga0265338_10004905 3300028800 Bacteria 17804
98 Ga0265338_10007287 3300028800 Bacteria 13802
99 Ga0265338_10015026 3300028800 Bacteria 8547
100 Ga0265338_10017702 3300028800 Bacteria 7662
101 Ga0265338_10027947 3300028800 Bacteria 5643
102 Ga0265338_10031875 3300028800 Bacteria 5157
103 Ga0265338_10035192 3300028800 Bacteria 4821
104 Ga0265338_10061057 3300028800 Bacteria 3306
105 Ga0265338_10072558 3300028800 Unclassified 2938
106 Ga0265338_10075790 3300028800 Bacteria 2852
107 Ga0265338_10096658 3300028800 Bacteria 2422
108 Ga0265338_10188566 3300028800 Bacteria 1565
109 Ga0265338_10191734 3300028800 Bacteria 1548
110 Ga0265338_10243893 3300028800 Bacteria 1329
111 Ga0265324_10000470 3300029957 Bacteria 28358
112 Ga0265324_10001345 3300029957 Bacteria 14370
113 Ga0265324_10011224 3300029957 Bacteria 3421
114 Ga0265324_10015018 3300029957 Bacteria 2853
115 Ga0265324_10025537 3300029957 Bacteria 2094
116 Ga0265324_10040357 3300029957 Bacteria 1616
117 Ga0265324_10051456 3300029957 Bacteria 1415
118 Ga0265332_10008687 3300031238 Bacteria 4553
119 Ga0265320_10004502 3300031240 Bacteria 9122
120 Ga0265320_10010442 3300031240 Bacteria 5533
121 Ga0265320_10016077 3300031240 Bacteria 4204
122 Ga0265320_10019762 3300031240 Bacteria 3672
123 Ga0265320_10034288 3300031240 Bacteria 2583
124 Ga0265320_10051862 3300031240 Bacteria 1988
125 Ga0265325_10001373 3300031241 Bacteria 17189
126 Ga0265329_10034774 3300031242 Bacteria 1627
127 Ga0265340_10014173 3300031247 Bacteria 4173
128 Ga0265339_10029611 3300031249 Bacteria 3106
129 Ga0265339_10032799 3300031249 Bacteria 2928
130 Ga0265331_10045494 3300031250 Bacteria 2119
131 Ga0265331_10067708 3300031250 Bacteria 1675
132 Ga0265327_10001028 3300031251 Bacteria 39368
133 Ga0265327_10004709 3300031251 Bacteria 11916
134 Ga0265327_10015133 3300031251 Bacteria 5001
135 Ga0265327_10047159 3300031251 Bacteria 2275
136 Ga0265316_10005918 3300031344 Bacteria 11781
137 Ga0265316_10011006 3300031344 Bacteria 8206
138 Ga0265316_10031676 3300031344 Bacteria 4320
139 Ga0265316_10039878 3300031344 Bacteria 3768
140 Ga0265316_10043639 3300031344 Bacteria 3571
141 Ga0265316_10123883 3300031344 Bacteria 1950
142 Ga0265316_10127343 3300031344 Bacteria 1920
143 Ga0265313_10003145 3300031595 Bacteria 13623
144 Ga0265313_10003884 3300031595 Bacteria 11773
145 Ga0265313_10003960 3300031595 Bacteria 11637
146 Ga0265313_10028670 3300031595 Bacteria 2890
147 Ga0265314_10000105 3300031711 Bacteria 126697
148 Ga0265314_10038613 3300031711 Bacteria 3447
149 Ga0265314_10070107 3300031711 Bacteria 2350
150 Ga0265342_10019464 3300031712 Bacteria 4374
151 Ga0265342_10053543 3300031712 Bacteria 2401
152 Ga0265342_10088193 3300031712 Bacteria 1782
153 Ga0307412_10087661 3300031911 Bacteria 2169
154 Ga0373930_0015877 3300034816 Bacteria 1418
155 Ga0373938_0010162 3300034957 Bacteria 1722
156 Ga0373926_0025928 3300035083 Bacteria 2049
157 Ga0373928_0000267 3300035084 Bacteria 10319
158 Ga0373944_0000624 3300035089 Bacteria 8430
159 Ga0373949_0001467 3300035090 Bacteria 6734
160 Ga0373932_0000005 3300035112 Bacteria 259528
161 Ga0373954_0034531 3300035118 Bacteria 2343
162 Ga0373954_0044939 3300035118 Bacteria 2062
163 Ga0373943_0009894 3300035170 Bacteria 4272
164 Ga0373943_0050232 3300035170 Bacteria 2049
165 Ga0373962_0000612 3300035242 Bacteria 8060
166 Ga0373931_0000016 3300035691 Bacteria 217932
167 Ga0373927_0004833 3300035695 Bacteria 9365
168 Ga0373927_0005363 3300035695 Bacteria 8858
169 Ga0373927_0018916 3300035695 Bacteria 4520
170 Ga0373927_0107146 3300035695 Bacteria 1820
171 Ga0373947_0002671 3300035725 Bacteria 10721
172 Ga0373947_0040562 3300035725 Bacteria 2773
173 Ga0373937_0077332 3300036401 Bacteria 3075
174 Ga0373937_0106290 3300036401 Bacteria 2609
175 Ga0373937_0132434 3300036401 Unclassified 2329
176 Ga0373937_0424694 3300036401 Bacteria 1262
177 Ga0373925_0000831 3300037068 Bacteria 28499
178 Ga0373925_0001735 3300037068 Bacteria 18294
179 Ga0373925_0044012 3300037068 Bacteria 3314
180 Ga0395905_0171720 3300037471 Bacteria 2037
181 Ga0451577_0330498 3300042876 Bacteria 1383
182 Ga0453683_0001898 3300044673 Bacteria 17074
183 Ga0453684_0032965 3300044712 Bacteria 7233
184 Ga0453684_0076849 3300044712 Bacteria 4190
185 Ga0453684_0088973 3300044712 Bacteria 3821
186 Ga0453684_0283841 3300044712 Bacteria 1887
187 Ga0453684_0349701 3300044712 Bacteria 1667
188 Ga0453684_0590028 3300044712 Bacteria 1219
189 Ga0451576_0004026 3300045051 Bacteria 19541
190 Ga0451576_0161386 3300045051 Bacteria 2340
191 Ga0451576_0213202 3300045051 Bacteria 2017
192 Ga0495592_0043437 3300046454 Bacteria 3363
193 Ga0495629_0135390 3300046459 Bacteria 1715
194 Ga0495582_0060606 3300046473 Bacteria 2088
195 Ga0495639_0092451 3300046475 Bacteria 1421
196 Ga0495662_0024356 3300046476 Bacteria 2921
197 Ga0495662_0073694 3300046476 Bacteria 1656
198 Ga0495664_0063938 3300046477 Bacteria 2193
199 Ga0495618_0005077 3300046514 Bacteria 8040
200 Ga0495618_0101530 3300046514 Bacteria 1841
201 Ga0495618_0115681 3300046514 Bacteria 1717
202 Ga0495628_0001556 3300046516 Bacteria 21019
203 Ga0495630_0005007 3300046517 Bacteria 9319
204 Ga0495630_0016646 3300046517 Bacteria 5377
205 Ga0495630_0040765 3300046517 Bacteria 3470
206 Ga0495630_0087343 3300046517 Bacteria 2355
207 Ga0495586_0000329 3300046535 Bacteria 29949
208 Ga0495586_0004614 3300046535 Bacteria 7367
209 Ga0495645_0003245 3300046543 Bacteria 11037
210 Ga0495645_0054055 3300046543 Bacteria 2918
211 Ga0495667_0066622 3300046559 Bacteria 2354
212 Ga0495634_0004225 3300046642 Bacteria 11337
213 Ga0495657_0019151 3300046675 Bacteria 4942
214 Ga0495599_0001211 3300046678 Bacteria 14638
215 Ga0495599_0033398 3300046678 Bacteria 3233
216 Ga0495599_0073309 3300046678 Bacteria 2137
217 Ga0495658_0010208 3300046683 Bacteria 4694
218 Ga0495613_0007942 3300046689 Bacteria 7896
219 Ga0495613_0036766 3300046689 Bacteria 3631
220 Ga0495613_0069559 3300046689 Bacteria 2566
221 Ga0495674_0003737 3300047319 Bacteria 14799
222 Ga0495674_0119234 3300047319 Bacteria 2230
223 Ga0495676_0037835 3300047321 Bacteria 4013
224 Ga0495680_0009671 3300047322 Bacteria 8651
225 Ga0495684_0163212 3300047471 Bacteria 1661
226 Ga0496107_0190920 3300048910 Unclassified 1522
227 Ga0496115_0006262 3300048918 Bacteria 8706
228 Ga0496125_0000017 3300048928 Bacteria 508217
229 Ga0501031_0000114 3300049568 Bacteria 43188
230 Ga0501032_0003390 3300049569 Bacteria 12210
231 Ga0501033_0004809 3300049570 Bacteria 10788
232 Ga0501034_0252189 3300049571 Bacteria 1709
233 Ga0501046_0085000 3300049580 Bacteria 2440
234 Ga0501047_0085547 3300049581 Bacteria 3030
235 Ga0501035_0001599 3300049822 Bacteria 22935
236 Ga0501035_0106554 3300049822 Bacteria 2457
237 Ga0501044_0001468 3300049823 Bacteria 27685
238 nmdc:mga09592_252728_c1 3300050508 Bacteria 1528
239 nmdc:mga06r32_18152_c1 3300050510 Bacteria 6436
240 nmdc:mga08y16_261937_c1 3300050511 Bacteria 1785
241 nmdc:mga08y16_283580_c1 3300050511 Bacteria 1708
242 nmdc:mga08y16_43532_c1 3300050511 Bacteria 4705

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0213202 Ga0451576_0213202_25_1134 318
2 3300050510 nmdc:mga06r32_18152_c1 nmdc:mga06r32_18152_c1_2107_3102 331
3 3300035170 Ga0373943_0009894 Ga0373943_0009894_2480_3493 337
4 3300035695 Ga0373927_0004833 Ga0373927_0004833_7746_8759 337
5 3300035725 Ga0373947_0002671 Ga0373947_0002671_3771_4784 337
6 3300037068 Ga0373925_0000831 Ga0373925_0000831_3793_4806 337
7 3300046517 Ga0495630_0005007 Ga0495630_0005007_3653_4666 337
8 3300014325 Ga0163163_10153506 Ga0163163_101535062 338
9 3300044712 Ga0453684_0032965 Ga0453684_0032965_3116_4207 338
10 3300005577 Ga0068857_100002196 Ga0068857_1000021968 339
11 3300026118 Ga0207675_100281850 Ga0207675_1002818502 342
12 3300029957 Ga0265324_10025537 Ga0265324_100255371 342
13 3300031238 Ga0265332_10008687 Ga0265332_100086872 344
14 3300031242 Ga0265329_10034774 Ga0265329_100347742 344
15 3300031344 Ga0265316_10127343 Ga0265316_101273431 344
16 3300031711 Ga0265314_10000105 Ga0265314_1000010515 344
17 3300028800 Ga0265338_10015026 Ga0265338_100150267 347
18 3300044673 Ga0453683_0001898 Ga0453683_0001898_5107_6168 348
19 3300046678 Ga0495599_0073309 Ga0495599_0073309_795_1883 350
20 3300028800 Ga0265338_10188566 Ga0265338_101885662 351
21 3300031911 Ga0307412_10087661 Ga0307412_100876612 353
22 3300031595 Ga0265313_10028670 Ga0265313_100286702 354
23 3300048928 Ga0496125_0000017 Ga0496125_0000017_207538_208608 354
24 3300003322 rootL2_10049362 rootL2_100493624 355
25 3300003323 rootH1_10073407 rootH1_100734074 355
26 3300003323 rootH1_10218559 rootH1_102185592 355
27 3300028563 Ga0265319_1023668 Ga0265319_10236682 355
28 3300028563 Ga0265319_1038386 Ga0265319_10383862 355
29 3300028573 Ga0265334_10003988 Ga0265334_100039882 355
30 3300028653 Ga0265323_10000005 Ga0265323_1000000561 355
31 3300028653 Ga0265323_10001806 Ga0265323_100018067 355
32 3300028654 Ga0265322_10000526 Ga0265322_100005268 355
33 3300028654 Ga0265322_10000994 Ga0265322_100009945 355
34 3300028666 Ga0265336_10033555 Ga0265336_100335552 355
35 3300031240 Ga0265320_10010442 Ga0265320_100104424 355
36 3300031240 Ga0265320_10016077 Ga0265320_100160774 355
37 3300031250 Ga0265331_10045494 Ga0265331_100454942 355
38 3300031250 Ga0265331_10067708 Ga0265331_100677081 355
39 3300031344 Ga0265316_10005918 Ga0265316_1000591810 355
40 3300031344 Ga0265316_10011006 Ga0265316_100110066 355
41 3300031595 Ga0265313_10003960 Ga0265313_100039604 355
42 3300031712 Ga0265342_10019464 Ga0265342_100194642 355
43 3300044712 Ga0453684_0076849 Ga0453684_0076849_1835_2920 355
44 3300045051 Ga0451576_0004026 Ga0451576_0004026_4684_5769 355
45 3300048910 Ga0496107_0190920 Ga0496107_0190920_15_1136 355
46 3300035083 Ga0373926_0025928 Ga0373926_0025928_782_1858 356
47 3300042876 Ga0451577_0330498 Ga0451577_0330498_21_1109 357
48 3300044712 Ga0453684_0590028 Ga0453684_0590028_46_1134 357
49 3300006237 Ga0097621_100080070 Ga0097621_1000800702 358
50 3300006358 Ga0068871_100031056 Ga0068871_1000310562 358
51 3300028800 Ga0265338_10000009 Ga0265338_10000009163 358
52 3300028800 Ga0265338_10000312 Ga0265338_1000031244 358
53 3300028800 Ga0265338_10000660 Ga0265338_1000066030 358
54 3300028800 Ga0265338_10191734 Ga0265338_101917342 358
55 3300029957 Ga0265324_10001345 Ga0265324_100013459 358
56 3300029957 Ga0265324_10011224 Ga0265324_100112243 358
57 3300029957 Ga0265324_10040357 Ga0265324_100403572 358
58 3300029957 Ga0265324_10051456 Ga0265324_100514561 358
59 3300031249 Ga0265339_10029611 Ga0265339_100296113 358
60 3300031251 Ga0265327_10047159 Ga0265327_100471592 358
61 3300034816 Ga0373930_0015877 Ga0373930_0015877_157_1233 358
62 3300035084 Ga0373928_0000267 Ga0373928_0000267_2653_3729 358
63 3300035089 Ga0373944_0000624 Ga0373944_0000624_7024_8100 358
64 3300035090 Ga0373949_0001467 Ga0373949_0001467_1520_2596 358
65 3300035112 Ga0373932_0000005 Ga0373932_0000005_189636_190712 358
66 3300035170 Ga0373943_0050232 Ga0373943_0050232_343_1419 358
67 3300035242 Ga0373962_0000612 Ga0373962_0000612_6680_7756 358
68 3300035691 Ga0373931_0000016 Ga0373931_0000016_68817_69893 358
69 3300035695 Ga0373927_0005363 Ga0373927_0005363_1643_2719 358
70 3300035695 Ga0373927_0107146 Ga0373927_0107146_177_1253 358
71 3300035725 Ga0373947_0040562 Ga0373947_0040562_1658_2734 358
72 3300037068 Ga0373925_0001735 Ga0373925_0001735_16478_17554 358
73 3300044712 Ga0453684_0088973 Ga0453684_0088973_2232_3308 358
74 3300003323 rootH1_10130291 rootH1_101302913 359
75 3300005330 Ga0070690_100026314 Ga0070690_1000263143 359
76 3300005563 Ga0068855_100048356 Ga0068855_1000483566 359
77 3300005563 Ga0068855_100051888 Ga0068855_1000518887 359
78 3300005614 Ga0068856_100000264 Ga0068856_10000026438 359
79 3300005617 Ga0068859_100024591 Ga0068859_1000245912 359
80 3300005841 Ga0068863_100124656 Ga0068863_1001246562 359
81 3300006931 Ga0097620_100024591 Ga0097620_1000245914 359
82 3300009093 Ga0105240_10266113 Ga0105240_102661132 359
83 3300009551 Ga0105238_10007302 Ga0105238_100073022 359
84 3300025924 Ga0207694_10007749 Ga0207694_100077492 359
85 3300025949 Ga0207667_10065126 Ga0207667_100651262 359
86 3300026078 Ga0207702_10004146 Ga0207702_100041464 359
87 3300029957 Ga0265324_10015018 Ga0265324_100150182 359
88 3300034957 Ga0373938_0010162 Ga0373938_0010162_616_1695 359
89 3300037471 Ga0395905_0171720 Ga0395905_0171720_709_1788 359
90 3300049568 Ga0501031_0000114 Ga0501031_0000114_19269_20348 359
91 3300049569 Ga0501032_0003390 Ga0501032_0003390_9435_10514 359
92 3300049570 Ga0501033_0004809 Ga0501033_0004809_3108_4187 359
93 3300049580 Ga0501046_0085000 Ga0501046_0085000_1078_2157 359
94 3300049581 Ga0501047_0085547 Ga0501047_0085547_1349_2428 359
95 3300049822 Ga0501035_0001599 Ga0501035_0001599_17762_18841 359
96 3300049822 Ga0501035_0106554 Ga0501035_0106554_177_1256 359
97 3300049823 Ga0501044_0001468 Ga0501044_0001468_22789_23868 359
98 3300005338 Ga0068868_100302335 Ga0068868_1003023351 360
99 3300005365 Ga0070688_100011545 Ga0070688_1000115452 360
100 3300005459 Ga0068867_100275189 Ga0068867_1002751892 360
101 3300005466 Ga0070685_10009665 Ga0070685_100096652 360
102 3300026078 Ga0207702_10087304 Ga0207702_100873041 360
103 3300028556 Ga0265337_1006500 Ga0265337_10065002 360
104 3300028563 Ga0265319_1020745 Ga0265319_10207453 360
105 3300028563 Ga0265319_1047911 Ga0265319_10479111 360
106 3300028577 Ga0265318_10046318 Ga0265318_100463182 360
107 3300028800 Ga0265338_10001116 Ga0265338_1000111658 360
108 3300028800 Ga0265338_10004905 Ga0265338_1000490511 360
109 3300028800 Ga0265338_10007287 Ga0265338_100072879 360
110 3300028800 Ga0265338_10017702 Ga0265338_100177023 360
111 3300028800 Ga0265338_10027947 Ga0265338_100279472 360
112 3300028800 Ga0265338_10031875 Ga0265338_100318751 360
113 3300028800 Ga0265338_10096658 Ga0265338_100966582 360
114 3300031240 Ga0265320_10051862 Ga0265320_100518623 360
115 3300031241 Ga0265325_10001373 Ga0265325_1000137319 360
116 3300031249 Ga0265339_10032799 Ga0265339_100327992 360
117 3300031251 Ga0265327_10004709 Ga0265327_100047097 360
118 3300031344 Ga0265316_10031676 Ga0265316_100316765 360
119 3300031344 Ga0265316_10043639 Ga0265316_100436394 360
120 3300031595 Ga0265313_10003145 Ga0265313_1000314512 360
121 3300031711 Ga0265314_10038613 Ga0265314_100386132 360
122 3300031712 Ga0265342_10053543 Ga0265342_100535433 360
123 3300031712 Ga0265342_10088193 Ga0265342_100881931 360
124 3300035118 Ga0373954_0044939 Ga0373954_0044939_83_1165 360
125 3300035695 Ga0373927_0018916 Ga0373927_0018916_1127_2209 360
126 3300036401 Ga0373937_0077332 Ga0373937_0077332_247_1329 360
127 3300036401 Ga0373937_0132434 Ga0373937_0132434_303_1385 360
128 3300037068 Ga0373925_0044012 Ga0373925_0044012_1359_2441 360
129 3300046459 Ga0495629_0135390 Ga0495629_0135390_208_1290 360
130 3300046476 Ga0495662_0073694 Ga0495662_0073694_97_1179 360
131 3300046514 Ga0495618_0005077 Ga0495618_0005077_3450_4532 360
132 3300046514 Ga0495618_0115681 Ga0495618_0115681_153_1235 360
133 3300046517 Ga0495630_0040765 Ga0495630_0040765_394_1476 360
134 3300046517 Ga0495630_0087343 Ga0495630_0087343_948_2030 360
135 3300046535 Ga0495586_0004614 Ga0495586_0004614_5136_6218 360
136 3300046559 Ga0495667_0066622 Ga0495667_0066622_191_1273 360
137 3300046642 Ga0495634_0004225 Ga0495634_0004225_4235_5317 360
138 3300046683 Ga0495658_0010208 Ga0495658_0010208_2767_3849 360
139 3300046689 Ga0495613_0007942 Ga0495613_0007942_4665_5747 360
140 3300046689 Ga0495613_0036766 Ga0495613_0036766_1307_2389 360
141 3300047322 Ga0495680_0009671 Ga0495680_0009671_3774_4856 360
142 3300047471 Ga0495684_0163212 Ga0495684_0163212_135_1217 360
143 3300049571 Ga0501034_0252189 Ga0501034_0252189_24_1106 360
144 3300050508 nmdc:mga09592_252728_c1 nmdc:mga09592_252728_c1_398_1480 360
145 3300050511 nmdc:mga08y16_283580_c1 nmdc:mga08y16_283580_c1_535_1617 360
146 3300005436 Ga0070713_100354654 Ga0070713_1003546542 361
147 3300005543 Ga0070672_100337343 Ga0070672_1003373431 361
148 3300005617 Ga0068859_100113995 Ga0068859_1001139952 361
149 3300006931 Ga0097620_100113997 Ga0097620_1001139972 361
150 3300013296 Ga0157374_10172644 Ga0157374_101726442 361
151 3300014325 Ga0163163_10000064 Ga0163163_1000006446 361
152 3300025928 Ga0207700_10311995 Ga0207700_103119952 361
153 3300025944 Ga0207661_10157609 Ga0207661_101576092 361
154 3300028563 Ga0265319_1000179 Ga0265319_100017925 361
155 3300028800 Ga0265338_10000552 Ga0265338_1000055267 361
156 3300029957 Ga0265324_10000470 Ga0265324_1000047017 361
157 3300031240 Ga0265320_10004502 Ga0265320_100045027 361
158 3300031240 Ga0265320_10019762 Ga0265320_100197622 361
159 3300031595 Ga0265313_10003884 Ga0265313_100038848 361
160 3300005617 Ga0068859_100467069 Ga0068859_1004670692 362
161 3300006846 Ga0075430_100065766 Ga0075430_1000657663 362
162 3300006847 Ga0075431_100043646 Ga0075431_1000436462 362
163 3300006931 Ga0097620_100467083 Ga0097620_1004670832 362
164 3300013104 Ga0157370_10077126 Ga0157370_100771262 362
165 3300013308 Ga0157375_10000038 Ga0157375_1000003825 362
166 3300026116 Ga0207674_10016144 Ga0207674_100161444 362
167 3300028573 Ga0265334_10015185 Ga0265334_100151853 362
168 3300031251 Ga0265327_10001028 Ga0265327_100010286 362
169 3300044712 Ga0453684_0349701 Ga0453684_0349701_53_1141 362
170 3300003320 rootH2_10138414 rootH2_101384142 363
171 3300005329 Ga0070683_100028277 Ga0070683_1000282774 363
172 3300005339 Ga0070660_100142424 Ga0070660_1001424242 363
173 3300005435 Ga0070714_100009977 Ga0070714_1000099775 363
174 3300005439 Ga0070711_100031290 Ga0070711_1000312904 363
175 3300005458 Ga0070681_10261795 Ga0070681_102617951 363
176 3300005563 Ga0068855_100156483 Ga0068855_1001564832 363
177 3300005614 Ga0068856_100016909 Ga0068856_1000169093 363
178 3300005617 Ga0068859_100144618 Ga0068859_1001446182 363
179 3300005618 Ga0068864_100274185 Ga0068864_1002741852 363
180 3300005841 Ga0068863_100021811 Ga0068863_1000218112 363
181 3300006358 Ga0068871_100401391 Ga0068871_1004013911 363
182 3300006844 Ga0075428_100001486 Ga0075428_1000014865 363
183 3300006931 Ga0097620_100144607 Ga0097620_1001446072 363
184 3300009093 Ga0105240_10022584 Ga0105240_100225846 363
185 3300009093 Ga0105240_10125786 Ga0105240_101257863 363
186 3300009094 Ga0111539_10008568 Ga0111539_1000856810 363
187 3300009094 Ga0111539_10171963 Ga0111539_101719632 363
188 3300009094 Ga0111539_10333078 Ga0111539_103330782 363
189 3300009551 Ga0105238_10008944 Ga0105238_100089447 363
190 3300013297 Ga0157378_10466463 Ga0157378_104664631 363
191 3300013307 Ga0157372_10094143 Ga0157372_100941433 363
192 3300025912 Ga0207707_10077135 Ga0207707_100771353 363
193 3300025913 Ga0207695_10088298 Ga0207695_100882982 363
194 3300025913 Ga0207695_10104436 Ga0207695_101044362 363
195 3300025916 Ga0207663_10023397 Ga0207663_100233971 363
196 3300025921 Ga0207652_10334670 Ga0207652_103346702 363
197 3300025924 Ga0207694_10004798 Ga0207694_100047987 363
198 3300025936 Ga0207670_10043484 Ga0207670_100434842 363
199 3300026088 Ga0207641_10072125 Ga0207641_100721253 363
200 3300028556 Ga0265337_1001107 Ga0265337_10011078 363
201 3300028653 Ga0265323_10000055 Ga0265323_1000005520 363
202 3300028666 Ga0265336_10011908 Ga0265336_100119083 363
203 3300028666 Ga0265336_10019392 Ga0265336_100193922 363
204 3300028800 Ga0265338_10000774 Ga0265338_100007749 363
205 3300028800 Ga0265338_10004362 Ga0265338_1000436216 363
206 3300028800 Ga0265338_10035192 Ga0265338_100351922 363
207 3300028800 Ga0265338_10061057 Ga0265338_100610572 363
208 3300028800 Ga0265338_10072558 Ga0265338_100725583 363
209 3300028800 Ga0265338_10075790 Ga0265338_100757902 363
210 3300028800 Ga0265338_10243893 Ga0265338_102438931 363
211 3300031240 Ga0265320_10034288 Ga0265320_100342883 363
212 3300031247 Ga0265340_10014173 Ga0265340_100141735 363
213 3300031251 Ga0265327_10015133 Ga0265327_100151331 363
214 3300031344 Ga0265316_10039878 Ga0265316_100398784 363
215 3300031344 Ga0265316_10123883 Ga0265316_101238832 363
216 3300031711 Ga0265314_10070107 Ga0265314_100701072 363
217 3300035118 Ga0373954_0034531 Ga0373954_0034531_921_2021 363
218 3300036401 Ga0373937_0106290 Ga0373937_0106290_1175_2275 363
219 3300036401 Ga0373937_0424694 Ga0373937_0424694_66_1190 363
220 3300044712 Ga0453684_0283841 Ga0453684_0283841_246_1337 363
221 3300045051 Ga0451576_0161386 Ga0451576_0161386_288_1388 363
222 3300046454 Ga0495592_0043437 Ga0495592_0043437_1577_2671 363
223 3300046473 Ga0495582_0060606 Ga0495582_0060606_816_1913 363
224 3300046475 Ga0495639_0092451 Ga0495639_0092451_273_1370 363
225 3300046476 Ga0495662_0024356 Ga0495662_0024356_856_1953 363
226 3300046477 Ga0495664_0063938 Ga0495664_0063938_676_1827 363
227 3300046514 Ga0495618_0101530 Ga0495618_0101530_132_1283 363
228 3300046516 Ga0495628_0001556 Ga0495628_0001556_7562_8713 363
229 3300046517 Ga0495630_0016646 Ga0495630_0016646_2368_3519 363
230 3300046535 Ga0495586_0000329 Ga0495586_0000329_17759_18910 363
231 3300046543 Ga0495645_0003245 Ga0495645_0003245_5029_6180 363
232 3300046543 Ga0495645_0054055 Ga0495645_0054055_1275_2432 363
233 3300046675 Ga0495657_0019151 Ga0495657_0019151_537_1664 363
234 3300046678 Ga0495599_0001211 Ga0495599_0001211_7243_8394 363
235 3300046678 Ga0495599_0033398 Ga0495599_0033398_304_1398 363
236 3300046689 Ga0495613_0069559 Ga0495613_0069559_825_1922 363
237 3300047319 Ga0495674_0003737 Ga0495674_0003737_825_1922 363
238 3300047319 Ga0495674_0119234 Ga0495674_0119234_797_1891 363
239 3300047321 Ga0495676_0037835 Ga0495676_0037835_2552_3649 363
240 3300048918 Ga0496115_0006262 Ga0496115_0006262_998_2113 363
241 3300050511 nmdc:mga08y16_261937_c1 nmdc:mga08y16_261937_c1_234_1406 363
242 3300050511 nmdc:mga08y16_43532_c1 nmdc:mga08y16_43532_c1_2478_3569 363

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF24621

197

342

0.99

PF01761

DHQ_synthase

3-dehydroquinate synthase

82

196

0.98

PF00465

Fe-ADH

Iron-containing alcohol dehydrogenase

27

182

0.85

PF13685

Fe-ADH_2

Iron-containing alcohol dehydrogenase

31

188

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5eks-assembly3.cif.gz_B-2 structure of 3-dehydroquinate synthase from acinetobacter baumannii in complex with nad 0.9662 2 363
5eks-assembly3.cif.gz_A structure of 3-dehydroquinate synthase from acinetobacter baumannii in complex with nad 0.9654 2 363
6lk2-assembly2.cif.gz_D crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, nad and chlorogenic acid 0.9619 1 357
3qbe-assembly1.cif.gz_A crystal structure of the 3-dehydroquinate synthase (arob) from mycobacterium tuberculosis 0.9596 2 363
6lk2-assembly2.cif.gz_D crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, nad and chlorogenic acid 0.9564 1 357
ID Description Score Start End Superfamily
af_A0A0R0HLZ4_60_246_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9622 2 172 3.40.50.1970
3qbdA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.956 2 172 3.40.50.1970
3okfB02 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.9496 174 361 1.20.1090.10
af_A0A1D6IPW7_249_439_1.20.1090.10 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.948 174 362 1.20.1090.10
1xahB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9447 2 172 3.40.50.1970
ID Description Score Start End GO Terms
AF-A0A538P216-F1-model_v4 3-dehydroquinate synthase (EC 4.2.3.4) 0.9978 1 257 GO:0003856
GO:0005737
GO:0008652
GO:0009073
GO:0009423
AF-A0A3C0VZ06-F1-model_v4 3-dehydroquinate synthase 0.9974 1 121 GO:0003856
GO:0009073
GO:0016020
AF-A0A3B8QAC3-F1-model_v4 3-dehydroquinate synthase 0.9965 1 214 GO:0003856
GO:0009073
GO:0016020
AF-A0A2X1PI66-F1-model_v4 3-dehydroquinate synthase (EC 4.2.3.4) 0.996 93 205 GO:0003856
GO:0009073
AF-X1HFU3-F1-model_v4 3-dehydroquinate synthase domain-containing protein 0.9944 136 276 GO:0003856
GO:0009073

Feature Viewer

pLDDT pTM Quality
93.32 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map