F354283

General Info

Members Datasets Scaffolds Average Seq Length
242 133 234 303

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10053724|rootH1_100537241
Length 306
Sequence MKFEVTILGSSSATPIYNRNPSAQVLNINERLYLVDCGEGTQQQMLRFDVKPSRIDHIFISHLHGDHYLGLVGLLSSMHLNGRTKALKLFCPAQLREIIDLQLKYSETTLQFEIDYYFTNPDQPETILDNQDVVVESIPLDHRIACTGFLFKQKKRLRKLIKDKIAELDIPVEYYSAIKKGADYTAPDGTVYKNADLTLNPETPKSYAYCSDTQYNERYFKQISNADMLYHEATFAHTMLSRARITHHTTASQAAEIALITNARRLLIGHFSARYKTLNELLDEAQAVFPETELALEGKTFVIGEE

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
3 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
4 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
5 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
6 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
7 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
8 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
16 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
17 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
64 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
65 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
95 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
102 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
106 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
109 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
110 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
111 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
112 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
115 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
116 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
119 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
120 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
121 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
122 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
123 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
124 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
125 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
126 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
127 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
128 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
129 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
130 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
131 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
132 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
133 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.28
Metatranscriptomes 0.41
Isolates 3.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.09
Nodule 0
Rhizoplane 0.83
Rhizosphere 82.64
Stem 0
Stem Tuber 0
Unclassified 7.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10011033 3300001979 Bacteria 3455
2 JGI24740J21852_10038499 3300001979 Bacteria 1467
3 JGI24739J22299_10021719 3300001989 Bacteria 2282
4 JGI24737J22298_10001721 3300001990 Bacteria 7796
5 JGI24737J22298_10002039 3300001990 Bacteria 7227
6 JGI24737J22298_10004539 3300001990 Bacteria 4832
7 JGI24743J22301_10025258 3300001991 Bacteria 1150
8 JGI24735J21928_10000002 3300002067 Bacteria 624895
9 JGI24735J21928_10023508 3300002067 Bacteria 1869
10 JGI24744J21845_10008540 3300002077 Bacteria 2106
11 JGI25162J39368_1000024 3300002737 Bacteria 229507
12 JGI25162J39368_1002079 3300002737 Bacteria 8582
13 JGI25157J39369_1005129 3300002741 Bacteria 2190
14 JGI25164J39214_1000915 3300002772 Bacteria 9818
15 JGI25165J46597_1002405 3300003214 Bacteria 6136
16 rootH1_10053724 3300003316 Bacteria 2348
17 rootH2_10002858 3300003320 Bacteria 54174
18 rootH2_10035181 3300003320 Bacteria 29518
19 rootH2_10060402 3300003320 Bacteria 2886
20 rootH1_10012846 3300003323 Bacteria 47357
21 rootH1_10023692 3300003323 Bacteria 2213
22 rootH1_10265550 3300003323 Bacteria 1399
23 Ga0058863_11859959 3300004799 Bacteria 4630
24 Ga0065714_10003176 3300005288 Bacteria 9707
25 Ga0070658_10260196 3300005327 Unclassified 1473
26 Ga0070680_100004089 3300005336 Bacteria 10926
27 Ga0070671_100006251 3300005355 Bacteria 9487
28 Ga0070673_100007272 3300005364 Bacteria 7290
29 Ga0070659_100000920 3300005366 Bacteria 21557
30 Ga0070659_100001700 3300005366 Bacteria 15810
31 Ga0070659_100030852 3300005366 Bacteria 4149
32 Ga0070663_100016065 3300005455 Bacteria 4849
33 Ga0070678_100155505 3300005456 Bacteria 1847
34 Ga0070662_100002169 3300005457 Bacteria 12029
35 Ga0070681_10151240 3300005458 Bacteria 2247
36 Ga0068867_100022218 3300005459 Bacteria 4534
37 Ga0070679_100028754 3300005530 Bacteria 5483
38 Ga0068853_100018105 3300005539 Bacteria 5825
39 Ga0068853_100045969 3300005539 Bacteria 3741
40 Ga0070665_100000003 3300005548 Bacteria 811857
41 Ga0068855_100000134 3300005563 Bacteria 94864
42 Ga0068855_100001554 3300005563 Bacteria 28837
43 Ga0068855_100008317 3300005563 Bacteria 12540
44 Ga0068855_100216843 3300005563 Bacteria 2148
45 Ga0068856_100001155 3300005614 Bacteria 27745
46 Ga0068856_100005924 3300005614 Bacteria 12032
47 Ga0068856_100130467 3300005614 Bacteria 2518
48 Ga0068856_100156637 3300005614 Bacteria 2288
49 Ga0068852_100002395 3300005616 Bacteria 12919
50 Ga0068866_10106796 3300005718 Bacteria 1554
51 Ga0068866_10153107 3300005718 Bacteria 1337
52 Ga0075366_10001161 3300006195 Bacteria 13031
53 Ga0075366_10086373 3300006195 Bacteria 1877
54 Ga0097621_100000033 3300006237 Bacteria 69289
55 Ga0068871_100000020 3300006358 Bacteria 84930
56 Ga0068865_100000138 3300006881 Bacteria 38207
57 Ga0105240_10000068 3300009093 Bacteria 207756
58 Ga0105240_10004790 3300009093 Bacteria 20399
59 Ga0105240_10085251 3300009093 Bacteria 3871
60 Ga0105240_10140455 3300009093 Bacteria 2888
61 Ga0105240_10660089 3300009093 Bacteria 1145
62 Ga0105240_10796298 3300009093 Bacteria 1024
63 Ga0105241_10004109 3300009174 Bacteria 10745
64 Ga0105241_10007200 3300009174 Bacteria 8187
65 Ga0105241_10008457 3300009174 Bacteria 7566
66 Ga0105241_10037105 3300009174 Bacteria 3671
67 Ga0105241_10079837 3300009174 Bacteria 2559
68 Ga0105242_10045659 3300009176 Bacteria 3551
69 Ga0105237_10000274 3300009545 Bacteria 72354
70 Ga0105237_10000803 3300009545 Bacteria 42892
71 Ga0105237_10001914 3300009545 Bacteria 26581
72 Ga0105237_10004465 3300009545 Bacteria 16170
73 Ga0105237_10064483 3300009545 Bacteria 3659
74 Ga0105237_10066228 3300009545 Bacteria 3607
75 Ga0105237_10080771 3300009545 Bacteria 3242
76 Ga0105237_10161218 3300009545 Bacteria 2241
77 Ga0105238_10002195 3300009551 Bacteria 19712
78 Ga0105239_10000013 3300010375 Bacteria 327371
79 Ga0105239_10001207 3300010375 Bacteria 35283
80 Ga0105239_10005491 3300010375 Bacteria 14869
81 Ga0105239_10012287 3300010375 Bacteria 9537
82 Ga0105239_10025930 3300010375 Bacteria 6455
83 Ga0105239_10036215 3300010375 Bacteria 5419
84 Ga0105239_10052523 3300010375 Bacteria 4469
85 Ga0105239_10061388 3300010375 Bacteria 4125
86 Ga0105239_10368875 3300010375 Bacteria 1622
87 Ga0105246_10020949 3300011119 Bacteria 4199
88 Ga0157373_10001101 3300013100 Bacteria 20720
89 Ga0157373_10003455 3300013100 Bacteria 11955
90 Ga0157371_10006726 3300013102 Bacteria 9400
91 Ga0157371_10021642 3300013102 Bacteria 4718
92 Ga0157371_10026888 3300013102 Bacteria 4177
93 Ga0157371_10048438 3300013102 Bacteria 3020
94 Ga0157370_10037159 3300013104 Bacteria 4722
95 Ga0157370_10068672 3300013104 Bacteria 3349
96 Ga0157370_10154825 3300013104 Bacteria 2133
97 Ga0157369_10004541 3300013105 Bacteria 16330
98 Ga0157369_10141494 3300013105 Bacteria 2546
99 Ga0157374_10000349 3300013296 Bacteria 42687
100 Ga0157374_10000950 3300013296 Bacteria 25156
101 Ga0157374_10005211 3300013296 Bacteria 10898
102 Ga0157378_10007782 3300013297 Bacteria 9354
103 Ga0163162_10000066 3300013306 Bacteria 100009
104 Ga0163162_10004715 3300013306 Bacteria 13147
105 Ga0163162_10646207 3300013306 Unclassified 1182
106 Ga0157372_10000001 3300013307 Bacteria 791349
107 Ga0157372_10000730 3300013307 Bacteria 35818
108 Ga0157372_10002233 3300013307 Bacteria 21015
109 Ga0157372_10003847 3300013307 Bacteria 16131
110 Ga0157372_10270438 3300013307 Bacteria 1975
111 Ga0157372_10332598 3300013307 Bacteria 1769
112 Ga0157375_10006708 3300013308 Bacteria 10029
113 Ga0157375_10032139 3300013308 Bacteria 4974
114 Ga0213872_10025117 3300021361 Unclassified 2739
115 Ga0207427_101537 3300025231 Bacteria 8070
116 Ga0209437_100017 3300025233 Bacteria 694471
117 Ga0209437_100052 3300025233 Bacteria 380548
118 Ga0209026_1001668 3300025250 Bacteria 9372
119 Ga0209026_1002004 3300025250 Bacteria 8091
120 Ga0209129_1007615 3300025258 Bacteria 3180
121 Ga0209233_1000067 3300025261 Bacteria 380554
122 Ga0209233_1002062 3300025261 Bacteria 7612
123 Ga0209455_1008726 3300025272 Bacteria 2727
124 Ga0207647_10000665 3300025904 Bacteria 26867
125 Ga0207647_10003255 3300025904 Bacteria 12193
126 Ga0207647_10147474 3300025904 Bacteria 1376
127 Ga0207645_10000131 3300025907 Bacteria 56813
128 Ga0207705_10000015 3300025909 Bacteria 382901
129 Ga0207705_10243032 3300025909 Bacteria 1372
130 Ga0207654_10002510 3300025911 Bacteria 9323
131 Ga0207654_10044555 3300025911 Bacteria 2521
132 Ga0207707_10127994 3300025912 Bacteria 2221
133 Ga0207695_10000131 3300025913 Bacteria 223762
134 Ga0207695_10003136 3300025913 Bacteria 23615
135 Ga0207695_10019218 3300025913 Bacteria 7868
136 Ga0207695_10032091 3300025913 Bacteria 5752
137 Ga0207695_10093009 3300025913 Bacteria 3025
138 Ga0207695_10131687 3300025913 Bacteria 2458
139 Ga0207671_10000787 3300025914 Bacteria 40182
140 Ga0207671_10001653 3300025914 Bacteria 25337
141 Ga0207671_10004792 3300025914 Bacteria 12745
142 Ga0207671_10005774 3300025914 Bacteria 11271
143 Ga0207671_10017823 3300025914 Bacteria 5463
144 Ga0207671_10082308 3300025914 Bacteria 2415
145 Ga0207657_10043656 3300025919 Bacteria 3947
146 Ga0207652_10002395 3300025921 Bacteria 15834
147 Ga0207694_10075375 3300025924 Bacteria 2641
148 Ga0207644_10003897 3300025931 Bacteria 9670
149 Ga0207690_10008351 3300025932 Bacteria 6146
150 Ga0207706_10000126 3300025933 Bacteria 82630
151 Ga0207686_10065545 3300025934 Bacteria 2317
152 Ga0207704_10000109 3300025938 Bacteria 45314
153 Ga0207667_10000020 3300025949 Bacteria 374770
154 Ga0207667_10001127 3300025949 Bacteria 33693
155 Ga0207667_10005980 3300025949 Bacteria 14801
156 Ga0207667_10019556 3300025949 Bacteria 7556
157 Ga0207667_10057566 3300025949 Bacteria 4080
158 Ga0207667_10207317 3300025949 Bacteria 2010
159 Ga0207667_10388886 3300025949 Bacteria 1421
160 Ga0207677_10010526 3300026023 Bacteria 5238
161 Ga0207639_10005541 3300026041 Bacteria 8536
162 Ga0207639_10052686 3300026041 Bacteria 3102
163 Ga0207678_10008598 3300026067 Bacteria 8996
164 Ga0207702_10001532 3300026078 Bacteria 22854
165 Ga0207702_10012211 3300026078 Bacteria 7148
166 Ga0207702_10138237 3300026078 Bacteria 2201
167 Ga0207702_10141006 3300026078 Bacteria 2181
168 Ga0207648_10000155 3300026089 Bacteria 69524
169 Ga0207683_10016615 3300026121 Bacteria 6263
170 Ga0207698_10012144 3300026142 Bacteria 5621
171 Ga0268266_10000052 3300028379 Bacteria 296230
172 Ga0307517_10045196 3300028786 Bacteria 4634
173 Ga0307515_10000794 3300028794 Bacteria 72827
174 Ga0307515_10014388 3300028794 Bacteria 14675
175 Ga0307507_10000064 3300033179 Bacteria 161226
176 Ga0307510_10032848 3300033180 Bacteria 5842
177 Ga0395899_0000001 3300037312 Bacteria 1750322
178 Ga0395899_0000435 3300037312 Bacteria 47985
179 Ga0395899_0004805 3300037312 Bacteria 10519
180 Ga0395900_0000014 3300037418 Bacteria 386513
181 Ga0395900_0000873 3300037418 Bacteria 39536
182 Ga0395900_0037412 3300037418 Bacteria 5004
183 Ga0395898_0111571 3300037466 Bacteria 2621
184 Ga0395905_0000037 3300037471 Bacteria 261808
185 Ga0395905_0000516 3300037471 Bacteria 52868
186 Ga0395901_0000166 3300038443 Bacteria 86352
187 Ga0395901_0046427 3300038443 Bacteria 4512
188 Ga0436361_0818974 3300039447 Bacteria 5442
189 Ga0466969_0026733 3300044656 Bacteria 2959
190 Ga0466961_0049499 3300044693 Bacteria 2686
191 Ga0466959_0113693 3300045049 Bacteria 1930
192 Ga0495650_0000003 3300046471 Bacteria 900730
193 Ga0495585_0000079 3300046492 Bacteria 100159
194 Ga0495606_0000163 3300046507 Bacteria 117268
195 Ga0495606_0028010 3300046507 Bacteria 3982
196 Ga0495610_0032802 3300046512 Bacteria 2692
197 Ga0495616_0003711 3300046513 Bacteria 9739
198 Ga0495631_0018817 3300046518 Bacteria 3247
199 Ga0495644_0003838 3300046523 Bacteria 5916
200 Ga0495648_0032230 3300046524 Bacteria 3442
201 Ga0495652_0061195 3300046529 Bacteria 3179
202 Ga0495609_0047445 3300046538 Bacteria 1922
203 Ga0495633_0000056 3300046558 Bacteria 149334
204 Ga0495633_0016933 3300046558 Bacteria 3739
205 Ga0495668_0091494 3300046616 Bacteria 1667
206 Ga0495625_0000159 3300046660 Bacteria 104355
207 Ga0495625_0003717 3300046660 Bacteria 14877
208 Ga0495625_0022826 3300046660 Bacteria 4788
209 Ga0495625_0056927 3300046660 Bacteria 2782
210 Ga0495625_0340745 3300046660 Bacteria 950
211 Ga0495661_0001324 3300046665 Bacteria 21027
212 Ga0495661_0124868 3300046665 Bacteria 1417
213 Ga0495661_0151149 3300046665 Bacteria 1254
214 Ga0495649_0000003 3300046694 Bacteria 880817
215 Ga0495660_0041353 3300046810 Bacteria 2553
216 Ga0495687_000527 3300047443 Bacteria 45682
217 Ga0495687_001555 3300047443 Bacteria 20864
218 Ga0495673_0033768 3300047469 Bacteria 2371
219 Ga0495686_0000160 3300047472 Bacteria 128437
220 Ga0495686_0002432 3300047472 Bacteria 17594
221 Ga0495686_0097342 3300047472 Unclassified 1779
222 Ga0495686_0109074 3300047472 Bacteria 1662
223 Ga0495614_0011137 3300048089 Bacteria 3958
224 Ga0496115_0438043 3300048918 Unclassified 1057
225 Ga0501223_004313 3300049663 Bacteria 3057
226 nmdc:mga0k408_111_c1 3300050493 Bacteria 39614
227 nmdc:mga0k408_88_c1 3300050493 Bacteria 43334
228 Ga0500635_0009946 3300053080 Bacteria 2656
229 Ga0500650_0083606 3300053098 Bacteria 1493
230 Ga0500608_000994 3300053122 Bacteria 10206
231 Ga0500618_000003 3300053125 Bacteria 338706
232 Ga0500618_020218 3300053125 Bacteria 1632
233 Ga0500622_0001498 3300053156 Bacteria 18574
234 Ga0500634_0052812 3300053161 Bacteria 2182

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046665 Ga0495661_0151149 Ga0495661_0151149_64_849 259
2 3300053080 Ga0500635_0009946 Ga0500635_0009946_705_1619 263
3 3300025250 Ga0209026_1002004 Ga0209026_10020045 270
4 3300046507 Ga0495606_0028010 Ga0495606_0028010_13_837 272
5 3300047472 Ga0495686_0097342 Ga0495686_0097342_341_1258 280
6 3300053122 Ga0500608_000994 Ga0500608_000994_7275_8189 288
7 3300025914 Ga0207671_10017823 Ga0207671_100178233 296
8 3300025919 Ga0207657_10043656 Ga0207657_100436563 296
9 3300025949 Ga0207667_10388886 Ga0207667_103888861 296
10 iso_pu_bacteria 2599185184 2599478654 299
11 iso_pu_bacteria 2852623160 2852623677 299
12 iso_pu_bacteria 2884933994 2884937419 299
13 iso_pu_bacteria 2919437846 2919441332 299
14 iso_pu_bacteria 2928078545 2928080290 299
15 iso_pu_bacteria 2928147474 2928149537 299
16 iso_pu_bacteria 2932082852 2932083367 299
17 iso_pu_bacteria 2977232053 2977236186 299
18 3300038443 Ga0395901_0046427 Ga0395901_0046427_2604_3509 301
19 3300009174 Ga0105241_10079837 Ga0105241_100798372 302
20 3300009545 Ga0105237_10004465 Ga0105237_100044652 302
21 3300025914 Ga0207671_10001653 Ga0207671_1000165316 302
22 3300001979 JGI24740J21852_10011033 JGI24740J21852_100110334 303
23 3300001979 JGI24740J21852_10038499 JGI24740J21852_100384992 303
24 3300001989 JGI24739J22299_10021719 JGI24739J22299_100217193 303
25 3300001990 JGI24737J22298_10001721 JGI24737J22298_100017217 303
26 3300001990 JGI24737J22298_10002039 JGI24737J22298_100020394 303
27 3300001990 JGI24737J22298_10004539 JGI24737J22298_100045392 303
28 3300001991 JGI24743J22301_10025258 JGI24743J22301_100252582 303
29 3300002067 JGI24735J21928_10000002 JGI24735J21928_10000002289 303
30 3300002067 JGI24735J21928_10023508 JGI24735J21928_100235083 303
31 3300002077 JGI24744J21845_10008540 JGI24744J21845_100085402 303
32 3300002737 JGI25162J39368_1000024 JGI25162J39368_1000024163 303
33 3300002737 JGI25162J39368_1002079 JGI25162J39368_10020797 303
34 3300002741 JGI25157J39369_1005129 JGI25157J39369_10051292 303
35 3300002772 JGI25164J39214_1000915 JGI25164J39214_10009158 303
36 3300003214 JGI25165J46597_1002405 JGI25165J46597_10024054 303
37 3300003316 rootH1_10053724 rootH1_100537241 303
38 3300003320 rootH2_10002858 rootH2_1000285817 303
39 3300003320 rootH2_10035181 rootH2_1003518116 303
40 3300003320 rootH2_10060402 rootH2_100604023 303
41 3300003323 rootH1_10012846 rootH1_1001284625 303
42 3300003323 rootH1_10023692 rootH1_100236922 303
43 3300003323 rootH1_10265550 rootH1_102655501 303
44 3300004799 Ga0058863_11859959 Ga0058863_118599592 303
45 3300005288 Ga0065714_10003176 Ga0065714_100031767 303
46 3300005327 Ga0070658_10260196 Ga0070658_102601962 303
47 3300005336 Ga0070680_100004089 Ga0070680_1000040894 303
48 3300005355 Ga0070671_100006251 Ga0070671_1000062515 303
49 3300005364 Ga0070673_100007272 Ga0070673_1000072722 303
50 3300005366 Ga0070659_100000920 Ga0070659_10000092025 303
51 3300005366 Ga0070659_100001700 Ga0070659_10000170013 303
52 3300005366 Ga0070659_100030852 Ga0070659_1000308523 303
53 3300005455 Ga0070663_100016065 Ga0070663_1000160654 303
54 3300005456 Ga0070678_100155505 Ga0070678_1001555053 303
55 3300005457 Ga0070662_100002169 Ga0070662_1000021698 303
56 3300005458 Ga0070681_10151240 Ga0070681_101512403 303
57 3300005459 Ga0068867_100022218 Ga0068867_1000222184 303
58 3300005530 Ga0070679_100028754 Ga0070679_1000287542 303
59 3300005539 Ga0068853_100018105 Ga0068853_1000181054 303
60 3300005539 Ga0068853_100045969 Ga0068853_1000459693 303
61 3300005548 Ga0070665_100000003 Ga0070665_100000003464 303
62 3300005563 Ga0068855_100000134 Ga0068855_1000001342 303
63 3300005563 Ga0068855_100001554 Ga0068855_10000155415 303
64 3300005563 Ga0068855_100008317 Ga0068855_1000083173 303
65 3300005563 Ga0068855_100216843 Ga0068855_1002168432 303
66 3300005614 Ga0068856_100001155 Ga0068856_1000011557 303
67 3300005614 Ga0068856_100005924 Ga0068856_1000059247 303
68 3300005614 Ga0068856_100130467 Ga0068856_1001304672 303
69 3300005614 Ga0068856_100156637 Ga0068856_1001566373 303
70 3300005616 Ga0068852_100002395 Ga0068852_1000023951 303
71 3300005718 Ga0068866_10106796 Ga0068866_101067962 303
72 3300005718 Ga0068866_10153107 Ga0068866_101531072 303
73 3300006195 Ga0075366_10001161 Ga0075366_100011618 303
74 3300006195 Ga0075366_10086373 Ga0075366_100863732 303
75 3300006237 Ga0097621_100000033 Ga0097621_10000003357 303
76 3300006358 Ga0068871_100000020 Ga0068871_10000002060 303
77 3300006881 Ga0068865_100000138 Ga0068865_10000013819 303
78 3300009093 Ga0105240_10000068 Ga0105240_1000006862 303
79 3300009093 Ga0105240_10004790 Ga0105240_100047907 303
80 3300009093 Ga0105240_10085251 Ga0105240_100852514 303
81 3300009093 Ga0105240_10140455 Ga0105240_101404551 303
82 3300009093 Ga0105240_10660089 Ga0105240_106600891 303
83 3300009093 Ga0105240_10796298 Ga0105240_107962981 303
84 3300009174 Ga0105241_10004109 Ga0105241_100041099 303
85 3300009174 Ga0105241_10007200 Ga0105241_100072009 303
86 3300009174 Ga0105241_10008457 Ga0105241_100084577 303
87 3300009174 Ga0105241_10037105 Ga0105241_100371054 303
88 3300009176 Ga0105242_10045659 Ga0105242_100456593 303
89 3300009545 Ga0105237_10000274 Ga0105237_1000027462 303
90 3300009545 Ga0105237_10000803 Ga0105237_100008037 303
91 3300009545 Ga0105237_10001914 Ga0105237_100019146 303
92 3300009545 Ga0105237_10064483 Ga0105237_100644832 303
93 3300009545 Ga0105237_10066228 Ga0105237_100662283 303
94 3300009545 Ga0105237_10080771 Ga0105237_100807714 303
95 3300009545 Ga0105237_10161218 Ga0105237_101612182 303
96 3300009551 Ga0105238_10002195 Ga0105238_100021956 303
97 3300010375 Ga0105239_10000013 Ga0105239_1000001327 303
98 3300010375 Ga0105239_10001207 Ga0105239_1000120719 303
99 3300010375 Ga0105239_10005491 Ga0105239_100054919 303
100 3300010375 Ga0105239_10012287 Ga0105239_100122872 303
101 3300010375 Ga0105239_10025930 Ga0105239_100259301 303
102 3300010375 Ga0105239_10036215 Ga0105239_100362154 303
103 3300010375 Ga0105239_10052523 Ga0105239_100525232 303
104 3300010375 Ga0105239_10061388 Ga0105239_100613882 303
105 3300010375 Ga0105239_10368875 Ga0105239_103688752 303
106 3300011119 Ga0105246_10020949 Ga0105246_100209493 303
107 3300013100 Ga0157373_10001101 Ga0157373_1000110115 303
108 3300013100 Ga0157373_10003455 Ga0157373_100034555 303
109 3300013102 Ga0157371_10006726 Ga0157371_100067264 303
110 3300013102 Ga0157371_10021642 Ga0157371_100216425 303
111 3300013102 Ga0157371_10026888 Ga0157371_100268883 303
112 3300013102 Ga0157371_10048438 Ga0157371_100484382 303
113 3300013104 Ga0157370_10037159 Ga0157370_100371593 303
114 3300013104 Ga0157370_10068672 Ga0157370_100686723 303
115 3300013104 Ga0157370_10154825 Ga0157370_101548253 303
116 3300013105 Ga0157369_10004541 Ga0157369_100045419 303
117 3300013105 Ga0157369_10141494 Ga0157369_101414942 303
118 3300013296 Ga0157374_10000349 Ga0157374_1000034923 303
119 3300013296 Ga0157374_10000950 Ga0157374_1000095015 303
120 3300013296 Ga0157374_10005211 Ga0157374_100052119 303
121 3300013297 Ga0157378_10007782 Ga0157378_100077822 303
122 3300013306 Ga0163162_10000066 Ga0163162_1000006616 303
123 3300013306 Ga0163162_10004715 Ga0163162_100047159 303
124 3300013306 Ga0163162_10646207 Ga0163162_106462071 303
125 3300013307 Ga0157372_10000001 Ga0157372_10000001368 303
126 3300013307 Ga0157372_10000730 Ga0157372_1000073023 303
127 3300013307 Ga0157372_10002233 Ga0157372_100022338 303
128 3300013307 Ga0157372_10003847 Ga0157372_100038475 303
129 3300013307 Ga0157372_10270438 Ga0157372_102704382 303
130 3300013307 Ga0157372_10332598 Ga0157372_103325982 303
131 3300013308 Ga0157375_10006708 Ga0157375_100067084 303
132 3300013308 Ga0157375_10032139 Ga0157375_100321393 303
133 3300021361 Ga0213872_10025117 Ga0213872_100251173 303
134 3300025231 Ga0207427_101537 Ga0207427_1015378 303
135 3300025233 Ga0209437_100017 Ga0209437_100017160 303
136 3300025233 Ga0209437_100052 Ga0209437_100052300 303
137 3300025250 Ga0209026_1001668 Ga0209026_10016687 303
138 3300025258 Ga0209129_1007615 Ga0209129_10076152 303
139 3300025261 Ga0209233_1000067 Ga0209233_1000067300 303
140 3300025261 Ga0209233_1002062 Ga0209233_10020627 303
141 3300025272 Ga0209455_1008726 Ga0209455_10087263 303
142 3300025904 Ga0207647_10000665 Ga0207647_100006657 303
143 3300025904 Ga0207647_10003255 Ga0207647_100032555 303
144 3300025904 Ga0207647_10147474 Ga0207647_101474742 303
145 3300025907 Ga0207645_10000131 Ga0207645_1000013116 303
146 3300025909 Ga0207705_10000015 Ga0207705_10000015232 303
147 3300025909 Ga0207705_10243032 Ga0207705_102430321 303
148 3300025911 Ga0207654_10002510 Ga0207654_100025106 303
149 3300025911 Ga0207654_10044555 Ga0207654_100445553 303
150 3300025912 Ga0207707_10127994 Ga0207707_101279942 303
151 3300025913 Ga0207695_10000131 Ga0207695_1000013162 303
152 3300025913 Ga0207695_10003136 Ga0207695_1000313617 303
153 3300025913 Ga0207695_10019218 Ga0207695_100192184 303
154 3300025913 Ga0207695_10032091 Ga0207695_100320913 303
155 3300025913 Ga0207695_10093009 Ga0207695_100930092 303
156 3300025913 Ga0207695_10131687 Ga0207695_101316873 303
157 3300025914 Ga0207671_10000787 Ga0207671_1000078735 303
158 3300025914 Ga0207671_10004792 Ga0207671_100047927 303
159 3300025914 Ga0207671_10005774 Ga0207671_100057741 303
160 3300025914 Ga0207671_10082308 Ga0207671_100823082 303
161 3300025921 Ga0207652_10002395 Ga0207652_100023952 303
162 3300025924 Ga0207694_10075375 Ga0207694_100753752 303
163 3300025931 Ga0207644_10003897 Ga0207644_100038975 303
164 3300025932 Ga0207690_10008351 Ga0207690_100083514 303
165 3300025933 Ga0207706_10000126 Ga0207706_1000012660 303
166 3300025934 Ga0207686_10065545 Ga0207686_100655452 303
167 3300025938 Ga0207704_10000109 Ga0207704_1000010914 303
168 3300025949 Ga0207667_10000020 Ga0207667_10000020180 303
169 3300025949 Ga0207667_10001127 Ga0207667_1000112717 303
170 3300025949 Ga0207667_10005980 Ga0207667_100059804 303
171 3300025949 Ga0207667_10019556 Ga0207667_100195566 303
172 3300025949 Ga0207667_10057566 Ga0207667_100575664 303
173 3300025949 Ga0207667_10207317 Ga0207667_102073172 303
174 3300026023 Ga0207677_10010526 Ga0207677_100105266 303
175 3300026041 Ga0207639_10005541 Ga0207639_100055413 303
176 3300026041 Ga0207639_10052686 Ga0207639_100526862 303
177 3300026067 Ga0207678_10008598 Ga0207678_100085987 303
178 3300026078 Ga0207702_10001532 Ga0207702_1000153221 303
179 3300026078 Ga0207702_10012211 Ga0207702_100122114 303
180 3300026078 Ga0207702_10138237 Ga0207702_101382373 303
181 3300026078 Ga0207702_10141006 Ga0207702_101410063 303
182 3300026089 Ga0207648_10000155 Ga0207648_1000015569 303
183 3300026121 Ga0207683_10016615 Ga0207683_100166153 303
184 3300026142 Ga0207698_10012144 Ga0207698_100121447 303
185 3300028379 Ga0268266_10000052 Ga0268266_1000005258 303
186 3300028786 Ga0307517_10045196 Ga0307517_100451965 303
187 3300028794 Ga0307515_10000794 Ga0307515_100007944 303
188 3300028794 Ga0307515_10014388 Ga0307515_100143881 303
189 3300033179 Ga0307507_10000064 Ga0307507_100000648 303
190 3300033180 Ga0307510_10032848 Ga0307510_100328484 303
191 3300037312 Ga0395899_0000001 Ga0395899_0000001_1624457_1625374 303
192 3300037312 Ga0395899_0000435 Ga0395899_0000435_23547_24458 303
193 3300037312 Ga0395899_0004805 Ga0395899_0004805_1034_1951 303
194 3300037418 Ga0395900_0000014 Ga0395900_0000014_7869_8786 303
195 3300037418 Ga0395900_0000873 Ga0395900_0000873_13106_14017 303
196 3300037418 Ga0395900_0037412 Ga0395900_0037412_2023_2943 303
197 3300037466 Ga0395898_0111571 Ga0395898_0111571_1069_1986 303
198 3300037471 Ga0395905_0000037 Ga0395905_0000037_7859_8776 303
199 3300037471 Ga0395905_0000516 Ga0395905_0000516_34145_35065 303
200 3300038443 Ga0395901_0000166 Ga0395901_0000166_7723_8640 303
201 3300039447 Ga0436361_0818974 Ga0436361_0818974_384_1298 303
202 3300044656 Ga0466969_0026733 Ga0466969_0026733_709_1620 303
203 3300044693 Ga0466961_0049499 Ga0466961_0049499_1541_2452 303
204 3300045049 Ga0466959_0113693 Ga0466959_0113693_132_1046 303
205 3300046471 Ga0495650_0000003 Ga0495650_0000003_713180_714094 303
206 3300046492 Ga0495585_0000079 Ga0495585_0000079_28497_29411 303
207 3300046507 Ga0495606_0000163 Ga0495606_0000163_2613_3527 303
208 3300046512 Ga0495610_0032802 Ga0495610_0032802_1298_2212 303
209 3300046513 Ga0495616_0003711 Ga0495616_0003711_2105_3019 303
210 3300046518 Ga0495631_0018817 Ga0495631_0018817_2201_3115 303
211 3300046523 Ga0495644_0003838 Ga0495644_0003838_859_1773 303
212 3300046524 Ga0495648_0032230 Ga0495648_0032230_36_950 303
213 3300046529 Ga0495652_0061195 Ga0495652_0061195_510_1424 303
214 3300046538 Ga0495609_0047445 Ga0495609_0047445_434_1348 303
215 3300046558 Ga0495633_0000056 Ga0495633_0000056_69980_70894 303
216 3300046558 Ga0495633_0016933 Ga0495633_0016933_302_1216 303
217 3300046616 Ga0495668_0091494 Ga0495668_0091494_85_999 303
218 3300046660 Ga0495625_0000159 Ga0495625_0000159_49670_50584 303
219 3300046660 Ga0495625_0003717 Ga0495625_0003717_13562_14476 303
220 3300046660 Ga0495625_0022826 Ga0495625_0022826_111_1022 303
221 3300046660 Ga0495625_0056927 Ga0495625_0056927_269_1183 303
222 3300046660 Ga0495625_0340745 Ga0495625_0340745_11_925 303
223 3300046665 Ga0495661_0001324 Ga0495661_0001324_12084_13001 303
224 3300046665 Ga0495661_0124868 Ga0495661_0124868_38_952 303
225 3300046694 Ga0495649_0000003 Ga0495649_0000003_830230_831144 303
226 3300046810 Ga0495660_0041353 Ga0495660_0041353_238_1152 303
227 3300047443 Ga0495687_000527 Ga0495687_000527_4788_5705 303
228 3300047443 Ga0495687_001555 Ga0495687_001555_19246_20160 303
229 3300047469 Ga0495673_0033768 Ga0495673_0033768_406_1320 303
230 3300047472 Ga0495686_0000160 Ga0495686_0000160_102589_103503 303
231 3300047472 Ga0495686_0002432 Ga0495686_0002432_13316_14227 303
232 3300047472 Ga0495686_0109074 Ga0495686_0109074_618_1535 303
233 3300048089 Ga0495614_0011137 Ga0495614_0011137_1391_2305 303
234 3300048918 Ga0496115_0438043 Ga0496115_0438043_116_1027 303
235 3300049663 Ga0501223_004313 Ga0501223_004313_390_1301 303
236 3300050493 nmdc:mga0k408_111_c1 nmdc:mga0k408_111_c1_10527_11438 303
237 3300050493 nmdc:mga0k408_88_c1 nmdc:mga0k408_88_c1_3428_4342 303
238 3300053098 Ga0500650_0083606 Ga0500650_0083606_179_1093 303
239 3300053125 Ga0500618_000003 Ga0500618_000003_77290_78204 303
240 3300053125 Ga0500618_020218 Ga0500618_020218_429_1343 303
241 3300053156 Ga0500622_0001498 Ga0500622_0001498_8275_9186 303
242 3300053161 Ga0500634_0052812 Ga0500634_0052812_954_1868 303

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

18

148

0.83

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

31

159

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y44-assembly1.cif.gz_A crystal structure of rnase z 0.9154 4 303
2fk6-assembly1.cif.gz_A-2 crystal structure of rnase z/trna(thr) complex 0.9042 4 303
2cbn-assembly1.cif.gz_A-2 crystal structure of zipd from escherichia coli 0.9002 3 303
1y44-assembly1.cif.gz_A crystal structure of rnase z 0.8989 4 303
4gcw-assembly1.cif.gz_A crystal structure of rnase z in complex with precursor trna(thr) 0.8961 4 303
ID Description Score Start End Superfamily
af_D3ZB91_3_360_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.923 4 303 3.60.15.10
af_P0A8V0_1_305_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9174 4 303 3.60.15.10
af_D3ZB91_3_360_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9114 4 303 3.60.15.10
af_P0A8V0_1_305_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9059 4 303 3.60.15.10
af_Q2FY67_1_306_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8583 4 303 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A353A364-F1-model_v4 Ribonuclease Z 0.9884 220 303 GO:0042781
AF-A0A151EP05-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9796 220 303 GO:0042781
AF-A0A838F389-F1-model_v4 Ribonuclease Z (RNase Z) (EC 3.1.26.11) (tRNA 3 endonuclease) (tRNase Z) 0.9758 1 303 GO:0008270
GO:0042781
AF-A0A7Y3RXC7-F1-model_v4 deleted 0.9738 1 303
AF-A0A838F389-F1-model_v4 Ribonuclease Z (RNase Z) (EC 3.1.26.11) (tRNA 3 endonuclease) (tRNase Z) 0.9726 1 303 GO:0008270
GO:0042781

Feature Viewer

pLDDT pTM Quality
92.35 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map