F354282
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 242 | 158 | 225 | 477 |
Family's Representative Sequence
| Representative Sequence | 3300003316|rootH1_10003434|rootH1_100034342 |
| Length | 521 |
| Sequence | MLQPEDAVFIYVGSRFCVLLRFHKKFARFAEKQHWDAIQSMKITTIMKKIILGSVLLISMLCLVNAAAAQGNIHQQSTTYQWPTDPMVKEKLETWRDQKFGMIIHWGLYAVPGIIESWALCSEDWIERDSTMAYDDFKKWYWGLSKQFNPTWAQAAKDAGMRYLVFTTKHHDGFNMFDTKQTDFKITNGPFASNPRANVAKYIFEAFRKQNMMIGAYYSKPDWHTEYYWWPKYATADRNVNYDIRKNPWRWNKFKEFTYNQISELTHDYGKIDILWLDGGWVRPLETVTDEVRAWGAAIPAWSQDIDMPRIASMARSAQPGLLIVDRTVHGPYENYQTPEQSIPKEKLDNPWESCITLGGAWGYVPNDRFKSSARVIHTLIEVVAKGGSLLLGVGPTPEGTFTQEQIDRLKSVGQWLQQNGAAIYSTRPADNYYDQASDTYFTTGKNKEIYALVRLKEGASIPATVSWSGNVPAKGTTMKLLSTGTTVKWKKEGDKVIVQLPASFIKKYQAYPALAFSFQP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 3 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 4 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 5 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 6 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 7 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 8 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 9 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 10 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 11 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 12 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 13 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 14 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 15 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 16 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 17 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 18 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 19 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 20 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 21 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 22 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 23 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 24 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 25 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 52 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 53 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 71 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 73 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 74 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 77 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 105 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 106 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 107 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 108 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 109 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 110 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 111 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 112 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 113 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 114 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 115 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 116 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 117 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 118 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 119 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 120 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 121 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 122 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 123 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 124 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 125 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 126 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 127 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 128 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 129 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 137 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 138 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 139 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 145 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 146 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 147 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 148 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 151 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 152 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 153 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 154 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 155 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 156 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 157 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 158 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.98 |
| Metatranscriptomes | 0 |
| Isolates | 7.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.09 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 77.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3444455 | 2162886007 | Bacteria | 3743 |
| 2 | SwRhRL2b_contig_677705 | 2162886007 | Bacteria | 7312 |
| 3 | JGI25152J39213_1000697 | 3300002773 | Bacteria | 17459 |
| 4 | JGI25150J39212_1000001 | 3300002774 | Bacteria | 1318726 |
| 5 | JGI25151J46595_10000001 | 3300003187 | Bacteria | 887211 |
| 6 | JGI25153J46596_10000001 | 3300003215 | Bacteria | 748985 |
| 7 | rootH1_10003434 | 3300003316 | Bacteria | 4265 |
| 8 | rootH1_10079219 | 3300003316 | Bacteria | 2282 |
| 9 | rootH2_10014083 | 3300003320 | Bacteria | 56189 |
| 10 | rootH2_10076262 | 3300003320 | Bacteria | 8102 |
| 11 | rootL2_10026564 | 3300003322 | Bacteria | 3260 |
| 12 | rootL2_10026565 | 3300003322 | Bacteria | 6949 |
| 13 | rootL2_10175409 | 3300003322 | Bacteria | 3927 |
| 14 | rootH1_10000536 | 3300003323 | Bacteria | 87102 |
| 15 | rootH1_10017445 | 3300003323 | Bacteria | 9560 |
| 16 | rootH1_10018108 | 3300003323 | Bacteria | 7875 |
| 17 | rootH1_10105979 | 3300003323 | Bacteria | 2474 |
| 18 | Ga0065165_1001255 | 3300005262 | Bacteria | 28742 |
| 19 | Ga0065714_10003276 | 3300005288 | Bacteria | 14932 |
| 20 | Ga0065714_10004154 | 3300005288 | Bacteria | 7545 |
| 21 | Ga0065714_10009231 | 3300005288 | Bacteria | 2851 |
| 22 | Ga0065704_10070305 | 3300005289 | Bacteria | 36252 |
| 23 | Ga0065704_10074471 | 3300005289 | Bacteria | 6250 |
| 24 | Ga0065704_10078005 | 3300005289 | Bacteria | 4554 |
| 25 | Ga0070670_100013781 | 3300005331 | Bacteria | 6929 |
| 26 | Ga0070670_100081703 | 3300005331 | Bacteria | 2776 |
| 27 | Ga0070680_100000066 | 3300005336 | Bacteria | 55257 |
| 28 | Ga0070682_100000455 | 3300005337 | Bacteria | 25816 |
| 29 | Ga0068868_100130832 | 3300005338 | Bacteria | 2053 |
| 30 | Ga0070691_10064959 | 3300005341 | Bacteria | 1761 |
| 31 | Ga0070668_100087626 | 3300005347 | Bacteria | 2450 |
| 32 | Ga0070671_100002666 | 3300005355 | Bacteria | 13832 |
| 33 | Ga0070671_100020872 | 3300005355 | Bacteria | 5343 |
| 34 | Ga0070674_100018123 | 3300005356 | Bacteria | 4444 |
| 35 | Ga0070667_100003552 | 3300005367 | Bacteria | 13290 |
| 36 | Ga0070667_100043651 | 3300005367 | Bacteria | 3763 |
| 37 | Ga0070681_10005301 | 3300005458 | Bacteria | 12452 |
| 38 | Ga0070698_100040027 | 3300005471 | Bacteria | 4819 |
| 39 | Ga0070679_100000973 | 3300005530 | Bacteria | 24934 |
| 40 | Ga0068855_100009186 | 3300005563 | Bacteria | 11937 |
| 41 | Ga0070702_100003324 | 3300005615 | Bacteria | 7175 |
| 42 | Ga0068859_100000012 | 3300005617 | Bacteria | 300376 |
| 43 | Ga0068859_100003516 | 3300005617 | Bacteria | 15952 |
| 44 | Ga0068859_100211237 | 3300005617 | Bacteria | 2027 |
| 45 | Ga0068864_100006045 | 3300005618 | Bacteria | 9938 |
| 46 | Ga0068866_10016215 | 3300005718 | Bacteria | 3327 |
| 47 | Ga0068863_100008374 | 3300005841 | Bacteria | 10098 |
| 48 | Ga0068858_100016927 | 3300005842 | Bacteria | 6845 |
| 49 | Ga0068860_100004050 | 3300005843 | Bacteria | 15046 |
| 50 | Ga0075366_10036807 | 3300006195 | Bacteria | 2886 |
| 51 | Ga0068871_100020522 | 3300006358 | Bacteria | 5063 |
| 52 | Ga0068871_100122764 | 3300006358 | Bacteria | 2196 |
| 53 | Ga0075430_100070092 | 3300006846 | Bacteria | 2940 |
| 54 | Ga0075431_100192786 | 3300006847 | Bacteria | 2088 |
| 55 | Ga0097620_100000012 | 3300006931 | Bacteria | 300376 |
| 56 | Ga0097620_100003516 | 3300006931 | Bacteria | 15952 |
| 57 | Ga0097620_100211221 | 3300006931 | Bacteria | 2027 |
| 58 | Ga0105240_10022628 | 3300009093 | Bacteria | 8327 |
| 59 | Ga0105247_10025782 | 3300009101 | Bacteria | 3548 |
| 60 | Ga0114129_10050064 | 3300009147 | Bacteria | 5869 |
| 61 | Ga0114129_10070431 | 3300009147 | Bacteria | 4877 |
| 62 | Ga0105241_10000144 | 3300009174 | Bacteria | 50819 |
| 63 | Ga0105241_10001105 | 3300009174 | Bacteria | 20534 |
| 64 | Ga0105237_10000725 | 3300009545 | Bacteria | 45577 |
| 65 | Ga0105237_10001463 | 3300009545 | Bacteria | 31112 |
| 66 | Ga0105237_10007256 | 3300009545 | Bacteria | 12157 |
| 67 | Ga0105237_10073704 | 3300009545 | Bacteria | 3406 |
| 68 | Ga0105249_10012219 | 3300009553 | Bacteria | 7563 |
| 69 | Ga0105239_10000696 | 3300010375 | Bacteria | 47844 |
| 70 | Ga0105239_10041211 | 3300010375 | Bacteria | 5060 |
| 71 | Ga0105239_10117875 | 3300010375 | Unclassified | 2946 |
| 72 | Ga0105246_10035205 | 3300011119 | Bacteria | 3345 |
| 73 | Ga0105246_10151041 | 3300011119 | Bacteria | 1758 |
| 74 | Ga0157373_10001610 | 3300013100 | Bacteria | 17242 |
| 75 | Ga0157373_10023239 | 3300013100 | Bacteria | 4496 |
| 76 | Ga0157373_10026785 | 3300013100 | Bacteria | 4161 |
| 77 | Ga0157371_10000074 | 3300013102 | Bacteria | 162988 |
| 78 | Ga0157371_10002408 | 3300013102 | Bacteria | 17899 |
| 79 | Ga0157371_10011401 | 3300013102 | Bacteria | 6853 |
| 80 | Ga0157370_10000241 | 3300013104 | Bacteria | 69817 |
| 81 | Ga0157370_10002624 | 3300013104 | Bacteria | 21610 |
| 82 | Ga0157370_10005449 | 3300013104 | Bacteria | 14275 |
| 83 | Ga0157370_10006627 | 3300013104 | Bacteria | 12725 |
| 84 | Ga0157370_10020516 | 3300013104 | Bacteria | 6598 |
| 85 | Ga0157370_10036503 | 3300013104 | Bacteria | 4768 |
| 86 | Ga0157370_10044481 | 3300013104 | Bacteria | 4267 |
| 87 | Ga0157370_10203823 | 3300013104 | Bacteria | 1834 |
| 88 | Ga0157369_10000031 | 3300013105 | Bacteria | 203214 |
| 89 | Ga0157378_10009577 | 3300013297 | Bacteria | 8435 |
| 90 | Ga0157378_10021166 | 3300013297 | Bacteria | 5720 |
| 91 | Ga0157378_10124133 | 3300013297 | Bacteria | 2383 |
| 92 | Ga0163162_10000279 | 3300013306 | Bacteria | 46872 |
| 93 | Ga0157372_10369799 | 3300013307 | Bacteria | 1671 |
| 94 | Ga0157375_10044863 | 3300013308 | Bacteria | 4300 |
| 95 | Ga0157375_10232035 | 3300013308 | Bacteria | 2004 |
| 96 | Ga0182008_10000014 | 3300014497 | Bacteria | 263844 |
| 97 | Ga0182008_10000048 | 3300014497 | Bacteria | 105176 |
| 98 | Ga0182008_10000100 | 3300014497 | Bacteria | 66862 |
| 99 | Ga0157376_10048569 | 3300014969 | Bacteria | 3510 |
| 100 | Ga0182006_1000178 | 3300015261 | Bacteria | 66897 |
| 101 | Ga0182006_1000670 | 3300015261 | Bacteria | 24076 |
| 102 | Ga0182006_1000697 | 3300015261 | Bacteria | 23266 |
| 103 | Ga0182006_1006300 | 3300015261 | Bacteria | 5529 |
| 104 | Ga0182007_10000002 | 3300015262 | Bacteria | 564661 |
| 105 | Ga0163161_10000279 | 3300017792 | Bacteria | 44617 |
| 106 | Ga0163161_10000297 | 3300017792 | Bacteria | 43454 |
| 107 | Ga0163161_10000310 | 3300017792 | Bacteria | 42437 |
| 108 | Ga0163161_10001038 | 3300017792 | Bacteria | 21157 |
| 109 | Ga0163161_10002044 | 3300017792 | Bacteria | 14612 |
| 110 | Ga0163161_10006202 | 3300017792 | Bacteria | 8285 |
| 111 | Ga0207425_1000002 | 3300025245 | Bacteria | 1362590 |
| 112 | Ga0209646_1001395 | 3300025246 | Bacteria | 6610 |
| 113 | Ga0209129_1000002 | 3300025258 | Bacteria | 1359086 |
| 114 | Ga0209025_1000004 | 3300025294 | Bacteria | 1361782 |
| 115 | Ga0209758_1000006 | 3300025297 | Bacteria | 1359562 |
| 116 | Ga0209050_1008925 | 3300025298 | Bacteria | 5235 |
| 117 | Ga0207710_10032196 | 3300025900 | Bacteria | 2296 |
| 118 | Ga0207654_10000765 | 3300025911 | Bacteria | 17701 |
| 119 | Ga0207654_10002914 | 3300025911 | Bacteria | 8672 |
| 120 | Ga0207707_10000317 | 3300025912 | Bacteria | 50861 |
| 121 | Ga0207695_10007582 | 3300025913 | Bacteria | 13759 |
| 122 | Ga0207671_10004439 | 3300025914 | Bacteria | 13417 |
| 123 | Ga0207671_10009921 | 3300025914 | Bacteria | 7914 |
| 124 | Ga0207660_10001972 | 3300025917 | Bacteria | 13679 |
| 125 | Ga0207652_10000456 | 3300025921 | Bacteria | 42137 |
| 126 | Ga0207650_10027246 | 3300025925 | Bacteria | 4088 |
| 127 | Ga0207650_10120628 | 3300025925 | Bacteria | 2041 |
| 128 | Ga0207644_10022825 | 3300025931 | Bacteria | 4278 |
| 129 | Ga0207686_10039679 | 3300025934 | Bacteria | 2858 |
| 130 | Ga0207669_10015668 | 3300025937 | Unclassified | 3830 |
| 131 | Ga0207689_10000329 | 3300025942 | Bacteria | 44014 |
| 132 | Ga0207667_10021003 | 3300025949 | Bacteria | 7241 |
| 133 | Ga0207668_10163612 | 3300025972 | Bacteria | 1737 |
| 134 | Ga0207658_10164247 | 3300025986 | Bacteria | 1822 |
| 135 | Ga0207677_10041109 | 3300026023 | Bacteria | 3054 |
| 136 | Ga0207703_10001495 | 3300026035 | Bacteria | 21327 |
| 137 | Ga0207639_10015497 | 3300026041 | Bacteria | 5380 |
| 138 | Ga0207641_10000152 | 3300026088 | Bacteria | 98311 |
| 139 | Ga0207641_10013432 | 3300026088 | Bacteria | 6716 |
| 140 | Ga0207648_10021859 | 3300026089 | Bacteria | 5748 |
| 141 | Ga0207676_10013858 | 3300026095 | Bacteria | 5788 |
| 142 | Ga0207675_100082377 | 3300026118 | Bacteria | 3017 |
| 143 | Ga0268264_10001955 | 3300028381 | Bacteria | 18514 |
| 144 | Ga0307515_10000039 | 3300028794 | Bacteria | 323229 |
| 145 | Ga0307515_10000250 | 3300028794 | Bacteria | 133055 |
| 146 | Ga0307513_10071356 | 3300031456 | Bacteria | 3625 |
| 147 | Ga0307514_10093361 | 3300031649 | Bacteria | 2186 |
| 148 | Ga0307405_10000006 | 3300031731 | Bacteria | 361477 |
| 149 | Ga0307407_10000031 | 3300031903 | Bacteria | 87995 |
| 150 | Ga0307412_10000043 | 3300031911 | Bacteria | 166562 |
| 151 | Ga0307412_10012522 | 3300031911 | Bacteria | 4949 |
| 152 | Ga0307416_100000002 | 3300032002 | Bacteria | 509907 |
| 153 | Ga0307414_10001658 | 3300032004 | Bacteria | 11579 |
| 154 | Ga0307414_10004228 | 3300032004 | Bacteria | 7777 |
| 155 | Ga0307414_10011430 | 3300032004 | Bacteria | 5206 |
| 156 | Ga0307414_10028297 | 3300032004 | Bacteria | 3633 |
| 157 | Ga0307414_10033232 | 3300032004 | Bacteria | 3407 |
| 158 | Ga0307414_10064295 | 3300032004 | Bacteria | 2612 |
| 159 | Ga0373935_0059491 | 3300035692 | Bacteria | 2442 |
| 160 | Ga0373925_0020259 | 3300037068 | Unclassified | 4840 |
| 161 | Ga0400483_214800 | 3300039062 | Bacteria | 7215 |
| 162 | Ga0439436_0004392 | 3300041404 | Bacteria | 4318 |
| 163 | Ga0439445_0017221 | 3300042004 | Bacteria | 1785 |
| 164 | Ga0439449_0009601 | 3300042007 | Bacteria | 3662 |
| 165 | Ga0439457_001295 | 3300042014 | Bacteria | 7507 |
| 166 | Ga0466969_0000670 | 3300044656 | Bacteria | 18584 |
| 167 | Ga0466972_0000032 | 3300044658 | Bacteria | 159445 |
| 168 | Ga0466982_0044790 | 3300044672 | Bacteria | 2692 |
| 169 | Ga0453683_0010249 | 3300044673 | Bacteria | 6214 |
| 170 | Ga0453683_0198579 | 3300044673 | Unclassified | 1273 |
| 171 | Ga0466966_0000157 | 3300044684 | Bacteria | 44093 |
| 172 | Ga0466964_0019458 | 3300044706 | Bacteria | 2609 |
| 173 | Ga0453684_0001762 | 3300044712 | Bacteria | 57774 |
| 174 | Ga0453684_0005173 | 3300044712 | Bacteria | 26244 |
| 175 | Ga0453684_0030497 | 3300044712 | Bacteria | 7616 |
| 176 | Ga0453684_0059999 | 3300044712 | Bacteria | 4898 |
| 177 | Ga0453684_0104832 | 3300044712 | Bacteria | 3450 |
| 178 | Ga0466957_0001957 | 3300044842 | Bacteria | 10950 |
| 179 | Ga0466957_0049918 | 3300044842 | Bacteria | 2545 |
| 180 | Ga0466959_0000012 | 3300045049 | Bacteria | 168961 |
| 181 | Ga0451576_0000180 | 3300045051 | Bacteria | 159491 |
| 182 | Ga0451576_0000395 | 3300045051 | Bacteria | 101608 |
| 183 | Ga0451576_0051669 | 3300045051 | Unclassified | 4309 |
| 184 | Ga0451576_0093078 | 3300045051 | Bacteria | 3134 |
| 185 | Ga0451576_0109610 | 3300045051 | Bacteria | 2873 |
| 186 | Ga0451576_0127391 | 3300045051 | Bacteria | 2653 |
| 187 | Ga0495638_0000036 | 3300046460 | Bacteria | 275731 |
| 188 | Ga0495638_0088211 | 3300046460 | Bacteria | 1873 |
| 189 | Ga0495610_0000724 | 3300046512 | Bacteria | 31376 |
| 190 | Ga0495610_0001530 | 3300046512 | Bacteria | 20374 |
| 191 | Ga0495610_0007744 | 3300046512 | Bacteria | 7089 |
| 192 | Ga0495666_0029493 | 3300046526 | Unclassified | 2699 |
| 193 | Ga0495633_0073738 | 3300046558 | Bacteria | 1591 |
| 194 | Ga0495676_0094897 | 3300047321 | Bacteria | 2221 |
| 195 | Ga0495687_001322 | 3300047443 | Bacteria | 23124 |
| 196 | Ga0495686_0013267 | 3300047472 | Bacteria | 5722 |
| 197 | Ga0495686_0061894 | 3300047472 | Unclassified | 2323 |
| 198 | Ga0496122_0001507 | 3300048925 | Bacteria | 37128 |
| 199 | Ga0496122_0004698 | 3300048925 | Bacteria | 16777 |
| 200 | Ga0496123_0009199 | 3300048926 | Bacteria | 8928 |
| 201 | Ga0501300_001884 | 3300049523 | Unclassified | 3128 |
| 202 | Ga0501034_0010116 | 3300049571 | Bacteria | 9842 |
| 203 | Ga0501034_0134453 | 3300049571 | Bacteria | 2454 |
| 204 | Ga0501037_0082237 | 3300049573 | Bacteria | 2334 |
| 205 | Ga0501043_0025918 | 3300049579 | Bacteria | 4600 |
| 206 | Ga0501047_0002831 | 3300049581 | Bacteria | 16458 |
| 207 | Ga0501067_0019994 | 3300049583 | Bacteria | 3705 |
| 208 | Ga0501217_009034 | 3300049661 | Bacteria | 2161 |
| 209 | Ga0501236_000130 | 3300049670 | Bacteria | 7374 |
| 210 | Ga0501225_0001374 | 3300049705 | Bacteria | 7588 |
| 211 | Ga0501241_000977 | 3300049758 | Bacteria | 6020 |
| 212 | Ga0501044_0006113 | 3300049823 | Bacteria | 13284 |
| 213 | nmdc:mga05p37_201505_c1 | 3300050507 | Bacteria | 2410 |
| 214 | nmdc:mga05p37_24024_c1 | 3300050507 | Bacteria | 7404 |
| 215 | Ga0500578_0000001 | 3300053086 | Bacteria | 317120 |
| 216 | Ga0500644_0010585 | 3300053088 | Bacteria | 2499 |
| 217 | Ga0500583_0000013 | 3300053092 | Bacteria | 150087 |
| 218 | Ga0500651_0001777 | 3300053093 | Bacteria | 11046 |
| 219 | Ga0500652_003892 | 3300053131 | Bacteria | 4564 |
| 220 | Ga0500568_0005871 | 3300053139 | Bacteria | 6253 |
| 221 | Ga0500616_0000004 | 3300053153 | Bacteria | 1002714 |
| 222 | Ga0500622_0000003 | 3300053156 | Bacteria | 613483 |
| 223 | Ga0500622_0000008 | 3300053156 | Bacteria | 423636 |
| 224 | Ga0500622_0003062 | 3300053156 | Bacteria | 11537 |
| 225 | Ga0500633_0000320 | 3300053160 | Bacteria | 7127 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044673 | Ga0453683_0198579 | Ga0453683_0198579_54_1259 | 386 |
| 2 | 3300044706 | Ga0466964_0019458 | Ga0466964_0019458_1346_2593 | 396 |
| 3 | 3300003323 | rootH1_10000536 | rootH1_1000053617 | 421 |
| 4 | 3300009545 | Ga0105237_10007256 | Ga0105237_1000725612 | 428 |
| 5 | 3300013104 | Ga0157370_10005449 | Ga0157370_1000544910 | 430 |
| 6 | 3300014497 | Ga0182008_10000100 | Ga0182008_1000010051 | 430 |
| 7 | 3300015261 | Ga0182006_1000670 | Ga0182006_10006709 | 430 |
| 8 | 3300017792 | Ga0163161_10002044 | Ga0163161_100020444 | 430 |
| 9 | 3300048925 | Ga0496122_0001507 | Ga0496122_0001507_19634_21037 | 430 |
| 10 | 3300048926 | Ga0496123_0009199 | Ga0496123_0009199_3094_4497 | 430 |
| 11 | 3300045051 | Ga0451576_0051669 | Ga0451576_0051669_976_2412 | 435 |
| 12 | 3300013297 | Ga0157378_10009577 | Ga0157378_100095778 | 436 |
| 13 | 3300013308 | Ga0157375_10232035 | Ga0157375_102320352 | 436 |
| 14 | 3300035692 | Ga0373935_0059491 | Ga0373935_0059491_313_1827 | 436 |
| 15 | 3300037068 | Ga0373925_0020259 | Ga0373925_0020259_586_2100 | 436 |
| 16 | 3300046526 | Ga0495666_0029493 | Ga0495666_0029493_961_2475 | 436 |
| 17 | 3300047321 | Ga0495676_0094897 | Ga0495676_0094897_56_1570 | 436 |
| 18 | 3300053092 | Ga0500583_0000013 | Ga0500583_0000013_18200_19657 | 438 |
| 19 | 3300005289 | Ga0065704_10078005 | Ga0065704_100780054 | 444 |
| 20 | 3300005355 | Ga0070671_100002666 | Ga0070671_1000026666 | 444 |
| 21 | 3300010375 | Ga0105239_10041211 | Ga0105239_100412112 | 444 |
| 22 | 3300011119 | Ga0105246_10035205 | Ga0105246_100352053 | 444 |
| 23 | 3300025931 | Ga0207644_10022825 | Ga0207644_100228252 | 444 |
| 24 | 3300044673 | Ga0453683_0010249 | Ga0453683_0010249_1697_3130 | 444 |
| 25 | 3300045051 | Ga0451576_0000180 | Ga0451576_0000180_3731_5164 | 444 |
| 26 | 3300045051 | Ga0451576_0000395 | Ga0451576_0000395_50935_52368 | 444 |
| 27 | 3300047443 | Ga0495687_001322 | Ga0495687_001322_3651_5096 | 444 |
| 28 | 3300042004 | Ga0439445_0017221 | Ga0439445_0017221_355_1770 | 446 |
| 29 | 3300049571 | Ga0501034_0134453 | Ga0501034_0134453_508_1923 | 446 |
| 30 | 3300053153 | Ga0500616_0000004 | Ga0500616_0000004_404209_405612 | 446 |
| 31 | 3300044712 | Ga0453684_0104832 | Ga0453684_0104832_287_1732 | 447 |
| 32 | 3300045051 | Ga0451576_0127391 | Ga0451576_0127391_179_1624 | 447 |
| 33 | 3300049579 | Ga0501043_0025918 | Ga0501043_0025918_453_1910 | 447 |
| 34 | 3300017792 | Ga0163161_10001038 | Ga0163161_100010387 | 448 |
| 35 | 3300044712 | Ga0453684_0059999 | Ga0453684_0059999_2777_4213 | 448 |
| 36 | 3300053131 | Ga0500652_003892 | Ga0500652_003892_1580_3061 | 448 |
| 37 | iso_pu_bacteria | 2738541283 | 2738754174 | 448 |
| 38 | 3300044656 | Ga0466969_0000670 | Ga0466969_0000670_7616_9100 | 449 |
| 39 | 3300044684 | Ga0466966_0000157 | Ga0466966_0000157_42295_43779 | 449 |
| 40 | 3300044712 | Ga0453684_0005173 | Ga0453684_0005173_6296_7777 | 449 |
| 41 | 3300045049 | Ga0466959_0000012 | Ga0466959_0000012_11116_12600 | 449 |
| 42 | 3300045051 | Ga0451576_0093078 | Ga0451576_0093078_1074_2555 | 449 |
| 43 | 3300046460 | Ga0495638_0088211 | Ga0495638_0088211_155_1720 | 449 |
| 44 | 3300041404 | Ga0439436_0004392 | Ga0439436_0004392_210_1658 | 450 |
| 45 | 3300042014 | Ga0439457_001295 | Ga0439457_001295_5329_6777 | 450 |
| 46 | 3300053160 | Ga0500633_0000320 | Ga0500633_0000320_5507_6913 | 451 |
| 47 | 3300006195 | Ga0075366_10036807 | Ga0075366_100368072 | 453 |
| 48 | 3300009147 | Ga0114129_10050064 | Ga0114129_100500643 | 453 |
| 49 | 3300050507 | nmdc:mga05p37_24024_c1 | nmdc:mga05p37_24024_c1_2110_3603 | 453 |
| 50 | 3300025298 | Ga0209050_1008925 | Ga0209050_10089252 | 455 |
| 51 | 3300031456 | Ga0307513_10071356 | Ga0307513_100713564 | 455 |
| 52 | 3300046460 | Ga0495638_0000036 | Ga0495638_0000036_214727_216163 | 455 |
| 53 | iso_pu_bacteria | 2883068021 | 2883070721 | 455 |
| 54 | iso_pu_bacteria | 2896109856 | 2896114161 | 455 |
| 55 | 3300009147 | Ga0114129_10070431 | Ga0114129_100704314 | 456 |
| 56 | 3300013105 | Ga0157369_10000031 | Ga0157369_10000031146 | 456 |
| 57 | 3300050507 | nmdc:mga05p37_201505_c1 | nmdc:mga05p37_201505_c1_599_1987 | 456 |
| 58 | 3300015262 | Ga0182007_10000002 | Ga0182007_10000002176 | 457 |
| 59 | 3300053156 | Ga0500622_0000003 | Ga0500622_0000003_562378_563772 | 457 |
| 60 | 3300053156 | Ga0500622_0000008 | Ga0500622_0000008_388780_390174 | 457 |
| 61 | 3300042007 | Ga0439449_0009601 | Ga0439449_0009601_1496_2896 | 458 |
| 62 | 3300009545 | Ga0105237_10073704 | Ga0105237_100737042 | 460 |
| 63 | 3300044842 | Ga0466957_0001957 | Ga0466957_0001957_34_1431 | 460 |
| 64 | 3300049523 | Ga0501300_001884 | Ga0501300_001884_36_1442 | 460 |
| 65 | 3300049661 | Ga0501217_009034 | Ga0501217_009034_116_1522 | 460 |
| 66 | 3300031903 | Ga0307407_10000031 | Ga0307407_1000003142 | 461 |
| 67 | 3300032002 | Ga0307416_100000002 | Ga0307416_100000002163 | 461 |
| 68 | 3300032004 | Ga0307414_10028297 | Ga0307414_100282972 | 461 |
| 69 | 3300031911 | Ga0307412_10012522 | Ga0307412_100125223 | 463 |
| 70 | 3300032004 | Ga0307414_10004228 | Ga0307414_100042284 | 463 |
| 71 | 3300003316 | rootH1_10003434 | rootH1_100034342 | 464 |
| 72 | 3300003320 | rootH2_10014083 | rootH2_1001408327 | 464 |
| 73 | 3300003322 | rootL2_10026564 | rootL2_100265642 | 464 |
| 74 | 3300003323 | rootH1_10017445 | rootH1_100174455 | 464 |
| 75 | 3300053086 | Ga0500578_0000001 | Ga0500578_0000001_208792_210264 | 465 |
| 76 | 3300005262 | Ga0065165_1001255 | Ga0065165_100125513 | 466 |
| 77 | 3300046512 | Ga0495610_0000724 | Ga0495610_0000724_20373_21797 | 466 |
| 78 | 3300046512 | Ga0495610_0001530 | Ga0495610_0001530_14205_15644 | 466 |
| 79 | 3300049705 | Ga0501225_0001374 | Ga0501225_0001374_562_2001 | 466 |
| 80 | 3300053088 | Ga0500644_0010585 | Ga0500644_0010585_782_2221 | 466 |
| 81 | 3300053156 | Ga0500622_0003062 | Ga0500622_0003062_3844_5253 | 466 |
| 82 | iso_pu_bacteria | 2738541278 | 2738728791 | 466 |
| 83 | iso_pu_bacteria | 2739367663 | 2739647044 | 466 |
| 84 | 3300053139 | Ga0500568_0005871 | Ga0500568_0005871_219_1643 | 467 |
| 85 | iso_pu_bacteria | 2738541302 | 2738855414 | 467 |
| 86 | iso_pu_bacteria | 2739367656 | 2739614051 | 467 |
| 87 | iso_pu_bacteria | 2842722452 | 2842724019 | 467 |
| 88 | iso_pu_bacteria | 2842909656 | 2842912248 | 467 |
| 89 | 3300003323 | rootH1_10018108 | rootH1_100181088 | 468 |
| 90 | 3300044672 | Ga0466982_0044790 | Ga0466982_0044790_1081_2526 | 468 |
| 91 | iso_pu_bacteria | 2857627736 | 2857629403 | 468 |
| 92 | iso_pu_bacteria | 2919692658 | 2919693365 | 468 |
| 93 | iso_pu_bacteria | 2954016120 | 2954021621 | 468 |
| 94 | 3300005355 | Ga0070671_100020872 | Ga0070671_1000208723 | 469 |
| 95 | 3300005356 | Ga0070674_100018123 | Ga0070674_1000181232 | 469 |
| 96 | 3300005615 | Ga0070702_100003324 | Ga0070702_1000033244 | 469 |
| 97 | 3300028794 | Ga0307515_10000039 | Ga0307515_1000003985 | 469 |
| 98 | iso_pu_bacteria | 2945997725 | 2945999225 | 469 |
| 99 | 3300003322 | rootL2_10026565 | rootL2_100265654 | 470 |
| 100 | 3300003322 | rootL2_10175409 | rootL2_101754092 | 470 |
| 101 | 3300025937 | Ga0207669_10015668 | Ga0207669_100156682 | 470 |
| 102 | 3300028794 | Ga0307515_10000250 | Ga0307515_100002509 | 470 |
| 103 | 3300031649 | Ga0307514_10093361 | Ga0307514_100933612 | 470 |
| 104 | 3300032004 | Ga0307414_10011430 | Ga0307414_100114302 | 470 |
| 105 | 3300044712 | Ga0453684_0001762 | Ga0453684_0001762_1029_2471 | 470 |
| 106 | 3300049583 | Ga0501067_0019994 | Ga0501067_0019994_736_2169 | 470 |
| 107 | 3300049670 | Ga0501236_000130 | Ga0501236_000130_5309_6763 | 470 |
| 108 | iso_pu_bacteria | 2738541283 | 2738755582 | 470 |
| 109 | iso_pu_bacteria | 2738541284 | 2738764195 | 470 |
| 110 | iso_pu_bacteria | 2775506987 | 2776611974 | 470 |
| 111 | 3300002773 | JGI25152J39213_1000697 | JGI25152J39213_10006972 | 471 |
| 112 | 3300002774 | JGI25150J39212_1000001 | JGI25150J39212_1000001150 | 471 |
| 113 | 3300003187 | JGI25151J46595_10000001 | JGI25151J46595_10000001645 | 471 |
| 114 | 3300003215 | JGI25153J46596_10000001 | JGI25153J46596_10000001534 | 471 |
| 115 | 3300003316 | rootH1_10079219 | rootH1_100792193 | 471 |
| 116 | 3300003320 | rootH2_10076262 | rootH2_100762625 | 471 |
| 117 | 3300005288 | Ga0065714_10003276 | Ga0065714_100032767 | 471 |
| 118 | 3300005331 | Ga0070670_100013781 | Ga0070670_1000137814 | 471 |
| 119 | 3300005331 | Ga0070670_100081703 | Ga0070670_1000817032 | 471 |
| 120 | 3300005336 | Ga0070680_100000066 | Ga0070680_10000006627 | 471 |
| 121 | 3300005337 | Ga0070682_100000455 | Ga0070682_10000045518 | 471 |
| 122 | 3300005338 | Ga0068868_100130832 | Ga0068868_1001308322 | 471 |
| 123 | 3300005341 | Ga0070691_10064959 | Ga0070691_100649591 | 471 |
| 124 | 3300005347 | Ga0070668_100087626 | Ga0070668_1000876263 | 471 |
| 125 | 3300005367 | Ga0070667_100003552 | Ga0070667_1000035527 | 471 |
| 126 | 3300005367 | Ga0070667_100043651 | Ga0070667_1000436513 | 471 |
| 127 | 3300005458 | Ga0070681_10005301 | Ga0070681_100053017 | 471 |
| 128 | 3300005530 | Ga0070679_100000973 | Ga0070679_10000097318 | 471 |
| 129 | 3300005617 | Ga0068859_100000012 | Ga0068859_100000012157 | 471 |
| 130 | 3300005617 | Ga0068859_100003516 | Ga0068859_10000351616 | 471 |
| 131 | 3300005618 | Ga0068864_100006045 | Ga0068864_1000060451 | 471 |
| 132 | 3300005841 | Ga0068863_100008374 | Ga0068863_1000083749 | 471 |
| 133 | 3300005842 | Ga0068858_100016927 | Ga0068858_1000169272 | 471 |
| 134 | 3300005843 | Ga0068860_100004050 | Ga0068860_1000040504 | 471 |
| 135 | 3300006358 | Ga0068871_100122764 | Ga0068871_1001227644 | 471 |
| 136 | 3300006931 | Ga0097620_100000012 | Ga0097620_100000012157 | 471 |
| 137 | 3300006931 | Ga0097620_100003516 | Ga0097620_10000351616 | 471 |
| 138 | 3300009093 | Ga0105240_10022628 | Ga0105240_100226284 | 471 |
| 139 | 3300009101 | Ga0105247_10025782 | Ga0105247_100257825 | 471 |
| 140 | 3300009174 | Ga0105241_10000144 | Ga0105241_1000014418 | 471 |
| 141 | 3300009174 | Ga0105241_10001105 | Ga0105241_100011052 | 471 |
| 142 | 3300009545 | Ga0105237_10000725 | Ga0105237_1000072539 | 471 |
| 143 | 3300009553 | Ga0105249_10012219 | Ga0105249_100122192 | 471 |
| 144 | 3300010375 | Ga0105239_10117875 | Ga0105239_101178751 | 471 |
| 145 | 3300013100 | Ga0157373_10023239 | Ga0157373_100232393 | 471 |
| 146 | 3300013104 | Ga0157370_10006627 | Ga0157370_100066273 | 471 |
| 147 | 3300013297 | Ga0157378_10124133 | Ga0157378_101241332 | 471 |
| 148 | 3300013306 | Ga0163162_10000279 | Ga0163162_100002798 | 471 |
| 149 | 3300013307 | Ga0157372_10369799 | Ga0157372_103697991 | 471 |
| 150 | 3300013308 | Ga0157375_10044863 | Ga0157375_100448632 | 471 |
| 151 | 3300014969 | Ga0157376_10048569 | Ga0157376_100485692 | 471 |
| 152 | 3300015261 | Ga0182006_1000697 | Ga0182006_100069710 | 471 |
| 153 | 3300017792 | Ga0163161_10000279 | Ga0163161_1000027920 | 471 |
| 154 | 3300017792 | Ga0163161_10006202 | Ga0163161_100062025 | 471 |
| 155 | 3300025245 | Ga0207425_1000002 | Ga0207425_10000021011 | 471 |
| 156 | 3300025258 | Ga0209129_1000002 | Ga0209129_10000021011 | 471 |
| 157 | 3300025294 | Ga0209025_1000004 | Ga0209025_1000004180 | 471 |
| 158 | 3300025297 | Ga0209758_1000006 | Ga0209758_1000006180 | 471 |
| 159 | 3300025900 | Ga0207710_10032196 | Ga0207710_100321962 | 471 |
| 160 | 3300025911 | Ga0207654_10000765 | Ga0207654_100007659 | 471 |
| 161 | 3300025911 | Ga0207654_10002914 | Ga0207654_100029149 | 471 |
| 162 | 3300025912 | Ga0207707_10000317 | Ga0207707_1000031729 | 471 |
| 163 | 3300025913 | Ga0207695_10007582 | Ga0207695_100075829 | 471 |
| 164 | 3300025914 | Ga0207671_10004439 | Ga0207671_100044393 | 471 |
| 165 | 3300025917 | Ga0207660_10001972 | Ga0207660_100019724 | 471 |
| 166 | 3300025921 | Ga0207652_10000456 | Ga0207652_1000045615 | 471 |
| 167 | 3300025925 | Ga0207650_10027246 | Ga0207650_100272462 | 471 |
| 168 | 3300025925 | Ga0207650_10120628 | Ga0207650_101206281 | 471 |
| 169 | 3300025942 | Ga0207689_10000329 | Ga0207689_100003298 | 471 |
| 170 | 3300025986 | Ga0207658_10164247 | Ga0207658_101642472 | 471 |
| 171 | 3300026023 | Ga0207677_10041109 | Ga0207677_100411094 | 471 |
| 172 | 3300026035 | Ga0207703_10001495 | Ga0207703_100014954 | 471 |
| 173 | 3300026041 | Ga0207639_10015497 | Ga0207639_100154973 | 471 |
| 174 | 3300026088 | Ga0207641_10000152 | Ga0207641_1000015277 | 471 |
| 175 | 3300026088 | Ga0207641_10013432 | Ga0207641_100134324 | 471 |
| 176 | 3300026095 | Ga0207676_10013858 | Ga0207676_100138582 | 471 |
| 177 | 3300028381 | Ga0268264_10001955 | Ga0268264_1000195515 | 471 |
| 178 | 3300031731 | Ga0307405_10000006 | Ga0307405_10000006325 | 471 |
| 179 | 3300032004 | Ga0307414_10033232 | Ga0307414_100332322 | 471 |
| 180 | 3300047472 | Ga0495686_0061894 | Ga0495686_0061894_755_2197 | 471 |
| 181 | 3300049571 | Ga0501034_0010116 | Ga0501034_0010116_1113_2561 | 471 |
| 182 | 3300049573 | Ga0501037_0082237 | Ga0501037_0082237_560_2008 | 471 |
| 183 | 3300049823 | Ga0501044_0006113 | Ga0501044_0006113_10902_12350 | 471 |
| 184 | 3300005471 | Ga0070698_100040027 | Ga0070698_1000400271 | 472 |
| 185 | 3300006358 | Ga0068871_100020522 | Ga0068871_1000205223 | 472 |
| 186 | 3300006846 | Ga0075430_100070092 | Ga0075430_1000700923 | 472 |
| 187 | 3300006847 | Ga0075431_100192786 | Ga0075431_1001927861 | 472 |
| 188 | 3300011119 | Ga0105246_10151041 | Ga0105246_101510411 | 472 |
| 189 | 3300013102 | Ga0157371_10000074 | Ga0157371_10000074104 | 472 |
| 190 | 3300013104 | Ga0157370_10002624 | Ga0157370_100026244 | 472 |
| 191 | 3300013104 | Ga0157370_10036503 | Ga0157370_100365033 | 472 |
| 192 | 3300013104 | Ga0157370_10044481 | Ga0157370_100444812 | 472 |
| 193 | 3300013104 | Ga0157370_10203823 | Ga0157370_102038231 | 472 |
| 194 | 3300013297 | Ga0157378_10021166 | Ga0157378_100211662 | 472 |
| 195 | 3300017792 | Ga0163161_10000310 | Ga0163161_100003107 | 472 |
| 196 | 3300025246 | Ga0209646_1001395 | Ga0209646_10013953 | 472 |
| 197 | 3300032004 | Ga0307414_10064295 | Ga0307414_100642952 | 472 |
| 198 | 3300044658 | Ga0466972_0000032 | Ga0466972_0000032_49888_51360 | 472 |
| 199 | 3300044842 | Ga0466957_0049918 | Ga0466957_0049918_801_2273 | 472 |
| 200 | 3300046512 | Ga0495610_0007744 | Ga0495610_0007744_2176_3600 | 472 |
| 201 | 3300046558 | Ga0495633_0073738 | Ga0495633_0073738_121_1545 | 472 |
| 202 | 3300047472 | Ga0495686_0013267 | Ga0495686_0013267_2195_3694 | 472 |
| 203 | 3300049581 | Ga0501047_0002831 | Ga0501047_0002831_1702_3174 | 472 |
| 204 | 3300049758 | Ga0501241_000977 | Ga0501241_000977_148_1614 | 472 |
| 205 | iso_pu_bacteria | 2739367651 | 2739588178 | 472 |
| 206 | 3300003323 | rootH1_10105979 | rootH1_101059791 | 473 |
| 207 | 3300005288 | Ga0065714_10009231 | Ga0065714_100092312 | 473 |
| 208 | 3300005563 | Ga0068855_100009186 | Ga0068855_1000091863 | 473 |
| 209 | 3300005617 | Ga0068859_100211237 | Ga0068859_1002112373 | 473 |
| 210 | 3300005718 | Ga0068866_10016215 | Ga0068866_100162152 | 473 |
| 211 | 3300006931 | Ga0097620_100211221 | Ga0097620_1002112213 | 473 |
| 212 | 3300010375 | Ga0105239_10000696 | Ga0105239_1000069623 | 473 |
| 213 | 3300013100 | Ga0157373_10026785 | Ga0157373_100267852 | 473 |
| 214 | 3300025934 | Ga0207686_10039679 | Ga0207686_100396792 | 473 |
| 215 | 3300025949 | Ga0207667_10021003 | Ga0207667_100210034 | 473 |
| 216 | 3300025972 | Ga0207668_10163612 | Ga0207668_101636121 | 473 |
| 217 | 3300026089 | Ga0207648_10021859 | Ga0207648_100218594 | 473 |
| 218 | 3300026118 | Ga0207675_100082377 | Ga0207675_1000823772 | 473 |
| 219 | 3300032004 | Ga0307414_10001658 | Ga0307414_1000165810 | 473 |
| 220 | 3300039062 | Ga0400483_214800 | Ga0400483_214800_1918_3459 | 473 |
| 221 | 3300044712 | Ga0453684_0030497 | Ga0453684_0030497_215_1648 | 473 |
| 222 | 3300045051 | Ga0451576_0109610 | Ga0451576_0109610_872_2305 | 473 |
| 223 | 2162886007 | SwRhRL2b_contig_3444455 | SwRhRL2b_0167.00004470 | 474 |
| 224 | 2162886007 | SwRhRL2b_contig_677705 | SwRhRL2b_0104.00004150 | 474 |
| 225 | 3300005288 | Ga0065714_10004154 | Ga0065714_100041541 | 474 |
| 226 | 3300005289 | Ga0065704_10070305 | Ga0065704_1007030527 | 474 |
| 227 | 3300005289 | Ga0065704_10074471 | Ga0065704_100744712 | 474 |
| 228 | 3300009545 | Ga0105237_10001463 | Ga0105237_1000146316 | 474 |
| 229 | 3300013100 | Ga0157373_10001610 | Ga0157373_1000161016 | 474 |
| 230 | 3300013102 | Ga0157371_10002408 | Ga0157371_100024089 | 474 |
| 231 | 3300013102 | Ga0157371_10011401 | Ga0157371_100114011 | 474 |
| 232 | 3300013104 | Ga0157370_10000241 | Ga0157370_1000024139 | 474 |
| 233 | 3300013104 | Ga0157370_10020516 | Ga0157370_100205161 | 474 |
| 234 | 3300014497 | Ga0182008_10000014 | Ga0182008_10000014159 | 474 |
| 235 | 3300014497 | Ga0182008_10000048 | Ga0182008_1000004876 | 474 |
| 236 | 3300015261 | Ga0182006_1000178 | Ga0182006_100017837 | 474 |
| 237 | 3300015261 | Ga0182006_1006300 | Ga0182006_10063003 | 474 |
| 238 | 3300017792 | Ga0163161_10000297 | Ga0163161_1000029713 | 474 |
| 239 | 3300025914 | Ga0207671_10009921 | Ga0207671_100099214 | 474 |
| 240 | 3300031911 | Ga0307412_10000043 | Ga0307412_1000004350 | 474 |
| 241 | 3300048925 | Ga0496122_0004698 | Ga0496122_0004698_5023_6465 | 474 |
| 242 | 3300053093 | Ga0500651_0001777 | Ga0500651_0001777_7957_9381 | 474 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6gn6-assembly1.cif.gz_E | alpha-l-fucosidase isoenzyme 1 from paenibacillus thiaminolyticus | 0.8165 | 38 | 473 |
| 6gn6-assembly1.cif.gz_E | alpha-l-fucosidase isoenzyme 1 from paenibacillus thiaminolyticus | 0.811 | 38 | 473 |
| 7pls-assembly1.cif.gz_A | cryo-em structures of human fucosidase fuca1 reveal insight into substate recognition and catalysis. | 0.788 | 46 | 472 |
| 4jl2-assembly1.cif.gz_A | crystal structure of a bacterial fucosidase with a monovalent iminocyclitol inhibitor | 0.7777 | 28 | 473 |
| 7db5-assembly1.cif.gz_A | crystal structure of alpha-l-fucosidase from vibrio sp. strain ejy3 | 0.7739 | 41 | 473 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6GGS5_3_281_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8022 | 106 | 174 | 3.40.50.2000 |
| 6gn6F01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.7988 | 41 | 382 | 3.20.20.80 |
| 6gn6F01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.7965 | 41 | 382 | 3.20.20.80 |
| af_Q551C1_359_456_2.60.40.1180 | Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II | 0.7962 | 381 | 470 | 2.60.40.1180 |
| af_Q99LJ1_352_452_2.60.40.1180 | Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II | 0.7947 | 378 | 471 | 2.60.40.1180 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K1RDI7-F1-model_v4 | Alpha-L-fucosidase | 0.9624 | 225 | 360 |
GO:0004560
GO:0005764 GO:0006004 GO:0016139 |
| AF-A0A4Q3B491-F1-model_v4 | deleted | 0.9609 | 186 | 473 |
|
| AF-A0A519YCT1-F1-model_v4 | Alpha-L-fucosidase | 0.96 | 92 | 473 |
GO:0004560
GO:0005764 GO:0006004 GO:0016139 |
| AF-A0A5J4PJ37-F1-model_v4 | Alpha-L-fucosidase C-terminal domain-containing protein | 0.9593 | 347 | 472 |
GO:0004560
GO:0005975 |
| AF-W6TP98-F1-model_v4 | Alpha-L-fucosidase | 0.959 | 53 | 474 |
GO:0004560
GO:0005764 GO:0006004 GO:0016139 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar