F354282

General Info

Members Datasets Scaffolds Average Seq Length
242 158 225 477

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10003434|rootH1_100034342
Length 521
Sequence MLQPEDAVFIYVGSRFCVLLRFHKKFARFAEKQHWDAIQSMKITTIMKKIILGSVLLISMLCLVNAAAAQGNIHQQSTTYQWPTDPMVKEKLETWRDQKFGMIIHWGLYAVPGIIESWALCSEDWIERDSTMAYDDFKKWYWGLSKQFNPTWAQAAKDAGMRYLVFTTKHHDGFNMFDTKQTDFKITNGPFASNPRANVAKYIFEAFRKQNMMIGAYYSKPDWHTEYYWWPKYATADRNVNYDIRKNPWRWNKFKEFTYNQISELTHDYGKIDILWLDGGWVRPLETVTDEVRAWGAAIPAWSQDIDMPRIASMARSAQPGLLIVDRTVHGPYENYQTPEQSIPKEKLDNPWESCITLGGAWGYVPNDRFKSSARVIHTLIEVVAKGGSLLLGVGPTPEGTFTQEQIDRLKSVGQWLQQNGAAIYSTRPADNYYDQASDTYFTTGKNKEIYALVRLKEGASIPATVSWSGNVPAKGTTMKLLSTGTTVKWKKEGDKVIVQLPASFIKKYQAYPALAFSFQP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2738541283 Pedobacter sp. OK701 Isolate Unclassified
4 2738541284 Pedobacter sp. YR016 Isolate Unclassified
5 2738541302 Pedobacter sp. CF074 Isolate Unclassified
6 2739367651 Pedobacter sp. OK291 Isolate Unclassified
7 2739367656 Pedobacter sp. CF523 Isolate Unclassified
8 2739367663 Pedobacter sp. YR510 Isolate Unclassified
9 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
10 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
11 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
12 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
13 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
14 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
15 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
16 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
17 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
18 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
19 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
20 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
23 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
76 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
77 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
78 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
115 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
116 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
117 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
118 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
121 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
122 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
131 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
132 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
137 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
138 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
144 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
145 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
146 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
147 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
151 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
152 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
153 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
154 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
155 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
156 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
157 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
158 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.98
Metatranscriptomes 0
Isolates 7.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.09
Nodule 0
Rhizoplane 0
Rhizosphere 77.27
Stem 0
Stem Tuber 0
Unclassified 13.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3444455 2162886007 Bacteria 3743
2 SwRhRL2b_contig_677705 2162886007 Bacteria 7312
3 JGI25152J39213_1000697 3300002773 Bacteria 17459
4 JGI25150J39212_1000001 3300002774 Bacteria 1318726
5 JGI25151J46595_10000001 3300003187 Bacteria 887211
6 JGI25153J46596_10000001 3300003215 Bacteria 748985
7 rootH1_10003434 3300003316 Bacteria 4265
8 rootH1_10079219 3300003316 Bacteria 2282
9 rootH2_10014083 3300003320 Bacteria 56189
10 rootH2_10076262 3300003320 Bacteria 8102
11 rootL2_10026564 3300003322 Bacteria 3260
12 rootL2_10026565 3300003322 Bacteria 6949
13 rootL2_10175409 3300003322 Bacteria 3927
14 rootH1_10000536 3300003323 Bacteria 87102
15 rootH1_10017445 3300003323 Bacteria 9560
16 rootH1_10018108 3300003323 Bacteria 7875
17 rootH1_10105979 3300003323 Bacteria 2474
18 Ga0065165_1001255 3300005262 Bacteria 28742
19 Ga0065714_10003276 3300005288 Bacteria 14932
20 Ga0065714_10004154 3300005288 Bacteria 7545
21 Ga0065714_10009231 3300005288 Bacteria 2851
22 Ga0065704_10070305 3300005289 Bacteria 36252
23 Ga0065704_10074471 3300005289 Bacteria 6250
24 Ga0065704_10078005 3300005289 Bacteria 4554
25 Ga0070670_100013781 3300005331 Bacteria 6929
26 Ga0070670_100081703 3300005331 Bacteria 2776
27 Ga0070680_100000066 3300005336 Bacteria 55257
28 Ga0070682_100000455 3300005337 Bacteria 25816
29 Ga0068868_100130832 3300005338 Bacteria 2053
30 Ga0070691_10064959 3300005341 Bacteria 1761
31 Ga0070668_100087626 3300005347 Bacteria 2450
32 Ga0070671_100002666 3300005355 Bacteria 13832
33 Ga0070671_100020872 3300005355 Bacteria 5343
34 Ga0070674_100018123 3300005356 Bacteria 4444
35 Ga0070667_100003552 3300005367 Bacteria 13290
36 Ga0070667_100043651 3300005367 Bacteria 3763
37 Ga0070681_10005301 3300005458 Bacteria 12452
38 Ga0070698_100040027 3300005471 Bacteria 4819
39 Ga0070679_100000973 3300005530 Bacteria 24934
40 Ga0068855_100009186 3300005563 Bacteria 11937
41 Ga0070702_100003324 3300005615 Bacteria 7175
42 Ga0068859_100000012 3300005617 Bacteria 300376
43 Ga0068859_100003516 3300005617 Bacteria 15952
44 Ga0068859_100211237 3300005617 Bacteria 2027
45 Ga0068864_100006045 3300005618 Bacteria 9938
46 Ga0068866_10016215 3300005718 Bacteria 3327
47 Ga0068863_100008374 3300005841 Bacteria 10098
48 Ga0068858_100016927 3300005842 Bacteria 6845
49 Ga0068860_100004050 3300005843 Bacteria 15046
50 Ga0075366_10036807 3300006195 Bacteria 2886
51 Ga0068871_100020522 3300006358 Bacteria 5063
52 Ga0068871_100122764 3300006358 Bacteria 2196
53 Ga0075430_100070092 3300006846 Bacteria 2940
54 Ga0075431_100192786 3300006847 Bacteria 2088
55 Ga0097620_100000012 3300006931 Bacteria 300376
56 Ga0097620_100003516 3300006931 Bacteria 15952
57 Ga0097620_100211221 3300006931 Bacteria 2027
58 Ga0105240_10022628 3300009093 Bacteria 8327
59 Ga0105247_10025782 3300009101 Bacteria 3548
60 Ga0114129_10050064 3300009147 Bacteria 5869
61 Ga0114129_10070431 3300009147 Bacteria 4877
62 Ga0105241_10000144 3300009174 Bacteria 50819
63 Ga0105241_10001105 3300009174 Bacteria 20534
64 Ga0105237_10000725 3300009545 Bacteria 45577
65 Ga0105237_10001463 3300009545 Bacteria 31112
66 Ga0105237_10007256 3300009545 Bacteria 12157
67 Ga0105237_10073704 3300009545 Bacteria 3406
68 Ga0105249_10012219 3300009553 Bacteria 7563
69 Ga0105239_10000696 3300010375 Bacteria 47844
70 Ga0105239_10041211 3300010375 Bacteria 5060
71 Ga0105239_10117875 3300010375 Unclassified 2946
72 Ga0105246_10035205 3300011119 Bacteria 3345
73 Ga0105246_10151041 3300011119 Bacteria 1758
74 Ga0157373_10001610 3300013100 Bacteria 17242
75 Ga0157373_10023239 3300013100 Bacteria 4496
76 Ga0157373_10026785 3300013100 Bacteria 4161
77 Ga0157371_10000074 3300013102 Bacteria 162988
78 Ga0157371_10002408 3300013102 Bacteria 17899
79 Ga0157371_10011401 3300013102 Bacteria 6853
80 Ga0157370_10000241 3300013104 Bacteria 69817
81 Ga0157370_10002624 3300013104 Bacteria 21610
82 Ga0157370_10005449 3300013104 Bacteria 14275
83 Ga0157370_10006627 3300013104 Bacteria 12725
84 Ga0157370_10020516 3300013104 Bacteria 6598
85 Ga0157370_10036503 3300013104 Bacteria 4768
86 Ga0157370_10044481 3300013104 Bacteria 4267
87 Ga0157370_10203823 3300013104 Bacteria 1834
88 Ga0157369_10000031 3300013105 Bacteria 203214
89 Ga0157378_10009577 3300013297 Bacteria 8435
90 Ga0157378_10021166 3300013297 Bacteria 5720
91 Ga0157378_10124133 3300013297 Bacteria 2383
92 Ga0163162_10000279 3300013306 Bacteria 46872
93 Ga0157372_10369799 3300013307 Bacteria 1671
94 Ga0157375_10044863 3300013308 Bacteria 4300
95 Ga0157375_10232035 3300013308 Bacteria 2004
96 Ga0182008_10000014 3300014497 Bacteria 263844
97 Ga0182008_10000048 3300014497 Bacteria 105176
98 Ga0182008_10000100 3300014497 Bacteria 66862
99 Ga0157376_10048569 3300014969 Bacteria 3510
100 Ga0182006_1000178 3300015261 Bacteria 66897
101 Ga0182006_1000670 3300015261 Bacteria 24076
102 Ga0182006_1000697 3300015261 Bacteria 23266
103 Ga0182006_1006300 3300015261 Bacteria 5529
104 Ga0182007_10000002 3300015262 Bacteria 564661
105 Ga0163161_10000279 3300017792 Bacteria 44617
106 Ga0163161_10000297 3300017792 Bacteria 43454
107 Ga0163161_10000310 3300017792 Bacteria 42437
108 Ga0163161_10001038 3300017792 Bacteria 21157
109 Ga0163161_10002044 3300017792 Bacteria 14612
110 Ga0163161_10006202 3300017792 Bacteria 8285
111 Ga0207425_1000002 3300025245 Bacteria 1362590
112 Ga0209646_1001395 3300025246 Bacteria 6610
113 Ga0209129_1000002 3300025258 Bacteria 1359086
114 Ga0209025_1000004 3300025294 Bacteria 1361782
115 Ga0209758_1000006 3300025297 Bacteria 1359562
116 Ga0209050_1008925 3300025298 Bacteria 5235
117 Ga0207710_10032196 3300025900 Bacteria 2296
118 Ga0207654_10000765 3300025911 Bacteria 17701
119 Ga0207654_10002914 3300025911 Bacteria 8672
120 Ga0207707_10000317 3300025912 Bacteria 50861
121 Ga0207695_10007582 3300025913 Bacteria 13759
122 Ga0207671_10004439 3300025914 Bacteria 13417
123 Ga0207671_10009921 3300025914 Bacteria 7914
124 Ga0207660_10001972 3300025917 Bacteria 13679
125 Ga0207652_10000456 3300025921 Bacteria 42137
126 Ga0207650_10027246 3300025925 Bacteria 4088
127 Ga0207650_10120628 3300025925 Bacteria 2041
128 Ga0207644_10022825 3300025931 Bacteria 4278
129 Ga0207686_10039679 3300025934 Bacteria 2858
130 Ga0207669_10015668 3300025937 Unclassified 3830
131 Ga0207689_10000329 3300025942 Bacteria 44014
132 Ga0207667_10021003 3300025949 Bacteria 7241
133 Ga0207668_10163612 3300025972 Bacteria 1737
134 Ga0207658_10164247 3300025986 Bacteria 1822
135 Ga0207677_10041109 3300026023 Bacteria 3054
136 Ga0207703_10001495 3300026035 Bacteria 21327
137 Ga0207639_10015497 3300026041 Bacteria 5380
138 Ga0207641_10000152 3300026088 Bacteria 98311
139 Ga0207641_10013432 3300026088 Bacteria 6716
140 Ga0207648_10021859 3300026089 Bacteria 5748
141 Ga0207676_10013858 3300026095 Bacteria 5788
142 Ga0207675_100082377 3300026118 Bacteria 3017
143 Ga0268264_10001955 3300028381 Bacteria 18514
144 Ga0307515_10000039 3300028794 Bacteria 323229
145 Ga0307515_10000250 3300028794 Bacteria 133055
146 Ga0307513_10071356 3300031456 Bacteria 3625
147 Ga0307514_10093361 3300031649 Bacteria 2186
148 Ga0307405_10000006 3300031731 Bacteria 361477
149 Ga0307407_10000031 3300031903 Bacteria 87995
150 Ga0307412_10000043 3300031911 Bacteria 166562
151 Ga0307412_10012522 3300031911 Bacteria 4949
152 Ga0307416_100000002 3300032002 Bacteria 509907
153 Ga0307414_10001658 3300032004 Bacteria 11579
154 Ga0307414_10004228 3300032004 Bacteria 7777
155 Ga0307414_10011430 3300032004 Bacteria 5206
156 Ga0307414_10028297 3300032004 Bacteria 3633
157 Ga0307414_10033232 3300032004 Bacteria 3407
158 Ga0307414_10064295 3300032004 Bacteria 2612
159 Ga0373935_0059491 3300035692 Bacteria 2442
160 Ga0373925_0020259 3300037068 Unclassified 4840
161 Ga0400483_214800 3300039062 Bacteria 7215
162 Ga0439436_0004392 3300041404 Bacteria 4318
163 Ga0439445_0017221 3300042004 Bacteria 1785
164 Ga0439449_0009601 3300042007 Bacteria 3662
165 Ga0439457_001295 3300042014 Bacteria 7507
166 Ga0466969_0000670 3300044656 Bacteria 18584
167 Ga0466972_0000032 3300044658 Bacteria 159445
168 Ga0466982_0044790 3300044672 Bacteria 2692
169 Ga0453683_0010249 3300044673 Bacteria 6214
170 Ga0453683_0198579 3300044673 Unclassified 1273
171 Ga0466966_0000157 3300044684 Bacteria 44093
172 Ga0466964_0019458 3300044706 Bacteria 2609
173 Ga0453684_0001762 3300044712 Bacteria 57774
174 Ga0453684_0005173 3300044712 Bacteria 26244
175 Ga0453684_0030497 3300044712 Bacteria 7616
176 Ga0453684_0059999 3300044712 Bacteria 4898
177 Ga0453684_0104832 3300044712 Bacteria 3450
178 Ga0466957_0001957 3300044842 Bacteria 10950
179 Ga0466957_0049918 3300044842 Bacteria 2545
180 Ga0466959_0000012 3300045049 Bacteria 168961
181 Ga0451576_0000180 3300045051 Bacteria 159491
182 Ga0451576_0000395 3300045051 Bacteria 101608
183 Ga0451576_0051669 3300045051 Unclassified 4309
184 Ga0451576_0093078 3300045051 Bacteria 3134
185 Ga0451576_0109610 3300045051 Bacteria 2873
186 Ga0451576_0127391 3300045051 Bacteria 2653
187 Ga0495638_0000036 3300046460 Bacteria 275731
188 Ga0495638_0088211 3300046460 Bacteria 1873
189 Ga0495610_0000724 3300046512 Bacteria 31376
190 Ga0495610_0001530 3300046512 Bacteria 20374
191 Ga0495610_0007744 3300046512 Bacteria 7089
192 Ga0495666_0029493 3300046526 Unclassified 2699
193 Ga0495633_0073738 3300046558 Bacteria 1591
194 Ga0495676_0094897 3300047321 Bacteria 2221
195 Ga0495687_001322 3300047443 Bacteria 23124
196 Ga0495686_0013267 3300047472 Bacteria 5722
197 Ga0495686_0061894 3300047472 Unclassified 2323
198 Ga0496122_0001507 3300048925 Bacteria 37128
199 Ga0496122_0004698 3300048925 Bacteria 16777
200 Ga0496123_0009199 3300048926 Bacteria 8928
201 Ga0501300_001884 3300049523 Unclassified 3128
202 Ga0501034_0010116 3300049571 Bacteria 9842
203 Ga0501034_0134453 3300049571 Bacteria 2454
204 Ga0501037_0082237 3300049573 Bacteria 2334
205 Ga0501043_0025918 3300049579 Bacteria 4600
206 Ga0501047_0002831 3300049581 Bacteria 16458
207 Ga0501067_0019994 3300049583 Bacteria 3705
208 Ga0501217_009034 3300049661 Bacteria 2161
209 Ga0501236_000130 3300049670 Bacteria 7374
210 Ga0501225_0001374 3300049705 Bacteria 7588
211 Ga0501241_000977 3300049758 Bacteria 6020
212 Ga0501044_0006113 3300049823 Bacteria 13284
213 nmdc:mga05p37_201505_c1 3300050507 Bacteria 2410
214 nmdc:mga05p37_24024_c1 3300050507 Bacteria 7404
215 Ga0500578_0000001 3300053086 Bacteria 317120
216 Ga0500644_0010585 3300053088 Bacteria 2499
217 Ga0500583_0000013 3300053092 Bacteria 150087
218 Ga0500651_0001777 3300053093 Bacteria 11046
219 Ga0500652_003892 3300053131 Bacteria 4564
220 Ga0500568_0005871 3300053139 Bacteria 6253
221 Ga0500616_0000004 3300053153 Bacteria 1002714
222 Ga0500622_0000003 3300053156 Bacteria 613483
223 Ga0500622_0000008 3300053156 Bacteria 423636
224 Ga0500622_0003062 3300053156 Bacteria 11537
225 Ga0500633_0000320 3300053160 Bacteria 7127

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044673 Ga0453683_0198579 Ga0453683_0198579_54_1259 386
2 3300044706 Ga0466964_0019458 Ga0466964_0019458_1346_2593 396
3 3300003323 rootH1_10000536 rootH1_1000053617 421
4 3300009545 Ga0105237_10007256 Ga0105237_1000725612 428
5 3300013104 Ga0157370_10005449 Ga0157370_1000544910 430
6 3300014497 Ga0182008_10000100 Ga0182008_1000010051 430
7 3300015261 Ga0182006_1000670 Ga0182006_10006709 430
8 3300017792 Ga0163161_10002044 Ga0163161_100020444 430
9 3300048925 Ga0496122_0001507 Ga0496122_0001507_19634_21037 430
10 3300048926 Ga0496123_0009199 Ga0496123_0009199_3094_4497 430
11 3300045051 Ga0451576_0051669 Ga0451576_0051669_976_2412 435
12 3300013297 Ga0157378_10009577 Ga0157378_100095778 436
13 3300013308 Ga0157375_10232035 Ga0157375_102320352 436
14 3300035692 Ga0373935_0059491 Ga0373935_0059491_313_1827 436
15 3300037068 Ga0373925_0020259 Ga0373925_0020259_586_2100 436
16 3300046526 Ga0495666_0029493 Ga0495666_0029493_961_2475 436
17 3300047321 Ga0495676_0094897 Ga0495676_0094897_56_1570 436
18 3300053092 Ga0500583_0000013 Ga0500583_0000013_18200_19657 438
19 3300005289 Ga0065704_10078005 Ga0065704_100780054 444
20 3300005355 Ga0070671_100002666 Ga0070671_1000026666 444
21 3300010375 Ga0105239_10041211 Ga0105239_100412112 444
22 3300011119 Ga0105246_10035205 Ga0105246_100352053 444
23 3300025931 Ga0207644_10022825 Ga0207644_100228252 444
24 3300044673 Ga0453683_0010249 Ga0453683_0010249_1697_3130 444
25 3300045051 Ga0451576_0000180 Ga0451576_0000180_3731_5164 444
26 3300045051 Ga0451576_0000395 Ga0451576_0000395_50935_52368 444
27 3300047443 Ga0495687_001322 Ga0495687_001322_3651_5096 444
28 3300042004 Ga0439445_0017221 Ga0439445_0017221_355_1770 446
29 3300049571 Ga0501034_0134453 Ga0501034_0134453_508_1923 446
30 3300053153 Ga0500616_0000004 Ga0500616_0000004_404209_405612 446
31 3300044712 Ga0453684_0104832 Ga0453684_0104832_287_1732 447
32 3300045051 Ga0451576_0127391 Ga0451576_0127391_179_1624 447
33 3300049579 Ga0501043_0025918 Ga0501043_0025918_453_1910 447
34 3300017792 Ga0163161_10001038 Ga0163161_100010387 448
35 3300044712 Ga0453684_0059999 Ga0453684_0059999_2777_4213 448
36 3300053131 Ga0500652_003892 Ga0500652_003892_1580_3061 448
37 iso_pu_bacteria 2738541283 2738754174 448
38 3300044656 Ga0466969_0000670 Ga0466969_0000670_7616_9100 449
39 3300044684 Ga0466966_0000157 Ga0466966_0000157_42295_43779 449
40 3300044712 Ga0453684_0005173 Ga0453684_0005173_6296_7777 449
41 3300045049 Ga0466959_0000012 Ga0466959_0000012_11116_12600 449
42 3300045051 Ga0451576_0093078 Ga0451576_0093078_1074_2555 449
43 3300046460 Ga0495638_0088211 Ga0495638_0088211_155_1720 449
44 3300041404 Ga0439436_0004392 Ga0439436_0004392_210_1658 450
45 3300042014 Ga0439457_001295 Ga0439457_001295_5329_6777 450
46 3300053160 Ga0500633_0000320 Ga0500633_0000320_5507_6913 451
47 3300006195 Ga0075366_10036807 Ga0075366_100368072 453
48 3300009147 Ga0114129_10050064 Ga0114129_100500643 453
49 3300050507 nmdc:mga05p37_24024_c1 nmdc:mga05p37_24024_c1_2110_3603 453
50 3300025298 Ga0209050_1008925 Ga0209050_10089252 455
51 3300031456 Ga0307513_10071356 Ga0307513_100713564 455
52 3300046460 Ga0495638_0000036 Ga0495638_0000036_214727_216163 455
53 iso_pu_bacteria 2883068021 2883070721 455
54 iso_pu_bacteria 2896109856 2896114161 455
55 3300009147 Ga0114129_10070431 Ga0114129_100704314 456
56 3300013105 Ga0157369_10000031 Ga0157369_10000031146 456
57 3300050507 nmdc:mga05p37_201505_c1 nmdc:mga05p37_201505_c1_599_1987 456
58 3300015262 Ga0182007_10000002 Ga0182007_10000002176 457
59 3300053156 Ga0500622_0000003 Ga0500622_0000003_562378_563772 457
60 3300053156 Ga0500622_0000008 Ga0500622_0000008_388780_390174 457
61 3300042007 Ga0439449_0009601 Ga0439449_0009601_1496_2896 458
62 3300009545 Ga0105237_10073704 Ga0105237_100737042 460
63 3300044842 Ga0466957_0001957 Ga0466957_0001957_34_1431 460
64 3300049523 Ga0501300_001884 Ga0501300_001884_36_1442 460
65 3300049661 Ga0501217_009034 Ga0501217_009034_116_1522 460
66 3300031903 Ga0307407_10000031 Ga0307407_1000003142 461
67 3300032002 Ga0307416_100000002 Ga0307416_100000002163 461
68 3300032004 Ga0307414_10028297 Ga0307414_100282972 461
69 3300031911 Ga0307412_10012522 Ga0307412_100125223 463
70 3300032004 Ga0307414_10004228 Ga0307414_100042284 463
71 3300003316 rootH1_10003434 rootH1_100034342 464
72 3300003320 rootH2_10014083 rootH2_1001408327 464
73 3300003322 rootL2_10026564 rootL2_100265642 464
74 3300003323 rootH1_10017445 rootH1_100174455 464
75 3300053086 Ga0500578_0000001 Ga0500578_0000001_208792_210264 465
76 3300005262 Ga0065165_1001255 Ga0065165_100125513 466
77 3300046512 Ga0495610_0000724 Ga0495610_0000724_20373_21797 466
78 3300046512 Ga0495610_0001530 Ga0495610_0001530_14205_15644 466
79 3300049705 Ga0501225_0001374 Ga0501225_0001374_562_2001 466
80 3300053088 Ga0500644_0010585 Ga0500644_0010585_782_2221 466
81 3300053156 Ga0500622_0003062 Ga0500622_0003062_3844_5253 466
82 iso_pu_bacteria 2738541278 2738728791 466
83 iso_pu_bacteria 2739367663 2739647044 466
84 3300053139 Ga0500568_0005871 Ga0500568_0005871_219_1643 467
85 iso_pu_bacteria 2738541302 2738855414 467
86 iso_pu_bacteria 2739367656 2739614051 467
87 iso_pu_bacteria 2842722452 2842724019 467
88 iso_pu_bacteria 2842909656 2842912248 467
89 3300003323 rootH1_10018108 rootH1_100181088 468
90 3300044672 Ga0466982_0044790 Ga0466982_0044790_1081_2526 468
91 iso_pu_bacteria 2857627736 2857629403 468
92 iso_pu_bacteria 2919692658 2919693365 468
93 iso_pu_bacteria 2954016120 2954021621 468
94 3300005355 Ga0070671_100020872 Ga0070671_1000208723 469
95 3300005356 Ga0070674_100018123 Ga0070674_1000181232 469
96 3300005615 Ga0070702_100003324 Ga0070702_1000033244 469
97 3300028794 Ga0307515_10000039 Ga0307515_1000003985 469
98 iso_pu_bacteria 2945997725 2945999225 469
99 3300003322 rootL2_10026565 rootL2_100265654 470
100 3300003322 rootL2_10175409 rootL2_101754092 470
101 3300025937 Ga0207669_10015668 Ga0207669_100156682 470
102 3300028794 Ga0307515_10000250 Ga0307515_100002509 470
103 3300031649 Ga0307514_10093361 Ga0307514_100933612 470
104 3300032004 Ga0307414_10011430 Ga0307414_100114302 470
105 3300044712 Ga0453684_0001762 Ga0453684_0001762_1029_2471 470
106 3300049583 Ga0501067_0019994 Ga0501067_0019994_736_2169 470
107 3300049670 Ga0501236_000130 Ga0501236_000130_5309_6763 470
108 iso_pu_bacteria 2738541283 2738755582 470
109 iso_pu_bacteria 2738541284 2738764195 470
110 iso_pu_bacteria 2775506987 2776611974 470
111 3300002773 JGI25152J39213_1000697 JGI25152J39213_10006972 471
112 3300002774 JGI25150J39212_1000001 JGI25150J39212_1000001150 471
113 3300003187 JGI25151J46595_10000001 JGI25151J46595_10000001645 471
114 3300003215 JGI25153J46596_10000001 JGI25153J46596_10000001534 471
115 3300003316 rootH1_10079219 rootH1_100792193 471
116 3300003320 rootH2_10076262 rootH2_100762625 471
117 3300005288 Ga0065714_10003276 Ga0065714_100032767 471
118 3300005331 Ga0070670_100013781 Ga0070670_1000137814 471
119 3300005331 Ga0070670_100081703 Ga0070670_1000817032 471
120 3300005336 Ga0070680_100000066 Ga0070680_10000006627 471
121 3300005337 Ga0070682_100000455 Ga0070682_10000045518 471
122 3300005338 Ga0068868_100130832 Ga0068868_1001308322 471
123 3300005341 Ga0070691_10064959 Ga0070691_100649591 471
124 3300005347 Ga0070668_100087626 Ga0070668_1000876263 471
125 3300005367 Ga0070667_100003552 Ga0070667_1000035527 471
126 3300005367 Ga0070667_100043651 Ga0070667_1000436513 471
127 3300005458 Ga0070681_10005301 Ga0070681_100053017 471
128 3300005530 Ga0070679_100000973 Ga0070679_10000097318 471
129 3300005617 Ga0068859_100000012 Ga0068859_100000012157 471
130 3300005617 Ga0068859_100003516 Ga0068859_10000351616 471
131 3300005618 Ga0068864_100006045 Ga0068864_1000060451 471
132 3300005841 Ga0068863_100008374 Ga0068863_1000083749 471
133 3300005842 Ga0068858_100016927 Ga0068858_1000169272 471
134 3300005843 Ga0068860_100004050 Ga0068860_1000040504 471
135 3300006358 Ga0068871_100122764 Ga0068871_1001227644 471
136 3300006931 Ga0097620_100000012 Ga0097620_100000012157 471
137 3300006931 Ga0097620_100003516 Ga0097620_10000351616 471
138 3300009093 Ga0105240_10022628 Ga0105240_100226284 471
139 3300009101 Ga0105247_10025782 Ga0105247_100257825 471
140 3300009174 Ga0105241_10000144 Ga0105241_1000014418 471
141 3300009174 Ga0105241_10001105 Ga0105241_100011052 471
142 3300009545 Ga0105237_10000725 Ga0105237_1000072539 471
143 3300009553 Ga0105249_10012219 Ga0105249_100122192 471
144 3300010375 Ga0105239_10117875 Ga0105239_101178751 471
145 3300013100 Ga0157373_10023239 Ga0157373_100232393 471
146 3300013104 Ga0157370_10006627 Ga0157370_100066273 471
147 3300013297 Ga0157378_10124133 Ga0157378_101241332 471
148 3300013306 Ga0163162_10000279 Ga0163162_100002798 471
149 3300013307 Ga0157372_10369799 Ga0157372_103697991 471
150 3300013308 Ga0157375_10044863 Ga0157375_100448632 471
151 3300014969 Ga0157376_10048569 Ga0157376_100485692 471
152 3300015261 Ga0182006_1000697 Ga0182006_100069710 471
153 3300017792 Ga0163161_10000279 Ga0163161_1000027920 471
154 3300017792 Ga0163161_10006202 Ga0163161_100062025 471
155 3300025245 Ga0207425_1000002 Ga0207425_10000021011 471
156 3300025258 Ga0209129_1000002 Ga0209129_10000021011 471
157 3300025294 Ga0209025_1000004 Ga0209025_1000004180 471
158 3300025297 Ga0209758_1000006 Ga0209758_1000006180 471
159 3300025900 Ga0207710_10032196 Ga0207710_100321962 471
160 3300025911 Ga0207654_10000765 Ga0207654_100007659 471
161 3300025911 Ga0207654_10002914 Ga0207654_100029149 471
162 3300025912 Ga0207707_10000317 Ga0207707_1000031729 471
163 3300025913 Ga0207695_10007582 Ga0207695_100075829 471
164 3300025914 Ga0207671_10004439 Ga0207671_100044393 471
165 3300025917 Ga0207660_10001972 Ga0207660_100019724 471
166 3300025921 Ga0207652_10000456 Ga0207652_1000045615 471
167 3300025925 Ga0207650_10027246 Ga0207650_100272462 471
168 3300025925 Ga0207650_10120628 Ga0207650_101206281 471
169 3300025942 Ga0207689_10000329 Ga0207689_100003298 471
170 3300025986 Ga0207658_10164247 Ga0207658_101642472 471
171 3300026023 Ga0207677_10041109 Ga0207677_100411094 471
172 3300026035 Ga0207703_10001495 Ga0207703_100014954 471
173 3300026041 Ga0207639_10015497 Ga0207639_100154973 471
174 3300026088 Ga0207641_10000152 Ga0207641_1000015277 471
175 3300026088 Ga0207641_10013432 Ga0207641_100134324 471
176 3300026095 Ga0207676_10013858 Ga0207676_100138582 471
177 3300028381 Ga0268264_10001955 Ga0268264_1000195515 471
178 3300031731 Ga0307405_10000006 Ga0307405_10000006325 471
179 3300032004 Ga0307414_10033232 Ga0307414_100332322 471
180 3300047472 Ga0495686_0061894 Ga0495686_0061894_755_2197 471
181 3300049571 Ga0501034_0010116 Ga0501034_0010116_1113_2561 471
182 3300049573 Ga0501037_0082237 Ga0501037_0082237_560_2008 471
183 3300049823 Ga0501044_0006113 Ga0501044_0006113_10902_12350 471
184 3300005471 Ga0070698_100040027 Ga0070698_1000400271 472
185 3300006358 Ga0068871_100020522 Ga0068871_1000205223 472
186 3300006846 Ga0075430_100070092 Ga0075430_1000700923 472
187 3300006847 Ga0075431_100192786 Ga0075431_1001927861 472
188 3300011119 Ga0105246_10151041 Ga0105246_101510411 472
189 3300013102 Ga0157371_10000074 Ga0157371_10000074104 472
190 3300013104 Ga0157370_10002624 Ga0157370_100026244 472
191 3300013104 Ga0157370_10036503 Ga0157370_100365033 472
192 3300013104 Ga0157370_10044481 Ga0157370_100444812 472
193 3300013104 Ga0157370_10203823 Ga0157370_102038231 472
194 3300013297 Ga0157378_10021166 Ga0157378_100211662 472
195 3300017792 Ga0163161_10000310 Ga0163161_100003107 472
196 3300025246 Ga0209646_1001395 Ga0209646_10013953 472
197 3300032004 Ga0307414_10064295 Ga0307414_100642952 472
198 3300044658 Ga0466972_0000032 Ga0466972_0000032_49888_51360 472
199 3300044842 Ga0466957_0049918 Ga0466957_0049918_801_2273 472
200 3300046512 Ga0495610_0007744 Ga0495610_0007744_2176_3600 472
201 3300046558 Ga0495633_0073738 Ga0495633_0073738_121_1545 472
202 3300047472 Ga0495686_0013267 Ga0495686_0013267_2195_3694 472
203 3300049581 Ga0501047_0002831 Ga0501047_0002831_1702_3174 472
204 3300049758 Ga0501241_000977 Ga0501241_000977_148_1614 472
205 iso_pu_bacteria 2739367651 2739588178 472
206 3300003323 rootH1_10105979 rootH1_101059791 473
207 3300005288 Ga0065714_10009231 Ga0065714_100092312 473
208 3300005563 Ga0068855_100009186 Ga0068855_1000091863 473
209 3300005617 Ga0068859_100211237 Ga0068859_1002112373 473
210 3300005718 Ga0068866_10016215 Ga0068866_100162152 473
211 3300006931 Ga0097620_100211221 Ga0097620_1002112213 473
212 3300010375 Ga0105239_10000696 Ga0105239_1000069623 473
213 3300013100 Ga0157373_10026785 Ga0157373_100267852 473
214 3300025934 Ga0207686_10039679 Ga0207686_100396792 473
215 3300025949 Ga0207667_10021003 Ga0207667_100210034 473
216 3300025972 Ga0207668_10163612 Ga0207668_101636121 473
217 3300026089 Ga0207648_10021859 Ga0207648_100218594 473
218 3300026118 Ga0207675_100082377 Ga0207675_1000823772 473
219 3300032004 Ga0307414_10001658 Ga0307414_1000165810 473
220 3300039062 Ga0400483_214800 Ga0400483_214800_1918_3459 473
221 3300044712 Ga0453684_0030497 Ga0453684_0030497_215_1648 473
222 3300045051 Ga0451576_0109610 Ga0451576_0109610_872_2305 473
223 2162886007 SwRhRL2b_contig_3444455 SwRhRL2b_0167.00004470 474
224 2162886007 SwRhRL2b_contig_677705 SwRhRL2b_0104.00004150 474
225 3300005288 Ga0065714_10004154 Ga0065714_100041541 474
226 3300005289 Ga0065704_10070305 Ga0065704_1007030527 474
227 3300005289 Ga0065704_10074471 Ga0065704_100744712 474
228 3300009545 Ga0105237_10001463 Ga0105237_1000146316 474
229 3300013100 Ga0157373_10001610 Ga0157373_1000161016 474
230 3300013102 Ga0157371_10002408 Ga0157371_100024089 474
231 3300013102 Ga0157371_10011401 Ga0157371_100114011 474
232 3300013104 Ga0157370_10000241 Ga0157370_1000024139 474
233 3300013104 Ga0157370_10020516 Ga0157370_100205161 474
234 3300014497 Ga0182008_10000014 Ga0182008_10000014159 474
235 3300014497 Ga0182008_10000048 Ga0182008_1000004876 474
236 3300015261 Ga0182006_1000178 Ga0182006_100017837 474
237 3300015261 Ga0182006_1006300 Ga0182006_10063003 474
238 3300017792 Ga0163161_10000297 Ga0163161_1000029713 474
239 3300025914 Ga0207671_10009921 Ga0207671_100099214 474
240 3300031911 Ga0307412_10000043 Ga0307412_1000004350 474
241 3300048925 Ga0496122_0004698 Ga0496122_0004698_5023_6465 474
242 3300053093 Ga0500651_0001777 Ga0500651_0001777_7957_9381 474

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01120

Alpha_L_fucos

Alpha-L-fucosidase

67

422

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gn6-assembly1.cif.gz_E alpha-l-fucosidase isoenzyme 1 from paenibacillus thiaminolyticus 0.8165 38 473
6gn6-assembly1.cif.gz_E alpha-l-fucosidase isoenzyme 1 from paenibacillus thiaminolyticus 0.811 38 473
7pls-assembly1.cif.gz_A cryo-em structures of human fucosidase fuca1 reveal insight into substate recognition and catalysis. 0.788 46 472
4jl2-assembly1.cif.gz_A crystal structure of a bacterial fucosidase with a monovalent iminocyclitol inhibitor 0.7777 28 473
7db5-assembly1.cif.gz_A crystal structure of alpha-l-fucosidase from vibrio sp. strain ejy3 0.7739 41 473
ID Description Score Start End Superfamily
af_A0A1D6GGS5_3_281_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8022 106 174 3.40.50.2000
6gn6F01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7988 41 382 3.20.20.80
6gn6F01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7965 41 382 3.20.20.80
af_Q551C1_359_456_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.7962 381 470 2.60.40.1180
af_Q99LJ1_352_452_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.7947 378 471 2.60.40.1180
ID Description Score Start End GO Terms
AF-K1RDI7-F1-model_v4 Alpha-L-fucosidase 0.9624 225 360 GO:0004560
GO:0005764
GO:0006004
GO:0016139
AF-A0A4Q3B491-F1-model_v4 deleted 0.9609 186 473
AF-A0A519YCT1-F1-model_v4 Alpha-L-fucosidase 0.96 92 473 GO:0004560
GO:0005764
GO:0006004
GO:0016139
AF-A0A5J4PJ37-F1-model_v4 Alpha-L-fucosidase C-terminal domain-containing protein 0.9593 347 472 GO:0004560
GO:0005975
AF-W6TP98-F1-model_v4 Alpha-L-fucosidase 0.959 53 474 GO:0004560
GO:0005764
GO:0006004
GO:0016139

Feature Viewer

pLDDT pTM Quality
86.13 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map