F354149
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 241 | 169 | 241 | 286 |
Family's Representative Sequence
| Representative Sequence | 3300049663|Ga0501223_010890|Ga0501223_010890_185_1294 |
| Length | 346 |
| Sequence | VNKQLVSESLCIDHEAAWTVRPESDNLTNDPFASDLDRREMSLRLKGACSRGDECREGASKKTASVNRRVFPEWLVPMAATLTQDRFTGPEWIFERKFDGIRLLAYKKGSDVQLFSRNQLPQHLPAIQKAIERLPHEELILDGEITWRGGKVAYHVFDIMWMDGRNVTTLPLEERREFLAQLPFEDPLHRVALIDDPSPWELAQKEGWEGVIAKRRGSIYEHRRSKQWLKMKCELSQNFLVGGFTDPQGKRVGLGALLVGYFEDDDFVFAGKIGTGFDTKLLLDLRAQLDKLEIEKPPFTRAVGLPRVRAHWVQPKIEVKVGFIEWTVHGKLRHPRLLAVVDDHPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 36 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 42 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 43 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 44 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 45 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 46 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 47 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 103 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 104 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 105 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 106 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 107 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 108 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 109 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 110 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 111 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 112 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 113 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 114 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 115 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 116 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 117 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 118 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 119 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 145 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 146 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 147 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 148 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 149 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 153 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 154 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 155 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 156 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 157 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 159 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 161 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.24 |
| Rhizosphere | 98.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10000099 | 3300002459 | Bacteria | 47837 |
| 2 | JGI25406J46586_10000678 | 3300003203 | Bacteria | 15835 |
| 3 | Ga0065714_10064424 | 3300005288 | Bacteria | 236118 |
| 4 | Ga0065704_10206580 | 3300005289 | Bacteria | 1125 |
| 5 | Ga0065712_10000117 | 3300005290 | Bacteria | 235194 |
| 6 | Ga0065715_10089364 | 3300005293 | Bacteria | 10872 |
| 7 | Ga0070690_100240310 | 3300005330 | Bacteria | 1277 |
| 8 | Ga0070670_100000297 | 3300005331 | Bacteria | 43678 |
| 9 | Ga0070682_100000856 | 3300005337 | Bacteria | 17831 |
| 10 | Ga0070689_100001460 | 3300005340 | Bacteria | 15078 |
| 11 | Ga0070689_100507304 | 3300005340 | Unclassified | 1034 |
| 12 | Ga0070669_100116172 | 3300005353 | Bacteria | 2036 |
| 13 | Ga0070671_100001838 | 3300005355 | Bacteria | 16158 |
| 14 | Ga0070673_100525446 | 3300005364 | Bacteria | 1073 |
| 15 | Ga0070688_100184594 | 3300005365 | Bacteria | 1449 |
| 16 | Ga0070688_100306712 | 3300005365 | Bacteria | 1149 |
| 17 | Ga0070701_10070841 | 3300005438 | Bacteria | 1863 |
| 18 | Ga0070705_100135256 | 3300005440 | Unclassified | 1614 |
| 19 | Ga0070705_100196908 | 3300005440 | Unclassified | 1378 |
| 20 | Ga0070700_100493526 | 3300005441 | Unclassified | 940 |
| 21 | Ga0070694_100105680 | 3300005444 | Bacteria | 1998 |
| 22 | Ga0070694_100162476 | 3300005444 | Bacteria | 1640 |
| 23 | Ga0070678_100360630 | 3300005456 | Bacteria | 1252 |
| 24 | Ga0068867_100086897 | 3300005459 | Unclassified | 2367 |
| 25 | Ga0070698_100448261 | 3300005471 | Bacteria | 1226 |
| 26 | Ga0070699_100025203 | 3300005518 | Bacteria | 5129 |
| 27 | Ga0070699_100097602 | 3300005518 | Bacteria | 2574 |
| 28 | Ga0070699_100112880 | 3300005518 | Unclassified | 2387 |
| 29 | Ga0070699_100390640 | 3300005518 | Unclassified | 1257 |
| 30 | Ga0070679_100001193 | 3300005530 | Bacteria | 22833 |
| 31 | Ga0070697_100315068 | 3300005536 | Bacteria | 1346 |
| 32 | Ga0070686_100336087 | 3300005544 | Bacteria | 1131 |
| 33 | Ga0070695_100416374 | 3300005545 | Unclassified | 1022 |
| 34 | Ga0070696_100000515 | 3300005546 | Bacteria | 24519 |
| 35 | Ga0070693_100006294 | 3300005547 | Bacteria | 5753 |
| 36 | Ga0070693_100362599 | 3300005547 | Bacteria | 995 |
| 37 | Ga0068855_100105882 | 3300005563 | Unclassified | 3233 |
| 38 | Ga0070664_100188361 | 3300005564 | Bacteria | 1837 |
| 39 | Ga0070702_100008995 | 3300005615 | Bacteria | 4866 |
| 40 | Ga0068852_100457477 | 3300005616 | Viruses | 1264 |
| 41 | Ga0068859_100005380 | 3300005617 | Bacteria | 13019 |
| 42 | Ga0068859_100026463 | 3300005617 | Bacteria | 5818 |
| 43 | Ga0068859_100098054 | 3300005617 | Unclassified | 2985 |
| 44 | Ga0068859_100166603 | 3300005617 | Bacteria | 2283 |
| 45 | Ga0068859_100466360 | 3300005617 | Bacteria | 1359 |
| 46 | Ga0068864_100009138 | 3300005618 | Bacteria | 8171 |
| 47 | Ga0068864_100017410 | 3300005618 | Bacteria | 5991 |
| 48 | Ga0068851_10012842 | 3300005834 | Unclassified | 3956 |
| 49 | Ga0068870_10224544 | 3300005840 | Bacteria | 1151 |
| 50 | Ga0068863_100022684 | 3300005841 | Bacteria | 5995 |
| 51 | Ga0068863_100104853 | 3300005841 | Bacteria | 2690 |
| 52 | Ga0068858_100054638 | 3300005842 | Bacteria | 3693 |
| 53 | Ga0068858_100248731 | 3300005842 | Archaea | 1688 |
| 54 | Ga0068860_100156780 | 3300005843 | Bacteria | 2194 |
| 55 | Ga0068860_100205924 | 3300005843 | Unclassified | 1908 |
| 56 | Ga0068860_100250719 | 3300005843 | Bacteria | 1724 |
| 57 | Ga0068862_100081923 | 3300005844 | Bacteria | 2800 |
| 58 | Ga0081539_10000545 | 3300005985 | Bacteria | 77830 |
| 59 | Ga0081539_10004067 | 3300005985 | Bacteria | 16722 |
| 60 | Ga0075428_100015087 | 3300006844 | Bacteria | 8582 |
| 61 | Ga0075430_100001430 | 3300006846 | Bacteria | 19417 |
| 62 | Ga0075431_100054735 | 3300006847 | Bacteria | 4114 |
| 63 | Ga0075433_10066393 | 3300006852 | Unclassified | 3166 |
| 64 | Ga0075434_100012285 | 3300006871 | Bacteria | 8114 |
| 65 | Ga0075434_100154336 | 3300006871 | Unclassified | 2316 |
| 66 | Ga0075434_100250374 | 3300006871 | Unclassified | 1791 |
| 67 | Ga0075434_100384189 | 3300006871 | Bacteria | 1425 |
| 68 | Ga0075436_100019061 | 3300006914 | Unclassified | 4701 |
| 69 | Ga0097620_100005380 | 3300006931 | Bacteria | 13019 |
| 70 | Ga0097620_100026463 | 3300006931 | Bacteria | 5818 |
| 71 | Ga0097620_100098055 | 3300006931 | Unclassified | 2985 |
| 72 | Ga0097620_100166604 | 3300006931 | Bacteria | 2283 |
| 73 | Ga0097620_100466345 | 3300006931 | Bacteria | 1359 |
| 74 | Ga0075435_100015962 | 3300007076 | Bacteria | 5655 |
| 75 | Ga0105240_10190321 | 3300009093 | Unclassified | 2413 |
| 76 | Ga0105240_10341633 | 3300009093 | Unclassified | 1700 |
| 77 | Ga0111539_10038722 | 3300009094 | Bacteria | 5753 |
| 78 | Ga0105245_10705466 | 3300009098 | Unclassified | 1042 |
| 79 | Ga0114129_10037470 | 3300009147 | Bacteria | 6845 |
| 80 | Ga0114129_10058525 | 3300009147 | Bacteria | 5390 |
| 81 | Ga0114129_10220402 | 3300009147 | Bacteria | 2559 |
| 82 | Ga0114129_10328825 | 3300009147 | Bacteria | 2030 |
| 83 | Ga0114129_10402431 | 3300009147 | Unclassified | 1804 |
| 84 | Ga0105243_10068007 | 3300009148 | Bacteria | 2870 |
| 85 | Ga0105241_10070171 | 3300009174 | Bacteria | 2718 |
| 86 | Ga0105241_10077480 | 3300009174 | Bacteria | 2595 |
| 87 | Ga0105241_10383476 | 3300009174 | Bacteria | 1229 |
| 88 | Ga0105242_10014689 | 3300009176 | Bacteria | 6063 |
| 89 | Ga0105242_10087813 | 3300009176 | Unclassified | 2611 |
| 90 | Ga0105248_10336767 | 3300009177 | Unclassified | 1699 |
| 91 | Ga0105248_10515318 | 3300009177 | Bacteria | 1348 |
| 92 | Ga0105237_10006297 | 3300009545 | Bacteria | 13197 |
| 93 | Ga0105237_10008860 | 3300009545 | Bacteria | 10847 |
| 94 | Ga0105237_10646037 | 3300009545 | Bacteria | 1065 |
| 95 | Ga0105238_10017354 | 3300009551 | Bacteria | 7313 |
| 96 | Ga0105249_10032316 | 3300009553 | Bacteria | 4733 |
| 97 | Ga0105249_10208247 | 3300009553 | Bacteria | 1917 |
| 98 | Ga0105249_10330075 | 3300009553 | Unclassified | 1539 |
| 99 | Ga0105239_10074262 | 3300010375 | Unclassified | 3739 |
| 100 | Ga0105246_10108194 | 3300011119 | Bacteria | 2037 |
| 101 | Ga0157373_10007941 | 3300013100 | Bacteria | 7890 |
| 102 | Ga0157373_10306107 | 3300013100 | Bacteria | 1129 |
| 103 | Ga0157374_10024176 | 3300013296 | Bacteria | 5444 |
| 104 | Ga0157374_10294158 | 3300013296 | Unclassified | 1606 |
| 105 | Ga0157378_10131211 | 3300013297 | Bacteria | 2319 |
| 106 | Ga0163162_10498309 | 3300013306 | Unclassified | 1348 |
| 107 | Ga0157372_10013874 | 3300013307 | Bacteria | 8607 |
| 108 | Ga0157375_10034313 | 3300013308 | Bacteria | 4833 |
| 109 | Ga0157375_10129365 | 3300013308 | Bacteria | 2643 |
| 110 | Ga0157375_10172440 | 3300013308 | Bacteria | 2311 |
| 111 | Ga0157375_10449360 | 3300013308 | Bacteria | 1454 |
| 112 | Ga0163163_10002089 | 3300014325 | Bacteria | 16871 |
| 113 | Ga0163163_10064934 | 3300014325 | Bacteria | 3622 |
| 114 | Ga0163163_10065528 | 3300014325 | Bacteria | 3606 |
| 115 | Ga0163163_10334201 | 3300014325 | Unclassified | 1570 |
| 116 | Ga0157377_10268235 | 3300014745 | Viruses | 1114 |
| 117 | Ga0207656_10007814 | 3300025321 | Unclassified | 3915 |
| 118 | Ga0207710_10003304 | 3300025900 | Bacteria | 7210 |
| 119 | Ga0207647_10094655 | 3300025904 | Bacteria | 1779 |
| 120 | Ga0207684_10000327 | 3300025910 | Bacteria | 67005 |
| 121 | Ga0207654_10054032 | 3300025911 | Unclassified | 2321 |
| 122 | Ga0207707_10007357 | 3300025912 | Bacteria | 9590 |
| 123 | Ga0207671_10005001 | 3300025914 | Bacteria | 12412 |
| 124 | Ga0207652_10006896 | 3300025921 | Bacteria | 9152 |
| 125 | Ga0207652_10206410 | 3300025921 | Bacteria | 1769 |
| 126 | Ga0207681_10029214 | 3300025923 | Bacteria | 3578 |
| 127 | Ga0207694_10000842 | 3300025924 | Bacteria | 27303 |
| 128 | Ga0207650_10000313 | 3300025925 | Bacteria | 47889 |
| 129 | Ga0207650_10266895 | 3300025925 | Bacteria | 1390 |
| 130 | Ga0207644_10056724 | 3300025931 | Unclassified | 2827 |
| 131 | Ga0207686_10038549 | 3300025934 | Bacteria | 2893 |
| 132 | Ga0207709_10075452 | 3300025935 | Bacteria | 2155 |
| 133 | Ga0207670_10002291 | 3300025936 | Bacteria | 10029 |
| 134 | Ga0207691_10068124 | 3300025940 | Bacteria | 3216 |
| 135 | Ga0207711_10067130 | 3300025941 | Unclassified | 3104 |
| 136 | Ga0207711_10490480 | 3300025941 | Viruses | 1145 |
| 137 | Ga0207689_10246861 | 3300025942 | Unclassified | 1476 |
| 138 | Ga0207661_10279871 | 3300025944 | Bacteria | 1491 |
| 139 | Ga0207667_10157148 | 3300025949 | Unclassified | 2339 |
| 140 | Ga0207651_10129081 | 3300025960 | Bacteria | 1932 |
| 141 | Ga0207712_10002894 | 3300025961 | Bacteria | 10973 |
| 142 | Ga0207640_10553163 | 3300025981 | Unclassified | 967 |
| 143 | Ga0207677_10425462 | 3300026023 | Archaea | 1132 |
| 144 | Ga0207703_10165508 | 3300026035 | Unclassified | 1940 |
| 145 | Ga0207703_10278360 | 3300026035 | Unclassified | 1518 |
| 146 | Ga0207708_10054389 | 3300026075 | Bacteria | 3052 |
| 147 | Ga0207708_10197816 | 3300026075 | Unclassified | 1602 |
| 148 | Ga0207708_10252976 | 3300026075 | Unclassified | 1420 |
| 149 | Ga0207641_10096122 | 3300026088 | Bacteria | 2601 |
| 150 | Ga0207648_10103672 | 3300026089 | Unclassified | 2494 |
| 151 | Ga0207676_10003354 | 3300026095 | Bacteria | 11349 |
| 152 | Ga0207676_10047908 | 3300026095 | Bacteria | 3314 |
| 153 | Ga0207676_10222957 | 3300026095 | Unclassified | 1680 |
| 154 | Ga0207698_10161594 | 3300026142 | Bacteria | 1960 |
| 155 | Ga0207698_10218968 | 3300026142 | Unclassified | 1719 |
| 156 | Ga0268264_10115872 | 3300028381 | Unclassified | 2354 |
| 157 | Ga0268264_10159843 | 3300028381 | Unclassified | 2028 |
| 158 | Ga0307413_10067553 | 3300031824 | Bacteria | 2236 |
| 159 | Ga0307410_10029728 | 3300031852 | Bacteria | 3483 |
| 160 | Ga0307410_10071156 | 3300031852 | Unclassified | 2412 |
| 161 | Ga0307409_100183828 | 3300031995 | Bacteria | 1853 |
| 162 | Ga0307416_100324239 | 3300032002 | Bacteria | 1544 |
| 163 | Ga0307411_10014482 | 3300032005 | Bacteria | 4391 |
| 164 | Ga0307411_10088899 | 3300032005 | Bacteria | 2150 |
| 165 | Ga0307415_100109304 | 3300032126 | Unclassified | 2048 |
| 166 | Ga0307415_100136265 | 3300032126 | Bacteria | 1867 |
| 167 | Ga0373951_0002266 | 3300035091 | Unclassified | 4891 |
| 168 | Ga0373954_0043570 | 3300035118 | Bacteria | 2093 |
| 169 | Ga0373931_0375241 | 3300035691 | Unclassified | 895 |
| 170 | Ga0373937_0155464 | 3300036401 | Bacteria | 2143 |
| 171 | Ga0395899_0234626 | 3300037312 | Bacteria | 1265 |
| 172 | Ga0395900_0240161 | 3300037418 | Bacteria | 1818 |
| 173 | Ga0395905_0294458 | 3300037471 | Bacteria | 1510 |
| 174 | Ga0395901_0296561 | 3300038443 | Bacteria | 1677 |
| 175 | Ga0439435_0006123 | 3300042436 | Bacteria | 2689 |
| 176 | Ga0453683_0320061 | 3300044673 | Unclassified | 994 |
| 177 | Ga0451576_0191744 | 3300045051 | Bacteria | 2135 |
| 178 | Ga0495592_0035177 | 3300046454 | Bacteria | 3774 |
| 179 | Ga0495629_0185736 | 3300046459 | Bacteria | 1440 |
| 180 | Ga0495651_0120997 | 3300046462 | Bacteria | 1923 |
| 181 | Ga0495580_0068129 | 3300046472 | Bacteria | 2489 |
| 182 | Ga0495582_0016657 | 3300046473 | Bacteria | 4025 |
| 183 | Ga0495662_0002595 | 3300046476 | Bacteria | 9134 |
| 184 | Ga0495664_0006187 | 3300046477 | Bacteria | 6608 |
| 185 | Ga0495594_0099530 | 3300046499 | Unclassified | 1635 |
| 186 | Ga0495618_0020812 | 3300046514 | Bacteria | 4038 |
| 187 | Ga0495628_0066390 | 3300046516 | Bacteria | 2820 |
| 188 | Ga0495630_0036476 | 3300046517 | Bacteria | 3676 |
| 189 | Ga0495640_0068237 | 3300046533 | Bacteria | 2393 |
| 190 | Ga0495587_0048860 | 3300046536 | Bacteria | 2505 |
| 191 | Ga0495645_0180328 | 3300046543 | Bacteria | 1447 |
| 192 | Ga0495667_0246580 | 3300046559 | Unclassified | 1137 |
| 193 | Ga0495634_0034761 | 3300046642 | Bacteria | 3456 |
| 194 | Ga0495634_0097270 | 3300046642 | Bacteria | 1906 |
| 195 | Ga0495635_0057728 | 3300046663 | Bacteria | 2670 |
| 196 | Ga0495599_0070068 | 3300046678 | Bacteria | 2188 |
| 197 | Ga0495623_0280293 | 3300046679 | Bacteria | 928 |
| 198 | Ga0495646_0138828 | 3300046680 | Bacteria | 1361 |
| 199 | Ga0495674_0043348 | 3300047319 | Bacteria | 4005 |
| 200 | Ga0495680_0142141 | 3300047322 | Bacteria | 1755 |
| 201 | Ga0495680_0175880 | 3300047322 | Bacteria | 1548 |
| 202 | Ga0495675_0298140 | 3300047444 | Bacteria | 958 |
| 203 | Ga0495684_0326637 | 3300047471 | Bacteria | 1095 |
| 204 | Ga0495602_0160935 | 3300048088 | Bacteria | 1753 |
| 205 | Ga0496110_0081738 | 3300048913 | Bacteria | 2881 |
| 206 | Ga0496113_0094732 | 3300048916 | Bacteria | 2307 |
| 207 | Ga0496114_0280090 | 3300048917 | Bacteria | 1470 |
| 208 | Ga0501291_012602 | 3300049514 | Bacteria | 1237 |
| 209 | Ga0501296_005408 | 3300049519 | Bacteria | 1424 |
| 210 | Ga0501068_0323181 | 3300049584 | Bacteria | 989 |
| 211 | Ga0501071_0140228 | 3300049587 | Bacteria | 1800 |
| 212 | Ga0501076_0045056 | 3300049592 | Bacteria | 3481 |
| 213 | Ga0501202_003710 | 3300049652 | Bacteria | 2631 |
| 214 | Ga0501216_003022 | 3300049660 | Bacteria | 2430 |
| 215 | Ga0501223_010890 | 3300049663 | Bacteria | 1826 |
| 216 | Ga0501227_025122 | 3300049665 | Bacteria | 1396 |
| 217 | Ga0501234_001878 | 3300049707 | Bacteria | 3316 |
| 218 | Ga0501080_0071119 | 3300049742 | Bacteria | 3236 |
| 219 | Ga0501278_002819 | 3300049774 | Bacteria | 1220 |
| 220 | Ga0501045_0149006 | 3300049824 | Bacteria | 1740 |
| 221 | Ga0501212_002558 | 3300049851 | Bacteria | 2205 |
| 222 | nmdc:mga05p37_110_c1 | 3300050507 | Bacteria | 74328 |
| 223 | nmdc:mga05p37_147431_c1 | 3300050507 | Bacteria | 2880 |
| 224 | nmdc:mga05p37_621154_c1 | 3300050507 | Unclassified | 1216 |
| 225 | nmdc:mga05p37_92329_c1 | 3300050507 | Unclassified | 3730 |
| 226 | nmdc:mga09592_100715_c1 | 3300050508 | Bacteria | 2474 |
| 227 | nmdc:mga09592_462189_c1 | 3300050508 | Bacteria | 1094 |
| 228 | nmdc:mga0qj67_5696_c1 | 3300050509 | Bacteria | 9110 |
| 229 | nmdc:mga0n895_107865_c1 | 3300050512 | Bacteria | 2799 |
| 230 | nmdc:mga0n895_62241_c1 | 3300050512 | Bacteria | 3687 |
| 231 | nmdc:mga0n895_93197_c1 | 3300050512 | Bacteria | 3015 |
| 232 | nmdc:mga0rr50_187641_c1 | 3300050513 | Bacteria | 1693 |
| 233 | nmdc:mga0rr50_20464_c1 | 3300050513 | Bacteria | 4495 |
| 234 | nmdc:mga0a205_100079_c1 | 3300050515 | Bacteria | 2798 |
| 235 | nmdc:mga0a205_17128_c1 | 3300050515 | Bacteria | 6786 |
| 236 | nmdc:mga0a205_207614_c1 | 3300050515 | Bacteria | 1848 |
| 237 | nmdc:mga0a205_54522_c1 | 3300050515 | Bacteria | 3860 |
| 238 | Ga0495601_0066899 | 3300053077 | Bacteria | 2288 |
| 239 | Ga0495601_0149682 | 3300053077 | Bacteria | 1524 |
| 240 | Ga0501084_0192452 | 3300054114 | Bacteria | 1721 |
| 241 | Ga0501082_0559636 | 3300060353 | Bacteria | 1000 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042436 | Ga0439435_0006123 | Ga0439435_0006123_1739_2626 | 267 |
| 2 | 3300005444 | Ga0070694_100162476 | Ga0070694_1001624762 | 271 |
| 3 | 3300005364 | Ga0070673_100525446 | Ga0070673_1005254461 | 273 |
| 4 | 3300005365 | Ga0070688_100306712 | Ga0070688_1003067122 | 273 |
| 5 | 3300031995 | Ga0307409_100183828 | Ga0307409_1001838282 | 273 |
| 6 | 3300049584 | Ga0501068_0323181 | Ga0501068_0323181_143_973 | 273 |
| 7 | 3300049587 | Ga0501071_0140228 | Ga0501071_0140228_61_891 | 273 |
| 8 | 3300049592 | Ga0501076_0045056 | Ga0501076_0045056_986_1816 | 273 |
| 9 | 3300049742 | Ga0501080_0071119 | Ga0501080_0071119_807_1637 | 273 |
| 10 | 3300049824 | Ga0501045_0149006 | Ga0501045_0149006_307_1137 | 273 |
| 11 | 3300054114 | Ga0501084_0192452 | Ga0501084_0192452_347_1177 | 273 |
| 12 | 3300005365 | Ga0070688_100184594 | Ga0070688_1001845942 | 274 |
| 13 | 3300036401 | Ga0373937_0155464 | Ga0373937_0155464_691_1548 | 274 |
| 14 | 3300003203 | JGI25406J46586_10000678 | JGI25406J46586_100006787 | 275 |
| 15 | 3300005340 | Ga0070689_100001460 | Ga0070689_10000146016 | 275 |
| 16 | 3300005459 | Ga0068867_100086897 | Ga0068867_1000868972 | 275 |
| 17 | 3300005617 | Ga0068859_100098054 | Ga0068859_1000980542 | 275 |
| 18 | 3300005618 | Ga0068864_100009138 | Ga0068864_1000091385 | 275 |
| 19 | 3300005840 | Ga0068870_10224544 | Ga0068870_102245441 | 275 |
| 20 | 3300005841 | Ga0068863_100022684 | Ga0068863_1000226843 | 275 |
| 21 | 3300005985 | Ga0081539_10000545 | Ga0081539_100005459 | 275 |
| 22 | 3300005985 | Ga0081539_10004067 | Ga0081539_1000406716 | 275 |
| 23 | 3300006871 | Ga0075434_100154336 | Ga0075434_1001543362 | 275 |
| 24 | 3300006871 | Ga0075434_100250374 | Ga0075434_1002503742 | 275 |
| 25 | 3300006931 | Ga0097620_100098055 | Ga0097620_1000980552 | 275 |
| 26 | 3300007076 | Ga0075435_100015962 | Ga0075435_1000159622 | 275 |
| 27 | 3300009093 | Ga0105240_10190321 | Ga0105240_101903212 | 275 |
| 28 | 3300009147 | Ga0114129_10037470 | Ga0114129_100374702 | 275 |
| 29 | 3300009177 | Ga0105248_10515318 | Ga0105248_105153182 | 275 |
| 30 | 3300009545 | Ga0105237_10646037 | Ga0105237_106460371 | 275 |
| 31 | 3300009553 | Ga0105249_10208247 | Ga0105249_102082471 | 275 |
| 32 | 3300010375 | Ga0105239_10074262 | Ga0105239_100742622 | 275 |
| 33 | 3300013306 | Ga0163162_10498309 | Ga0163162_104983092 | 275 |
| 34 | 3300013308 | Ga0157375_10172440 | Ga0157375_101724402 | 275 |
| 35 | 3300025936 | Ga0207670_10002291 | Ga0207670_1000229110 | 275 |
| 36 | 3300025941 | Ga0207711_10067130 | Ga0207711_100671304 | 275 |
| 37 | 3300026088 | Ga0207641_10096122 | Ga0207641_100961223 | 275 |
| 38 | 3300026095 | Ga0207676_10003354 | Ga0207676_1000335412 | 275 |
| 39 | 3300035118 | Ga0373954_0043570 | Ga0373954_0043570_1160_2020 | 275 |
| 40 | 3300035691 | Ga0373931_0375241 | Ga0373931_0375241_17_883 | 275 |
| 41 | 3300046454 | Ga0495592_0035177 | Ga0495592_0035177_2887_3747 | 275 |
| 42 | 3300046459 | Ga0495629_0185736 | Ga0495629_0185736_46_906 | 275 |
| 43 | 3300046462 | Ga0495651_0120997 | Ga0495651_0120997_856_1716 | 275 |
| 44 | 3300046476 | Ga0495662_0002595 | Ga0495662_0002595_4834_5694 | 275 |
| 45 | 3300046477 | Ga0495664_0006187 | Ga0495664_0006187_5549_6409 | 275 |
| 46 | 3300046514 | Ga0495618_0020812 | Ga0495618_0020812_3096_3956 | 275 |
| 47 | 3300046516 | Ga0495628_0066390 | Ga0495628_0066390_668_1528 | 275 |
| 48 | 3300046533 | Ga0495640_0068237 | Ga0495640_0068237_1181_2041 | 275 |
| 49 | 3300046536 | Ga0495587_0048860 | Ga0495587_0048860_893_1753 | 275 |
| 50 | 3300046543 | Ga0495645_0180328 | Ga0495645_0180328_396_1256 | 275 |
| 51 | 3300046642 | Ga0495634_0034761 | Ga0495634_0034761_2420_3280 | 275 |
| 52 | 3300046663 | Ga0495635_0057728 | Ga0495635_0057728_1785_2645 | 275 |
| 53 | 3300046678 | Ga0495599_0070068 | Ga0495599_0070068_995_1855 | 275 |
| 54 | 3300046679 | Ga0495623_0280293 | Ga0495623_0280293_45_905 | 275 |
| 55 | 3300046680 | Ga0495646_0138828 | Ga0495646_0138828_264_1124 | 275 |
| 56 | 3300047319 | Ga0495674_0043348 | Ga0495674_0043348_2921_3781 | 275 |
| 57 | 3300047322 | Ga0495680_0142141 | Ga0495680_0142141_300_1160 | 275 |
| 58 | 3300047444 | Ga0495675_0298140 | Ga0495675_0298140_11_871 | 275 |
| 59 | 3300048088 | Ga0495602_0160935 | Ga0495602_0160935_44_904 | 275 |
| 60 | 3300048913 | Ga0496110_0081738 | Ga0496110_0081738_1304_2152 | 275 |
| 61 | 3300050512 | nmdc:mga0n895_62241_c1 | nmdc:mga0n895_62241_c1_1393_2253 | 275 |
| 62 | 3300050513 | nmdc:mga0rr50_20464_c1 | nmdc:mga0rr50_20464_c1_687_1547 | 275 |
| 63 | 3300053077 | Ga0495601_0149682 | Ga0495601_0149682_620_1480 | 275 |
| 64 | 3300060353 | Ga0501082_0559636 | Ga0501082_0559636_93_965 | 275 |
| 65 | 3300005441 | Ga0070700_100493526 | Ga0070700_1004935261 | 276 |
| 66 | 3300005563 | Ga0068855_100105882 | Ga0068855_1001058824 | 276 |
| 67 | 3300006844 | Ga0075428_100015087 | Ga0075428_1000150874 | 276 |
| 68 | 3300009553 | Ga0105249_10330075 | Ga0105249_103300753 | 276 |
| 69 | 3300013308 | Ga0157375_10129365 | Ga0157375_101293653 | 276 |
| 70 | 3300025944 | Ga0207661_10279871 | Ga0207661_102798712 | 276 |
| 71 | 3300025949 | Ga0207667_10157148 | Ga0207667_101571482 | 276 |
| 72 | 3300026075 | Ga0207708_10197816 | Ga0207708_101978161 | 276 |
| 73 | 3300026142 | Ga0207698_10218968 | Ga0207698_102189682 | 276 |
| 74 | 3300046472 | Ga0495580_0068129 | Ga0495580_0068129_1570_2430 | 276 |
| 75 | 3300046642 | Ga0495634_0097270 | Ga0495634_0097270_427_1287 | 276 |
| 76 | 3300047471 | Ga0495684_0326637 | Ga0495684_0326637_120_980 | 276 |
| 77 | 3300053077 | Ga0495601_0066899 | Ga0495601_0066899_221_1081 | 276 |
| 78 | 3300005289 | Ga0065704_10206580 | Ga0065704_102065801 | 277 |
| 79 | 3300005330 | Ga0070690_100240310 | Ga0070690_1002403101 | 277 |
| 80 | 3300005340 | Ga0070689_100507304 | Ga0070689_1005073041 | 277 |
| 81 | 3300005355 | Ga0070671_100001838 | Ga0070671_1000018387 | 277 |
| 82 | 3300005440 | Ga0070705_100196908 | Ga0070705_1001969082 | 277 |
| 83 | 3300005456 | Ga0070678_100360630 | Ga0070678_1003606301 | 277 |
| 84 | 3300005518 | Ga0070699_100097602 | Ga0070699_1000976022 | 277 |
| 85 | 3300005518 | Ga0070699_100112880 | Ga0070699_1001128803 | 277 |
| 86 | 3300005530 | Ga0070679_100001193 | Ga0070679_1000011933 | 277 |
| 87 | 3300005545 | Ga0070695_100416374 | Ga0070695_1004163741 | 277 |
| 88 | 3300005546 | Ga0070696_100000515 | Ga0070696_10000051514 | 277 |
| 89 | 3300005564 | Ga0070664_100188361 | Ga0070664_1001883612 | 277 |
| 90 | 3300005617 | Ga0068859_100466360 | Ga0068859_1004663602 | 277 |
| 91 | 3300005842 | Ga0068858_100248731 | Ga0068858_1002487312 | 277 |
| 92 | 3300005843 | Ga0068860_100250719 | Ga0068860_1002507192 | 277 |
| 93 | 3300005844 | Ga0068862_100081923 | Ga0068862_1000819233 | 277 |
| 94 | 3300006846 | Ga0075430_100001430 | Ga0075430_1000014303 | 277 |
| 95 | 3300006847 | Ga0075431_100054735 | Ga0075431_1000547352 | 277 |
| 96 | 3300006914 | Ga0075436_100019061 | Ga0075436_1000190613 | 277 |
| 97 | 3300006931 | Ga0097620_100466345 | Ga0097620_1004663452 | 277 |
| 98 | 3300009093 | Ga0105240_10341633 | Ga0105240_103416332 | 277 |
| 99 | 3300009147 | Ga0114129_10220402 | Ga0114129_102204023 | 277 |
| 100 | 3300009174 | Ga0105241_10070171 | Ga0105241_100701712 | 277 |
| 101 | 3300009176 | Ga0105242_10014689 | Ga0105242_100146892 | 277 |
| 102 | 3300009177 | Ga0105248_10336767 | Ga0105248_103367672 | 277 |
| 103 | 3300009545 | Ga0105237_10008860 | Ga0105237_100088607 | 277 |
| 104 | 3300013296 | Ga0157374_10024176 | Ga0157374_100241766 | 277 |
| 105 | 3300013296 | Ga0157374_10294158 | Ga0157374_102941582 | 277 |
| 106 | 3300013297 | Ga0157378_10131211 | Ga0157378_101312113 | 277 |
| 107 | 3300013308 | Ga0157375_10449360 | Ga0157375_104493602 | 277 |
| 108 | 3300014325 | Ga0163163_10064934 | Ga0163163_100649343 | 277 |
| 109 | 3300014325 | Ga0163163_10334201 | Ga0163163_103342011 | 277 |
| 110 | 3300025921 | Ga0207652_10006896 | Ga0207652_100068962 | 277 |
| 111 | 3300025921 | Ga0207652_10206410 | Ga0207652_102064101 | 277 |
| 112 | 3300025923 | Ga0207681_10029214 | Ga0207681_100292142 | 277 |
| 113 | 3300025931 | Ga0207644_10056724 | Ga0207644_100567243 | 277 |
| 114 | 3300026035 | Ga0207703_10278360 | Ga0207703_102783602 | 277 |
| 115 | 3300026075 | Ga0207708_10252976 | Ga0207708_102529762 | 277 |
| 116 | 3300032126 | Ga0307415_100109304 | Ga0307415_1001093041 | 277 |
| 117 | 3300037471 | Ga0395905_0294458 | Ga0395905_0294458_534_1427 | 277 |
| 118 | 3300046473 | Ga0495582_0016657 | Ga0495582_0016657_288_1154 | 277 |
| 119 | 3300046499 | Ga0495594_0099530 | Ga0495594_0099530_681_1547 | 277 |
| 120 | 3300046559 | Ga0495667_0246580 | Ga0495667_0246580_201_1067 | 277 |
| 121 | 3300048917 | Ga0496114_0280090 | Ga0496114_0280090_117_992 | 277 |
| 122 | 3300050507 | nmdc:mga05p37_110_c1 | nmdc:mga05p37_110_c1_34577_35443 | 277 |
| 123 | 3300050508 | nmdc:mga09592_100715_c1 | nmdc:mga09592_100715_c1_931_1845 | 277 |
| 124 | 3300050508 | nmdc:mga09592_462189_c1 | nmdc:mga09592_462189_c1_68_946 | 277 |
| 125 | 3300050509 | nmdc:mga0qj67_5696_c1 | nmdc:mga0qj67_5696_c1_1496_2410 | 277 |
| 126 | 3300050515 | nmdc:mga0a205_54522_c1 | nmdc:mga0a205_54522_c1_2954_3838 | 277 |
| 127 | 3300025925 | Ga0207650_10266895 | Ga0207650_102668952 | 278 |
| 128 | 3300031824 | Ga0307413_10067553 | Ga0307413_100675531 | 278 |
| 129 | 3300031852 | Ga0307410_10029728 | Ga0307410_100297282 | 278 |
| 130 | 3300032005 | Ga0307411_10088899 | Ga0307411_100888992 | 278 |
| 131 | 3300005288 | Ga0065714_10064424 | Ga0065714_1006442494 | 279 |
| 132 | 3300005290 | Ga0065712_10000117 | Ga0065712_1000011794 | 279 |
| 133 | 3300005293 | Ga0065715_10089364 | Ga0065715_100893647 | 279 |
| 134 | 3300005337 | Ga0070682_100000856 | Ga0070682_1000008566 | 279 |
| 135 | 3300005353 | Ga0070669_100116172 | Ga0070669_1001161722 | 279 |
| 136 | 3300005438 | Ga0070701_10070841 | Ga0070701_100708412 | 279 |
| 137 | 3300005440 | Ga0070705_100135256 | Ga0070705_1001352562 | 279 |
| 138 | 3300005444 | Ga0070694_100105680 | Ga0070694_1001056802 | 279 |
| 139 | 3300005471 | Ga0070698_100448261 | Ga0070698_1004482611 | 279 |
| 140 | 3300005518 | Ga0070699_100025203 | Ga0070699_1000252033 | 279 |
| 141 | 3300005518 | Ga0070699_100390640 | Ga0070699_1003906402 | 279 |
| 142 | 3300005544 | Ga0070686_100336087 | Ga0070686_1003360871 | 279 |
| 143 | 3300005547 | Ga0070693_100006294 | Ga0070693_1000062943 | 279 |
| 144 | 3300005547 | Ga0070693_100362599 | Ga0070693_1003625992 | 279 |
| 145 | 3300005615 | Ga0070702_100008995 | Ga0070702_1000089952 | 279 |
| 146 | 3300005616 | Ga0068852_100457477 | Ga0068852_1004574772 | 279 |
| 147 | 3300005617 | Ga0068859_100005380 | Ga0068859_10000538010 | 279 |
| 148 | 3300005617 | Ga0068859_100026463 | Ga0068859_1000264636 | 279 |
| 149 | 3300005617 | Ga0068859_100166603 | Ga0068859_1001666032 | 279 |
| 150 | 3300005618 | Ga0068864_100017410 | Ga0068864_1000174103 | 279 |
| 151 | 3300005834 | Ga0068851_10012842 | Ga0068851_100128423 | 279 |
| 152 | 3300005842 | Ga0068858_100054638 | Ga0068858_1000546382 | 279 |
| 153 | 3300005843 | Ga0068860_100156780 | Ga0068860_1001567802 | 279 |
| 154 | 3300005843 | Ga0068860_100205924 | Ga0068860_1002059242 | 279 |
| 155 | 3300006852 | Ga0075433_10066393 | Ga0075433_100663932 | 279 |
| 156 | 3300006871 | Ga0075434_100012285 | Ga0075434_1000122853 | 279 |
| 157 | 3300006931 | Ga0097620_100005380 | Ga0097620_10000538010 | 279 |
| 158 | 3300006931 | Ga0097620_100026463 | Ga0097620_1000264636 | 279 |
| 159 | 3300006931 | Ga0097620_100166604 | Ga0097620_1001666042 | 279 |
| 160 | 3300009094 | Ga0111539_10038722 | Ga0111539_100387224 | 279 |
| 161 | 3300009098 | Ga0105245_10705466 | Ga0105245_107054662 | 279 |
| 162 | 3300009147 | Ga0114129_10058525 | Ga0114129_100585253 | 279 |
| 163 | 3300009147 | Ga0114129_10328825 | Ga0114129_103288251 | 279 |
| 164 | 3300009147 | Ga0114129_10402431 | Ga0114129_104024312 | 279 |
| 165 | 3300009148 | Ga0105243_10068007 | Ga0105243_100680072 | 279 |
| 166 | 3300009174 | Ga0105241_10077480 | Ga0105241_100774802 | 279 |
| 167 | 3300009174 | Ga0105241_10383476 | Ga0105241_103834762 | 279 |
| 168 | 3300009176 | Ga0105242_10087813 | Ga0105242_100878133 | 279 |
| 169 | 3300009545 | Ga0105237_10006297 | Ga0105237_100062976 | 279 |
| 170 | 3300009551 | Ga0105238_10017354 | Ga0105238_100173545 | 279 |
| 171 | 3300009553 | Ga0105249_10032316 | Ga0105249_100323163 | 279 |
| 172 | 3300011119 | Ga0105246_10108194 | Ga0105246_101081942 | 279 |
| 173 | 3300013100 | Ga0157373_10007941 | Ga0157373_100079412 | 279 |
| 174 | 3300013100 | Ga0157373_10306107 | Ga0157373_103061071 | 279 |
| 175 | 3300013307 | Ga0157372_10013874 | Ga0157372_1001387410 | 279 |
| 176 | 3300013308 | Ga0157375_10034313 | Ga0157375_100343136 | 279 |
| 177 | 3300014325 | Ga0163163_10002089 | Ga0163163_1000208910 | 279 |
| 178 | 3300014325 | Ga0163163_10065528 | Ga0163163_100655282 | 279 |
| 179 | 3300014745 | Ga0157377_10268235 | Ga0157377_102682352 | 279 |
| 180 | 3300025321 | Ga0207656_10007814 | Ga0207656_100078143 | 279 |
| 181 | 3300025900 | Ga0207710_10003304 | Ga0207710_100033042 | 279 |
| 182 | 3300025904 | Ga0207647_10094655 | Ga0207647_100946552 | 279 |
| 183 | 3300025910 | Ga0207684_10000327 | Ga0207684_1000032760 | 279 |
| 184 | 3300025911 | Ga0207654_10054032 | Ga0207654_100540323 | 279 |
| 185 | 3300025912 | Ga0207707_10007357 | Ga0207707_100073575 | 279 |
| 186 | 3300025914 | Ga0207671_10005001 | Ga0207671_100050015 | 279 |
| 187 | 3300025924 | Ga0207694_10000842 | Ga0207694_100008428 | 279 |
| 188 | 3300025934 | Ga0207686_10038549 | Ga0207686_100385493 | 279 |
| 189 | 3300025935 | Ga0207709_10075452 | Ga0207709_100754522 | 279 |
| 190 | 3300025941 | Ga0207711_10490480 | Ga0207711_104904801 | 279 |
| 191 | 3300025942 | Ga0207689_10246861 | Ga0207689_102468612 | 279 |
| 192 | 3300025960 | Ga0207651_10129081 | Ga0207651_101290812 | 279 |
| 193 | 3300025961 | Ga0207712_10002894 | Ga0207712_100028943 | 279 |
| 194 | 3300025981 | Ga0207640_10553163 | Ga0207640_105531631 | 279 |
| 195 | 3300026035 | Ga0207703_10165508 | Ga0207703_101655081 | 279 |
| 196 | 3300026075 | Ga0207708_10054389 | Ga0207708_100543892 | 279 |
| 197 | 3300026089 | Ga0207648_10103672 | Ga0207648_101036724 | 279 |
| 198 | 3300026095 | Ga0207676_10047908 | Ga0207676_100479084 | 279 |
| 199 | 3300026095 | Ga0207676_10222957 | Ga0207676_102229572 | 279 |
| 200 | 3300026142 | Ga0207698_10161594 | Ga0207698_101615942 | 279 |
| 201 | 3300028381 | Ga0268264_10115872 | Ga0268264_101158722 | 279 |
| 202 | 3300028381 | Ga0268264_10159843 | Ga0268264_101598432 | 279 |
| 203 | 3300031852 | Ga0307410_10071156 | Ga0307410_100711562 | 279 |
| 204 | 3300032002 | Ga0307416_100324239 | Ga0307416_1003242391 | 279 |
| 205 | 3300032005 | Ga0307411_10014482 | Ga0307411_100144823 | 279 |
| 206 | 3300032126 | Ga0307415_100136265 | Ga0307415_1001362652 | 279 |
| 207 | 3300035091 | Ga0373951_0002266 | Ga0373951_0002266_250_1089 | 279 |
| 208 | 3300037312 | Ga0395899_0234626 | Ga0395899_0234626_189_1040 | 279 |
| 209 | 3300037418 | Ga0395900_0240161 | Ga0395900_0240161_840_1691 | 279 |
| 210 | 3300038443 | Ga0395901_0296561 | Ga0395901_0296561_164_1015 | 279 |
| 211 | 3300044673 | Ga0453683_0320061 | Ga0453683_0320061_31_876 | 279 |
| 212 | 3300045051 | Ga0451576_0191744 | Ga0451576_0191744_766_1611 | 279 |
| 213 | 3300049514 | Ga0501291_012602 | Ga0501291_012602_79_918 | 279 |
| 214 | 3300049519 | Ga0501296_005408 | Ga0501296_005408_152_1024 | 279 |
| 215 | 3300049652 | Ga0501202_003710 | Ga0501202_003710_1646_2518 | 279 |
| 216 | 3300049660 | Ga0501216_003022 | Ga0501216_003022_229_1101 | 279 |
| 217 | 3300049665 | Ga0501227_025122 | Ga0501227_025122_164_1006 | 279 |
| 218 | 3300049707 | Ga0501234_001878 | Ga0501234_001878_1048_1887 | 279 |
| 219 | 3300049774 | Ga0501278_002819 | Ga0501278_002819_239_1111 | 279 |
| 220 | 3300049851 | Ga0501212_002558 | Ga0501212_002558_1057_1896 | 279 |
| 221 | 3300050507 | nmdc:mga05p37_147431_c1 | nmdc:mga05p37_147431_c1_1486_2325 | 279 |
| 222 | 3300050507 | nmdc:mga05p37_621154_c1 | nmdc:mga05p37_621154_c1_234_1079 | 279 |
| 223 | 3300050507 | nmdc:mga05p37_92329_c1 | nmdc:mga05p37_92329_c1_2503_3354 | 279 |
| 224 | 3300050512 | nmdc:mga0n895_107865_c1 | nmdc:mga0n895_107865_c1_1790_2632 | 279 |
| 225 | 3300050513 | nmdc:mga0rr50_187641_c1 | nmdc:mga0rr50_187641_c1_67_918 | 279 |
| 226 | 3300050515 | nmdc:mga0a205_100079_c1 | nmdc:mga0a205_100079_c1_329_1171 | 279 |
| 227 | 3300050515 | nmdc:mga0a205_17128_c1 | nmdc:mga0a205_17128_c1_4168_5019 | 279 |
| 228 | 3300050515 | nmdc:mga0a205_207614_c1 | nmdc:mga0a205_207614_c1_846_1685 | 279 |
| 229 | 3300005536 | Ga0070697_100315068 | Ga0070697_1003150682 | 281 |
| 230 | 3300006871 | Ga0075434_100384189 | Ga0075434_1003841891 | 281 |
| 231 | 3300050512 | nmdc:mga0n895_93197_c1 | nmdc:mga0n895_93197_c1_284_1165 | 281 |
| 232 | 3300005841 | Ga0068863_100104853 | Ga0068863_1001048532 | 282 |
| 233 | 3300026023 | Ga0207677_10425462 | Ga0207677_104254622 | 282 |
| 234 | 3300025940 | Ga0207691_10068124 | Ga0207691_100681243 | 283 |
| 235 | 3300046517 | Ga0495630_0036476 | Ga0495630_0036476_2182_3120 | 283 |
| 236 | 3300047322 | Ga0495680_0175880 | Ga0495680_0175880_389_1327 | 283 |
| 237 | 3300002459 | JGI24751J29686_10000099 | JGI24751J29686_1000009916 | 286 |
| 238 | 3300005331 | Ga0070670_100000297 | Ga0070670_10000029732 | 286 |
| 239 | 3300025925 | Ga0207650_10000313 | Ga0207650_1000031316 | 286 |
| 240 | 3300048916 | Ga0496113_0094732 | Ga0496113_0094732_1041_2240 | 286 |
| 241 | 3300049663 | Ga0501223_010890 | Ga0501223_010890_185_1294 | 286 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7rpw-assembly1.cif.gz_E | archaeal dna ligase and heterotrimeric pcna in complex with adenylated dna | 0.8045 | 17 | 172 |
| 3vnn-assembly1.cif.gz_A | crystal structure of a sub-domain of the nucleotidyltransferase (adenylation) domain of human dna ligase iv | 0.8011 | 35 | 130 |
| 3nbz-assembly1.cif.gz_B | crystal structure of the hiv-1 rev nes-crm1-rangtp nuclear export complex (crystal i) | 0.7831 | 16 | 172 |
| 4e6n-assembly2.cif.gz_C | crystal structure of bacterial pnkp-c/hen1-n heterodimer | 0.7772 | 32 | 172 |
| 3ty9-assembly2.cif.gz_A | crystal structure of c. thermocellum pnkp ligase domain amp-adenylate | 0.7714 | 32 | 173 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WNV3_639_759_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9088 | 175 | 284 | 2.40.50.140 |
| af_P9WNV5_183_380_3.30.470.30 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme | 0.8595 | 16 | 172 | 3.30.470.30 |
| af_D4A0U6_241_453_3.30.470.30 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme | 0.8595 | 32 | 172 | 3.30.470.30 |
| af_O74833_247_463_3.30.470.30 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme | 0.8594 | 32 | 172 | 3.30.470.30 |
| af_Q08387_250_468_3.30.470.30 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme | 0.8553 | 16 | 172 | 3.30.470.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7TRP1-F1-model_v4 | ATP-dependent DNA ligase | 0.9553 | 8 | 143 |
GO:0003910
GO:0005524 GO:0006281 GO:0006310 |
| AF-A0A1L7I4J2-F1-model_v4 | DNA ligase (ATP) (EC 6.5.1.1) | 0.9513 | 173 | 284 |
GO:0003910
GO:0006281 GO:0006310 |
| AF-A0A3N5XLX0-F1-model_v4 | ATP-dependent DNA ligase | 0.9306 | 10 | 185 |
GO:0003677
GO:0003910 GO:0005524 GO:0006297 GO:0006303 GO:0006310 GO:0051103 |
| AF-A0A2V7VG75-F1-model_v4 | DNA ligase (ATP) (EC 6.5.1.1) | 0.9287 | 175 | 284 |
GO:0003910
GO:0005524 GO:0006281 GO:0006310 GO:0046872 |
| AF-A0A4Q3PR88-F1-model_v4 | deleted | 0.9248 | 95 | 280 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar