F354149

General Info

Members Datasets Scaffolds Average Seq Length
241 169 241 286

Family's Representative Sequence

Representative Sequence 3300049663|Ga0501223_010890|Ga0501223_010890_185_1294
Length 346
Sequence VNKQLVSESLCIDHEAAWTVRPESDNLTNDPFASDLDRREMSLRLKGACSRGDECREGASKKTASVNRRVFPEWLVPMAATLTQDRFTGPEWIFERKFDGIRLLAYKKGSDVQLFSRNQLPQHLPAIQKAIERLPHEELILDGEITWRGGKVAYHVFDIMWMDGRNVTTLPLEERREFLAQLPFEDPLHRVALIDDPSPWELAQKEGWEGVIAKRRGSIYEHRRSKQWLKMKCELSQNFLVGGFTDPQGKRVGLGALLVGYFEDDDFVFAGKIGTGFDTKLLLDLRAQLDKLEIEKPPFTRAVGLPRVRAHWVQPKIEVKVGFIEWTVHGKLRHPRLLAVVDDHPS

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
109 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
117 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
137 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
138 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
148 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
149 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
153 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
154 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
155 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
156 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.24
Rhizosphere 98.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000099 3300002459 Bacteria 47837
2 JGI25406J46586_10000678 3300003203 Bacteria 15835
3 Ga0065714_10064424 3300005288 Bacteria 236118
4 Ga0065704_10206580 3300005289 Bacteria 1125
5 Ga0065712_10000117 3300005290 Bacteria 235194
6 Ga0065715_10089364 3300005293 Bacteria 10872
7 Ga0070690_100240310 3300005330 Bacteria 1277
8 Ga0070670_100000297 3300005331 Bacteria 43678
9 Ga0070682_100000856 3300005337 Bacteria 17831
10 Ga0070689_100001460 3300005340 Bacteria 15078
11 Ga0070689_100507304 3300005340 Unclassified 1034
12 Ga0070669_100116172 3300005353 Bacteria 2036
13 Ga0070671_100001838 3300005355 Bacteria 16158
14 Ga0070673_100525446 3300005364 Bacteria 1073
15 Ga0070688_100184594 3300005365 Bacteria 1449
16 Ga0070688_100306712 3300005365 Bacteria 1149
17 Ga0070701_10070841 3300005438 Bacteria 1863
18 Ga0070705_100135256 3300005440 Unclassified 1614
19 Ga0070705_100196908 3300005440 Unclassified 1378
20 Ga0070700_100493526 3300005441 Unclassified 940
21 Ga0070694_100105680 3300005444 Bacteria 1998
22 Ga0070694_100162476 3300005444 Bacteria 1640
23 Ga0070678_100360630 3300005456 Bacteria 1252
24 Ga0068867_100086897 3300005459 Unclassified 2367
25 Ga0070698_100448261 3300005471 Bacteria 1226
26 Ga0070699_100025203 3300005518 Bacteria 5129
27 Ga0070699_100097602 3300005518 Bacteria 2574
28 Ga0070699_100112880 3300005518 Unclassified 2387
29 Ga0070699_100390640 3300005518 Unclassified 1257
30 Ga0070679_100001193 3300005530 Bacteria 22833
31 Ga0070697_100315068 3300005536 Bacteria 1346
32 Ga0070686_100336087 3300005544 Bacteria 1131
33 Ga0070695_100416374 3300005545 Unclassified 1022
34 Ga0070696_100000515 3300005546 Bacteria 24519
35 Ga0070693_100006294 3300005547 Bacteria 5753
36 Ga0070693_100362599 3300005547 Bacteria 995
37 Ga0068855_100105882 3300005563 Unclassified 3233
38 Ga0070664_100188361 3300005564 Bacteria 1837
39 Ga0070702_100008995 3300005615 Bacteria 4866
40 Ga0068852_100457477 3300005616 Viruses 1264
41 Ga0068859_100005380 3300005617 Bacteria 13019
42 Ga0068859_100026463 3300005617 Bacteria 5818
43 Ga0068859_100098054 3300005617 Unclassified 2985
44 Ga0068859_100166603 3300005617 Bacteria 2283
45 Ga0068859_100466360 3300005617 Bacteria 1359
46 Ga0068864_100009138 3300005618 Bacteria 8171
47 Ga0068864_100017410 3300005618 Bacteria 5991
48 Ga0068851_10012842 3300005834 Unclassified 3956
49 Ga0068870_10224544 3300005840 Bacteria 1151
50 Ga0068863_100022684 3300005841 Bacteria 5995
51 Ga0068863_100104853 3300005841 Bacteria 2690
52 Ga0068858_100054638 3300005842 Bacteria 3693
53 Ga0068858_100248731 3300005842 Archaea 1688
54 Ga0068860_100156780 3300005843 Bacteria 2194
55 Ga0068860_100205924 3300005843 Unclassified 1908
56 Ga0068860_100250719 3300005843 Bacteria 1724
57 Ga0068862_100081923 3300005844 Bacteria 2800
58 Ga0081539_10000545 3300005985 Bacteria 77830
59 Ga0081539_10004067 3300005985 Bacteria 16722
60 Ga0075428_100015087 3300006844 Bacteria 8582
61 Ga0075430_100001430 3300006846 Bacteria 19417
62 Ga0075431_100054735 3300006847 Bacteria 4114
63 Ga0075433_10066393 3300006852 Unclassified 3166
64 Ga0075434_100012285 3300006871 Bacteria 8114
65 Ga0075434_100154336 3300006871 Unclassified 2316
66 Ga0075434_100250374 3300006871 Unclassified 1791
67 Ga0075434_100384189 3300006871 Bacteria 1425
68 Ga0075436_100019061 3300006914 Unclassified 4701
69 Ga0097620_100005380 3300006931 Bacteria 13019
70 Ga0097620_100026463 3300006931 Bacteria 5818
71 Ga0097620_100098055 3300006931 Unclassified 2985
72 Ga0097620_100166604 3300006931 Bacteria 2283
73 Ga0097620_100466345 3300006931 Bacteria 1359
74 Ga0075435_100015962 3300007076 Bacteria 5655
75 Ga0105240_10190321 3300009093 Unclassified 2413
76 Ga0105240_10341633 3300009093 Unclassified 1700
77 Ga0111539_10038722 3300009094 Bacteria 5753
78 Ga0105245_10705466 3300009098 Unclassified 1042
79 Ga0114129_10037470 3300009147 Bacteria 6845
80 Ga0114129_10058525 3300009147 Bacteria 5390
81 Ga0114129_10220402 3300009147 Bacteria 2559
82 Ga0114129_10328825 3300009147 Bacteria 2030
83 Ga0114129_10402431 3300009147 Unclassified 1804
84 Ga0105243_10068007 3300009148 Bacteria 2870
85 Ga0105241_10070171 3300009174 Bacteria 2718
86 Ga0105241_10077480 3300009174 Bacteria 2595
87 Ga0105241_10383476 3300009174 Bacteria 1229
88 Ga0105242_10014689 3300009176 Bacteria 6063
89 Ga0105242_10087813 3300009176 Unclassified 2611
90 Ga0105248_10336767 3300009177 Unclassified 1699
91 Ga0105248_10515318 3300009177 Bacteria 1348
92 Ga0105237_10006297 3300009545 Bacteria 13197
93 Ga0105237_10008860 3300009545 Bacteria 10847
94 Ga0105237_10646037 3300009545 Bacteria 1065
95 Ga0105238_10017354 3300009551 Bacteria 7313
96 Ga0105249_10032316 3300009553 Bacteria 4733
97 Ga0105249_10208247 3300009553 Bacteria 1917
98 Ga0105249_10330075 3300009553 Unclassified 1539
99 Ga0105239_10074262 3300010375 Unclassified 3739
100 Ga0105246_10108194 3300011119 Bacteria 2037
101 Ga0157373_10007941 3300013100 Bacteria 7890
102 Ga0157373_10306107 3300013100 Bacteria 1129
103 Ga0157374_10024176 3300013296 Bacteria 5444
104 Ga0157374_10294158 3300013296 Unclassified 1606
105 Ga0157378_10131211 3300013297 Bacteria 2319
106 Ga0163162_10498309 3300013306 Unclassified 1348
107 Ga0157372_10013874 3300013307 Bacteria 8607
108 Ga0157375_10034313 3300013308 Bacteria 4833
109 Ga0157375_10129365 3300013308 Bacteria 2643
110 Ga0157375_10172440 3300013308 Bacteria 2311
111 Ga0157375_10449360 3300013308 Bacteria 1454
112 Ga0163163_10002089 3300014325 Bacteria 16871
113 Ga0163163_10064934 3300014325 Bacteria 3622
114 Ga0163163_10065528 3300014325 Bacteria 3606
115 Ga0163163_10334201 3300014325 Unclassified 1570
116 Ga0157377_10268235 3300014745 Viruses 1114
117 Ga0207656_10007814 3300025321 Unclassified 3915
118 Ga0207710_10003304 3300025900 Bacteria 7210
119 Ga0207647_10094655 3300025904 Bacteria 1779
120 Ga0207684_10000327 3300025910 Bacteria 67005
121 Ga0207654_10054032 3300025911 Unclassified 2321
122 Ga0207707_10007357 3300025912 Bacteria 9590
123 Ga0207671_10005001 3300025914 Bacteria 12412
124 Ga0207652_10006896 3300025921 Bacteria 9152
125 Ga0207652_10206410 3300025921 Bacteria 1769
126 Ga0207681_10029214 3300025923 Bacteria 3578
127 Ga0207694_10000842 3300025924 Bacteria 27303
128 Ga0207650_10000313 3300025925 Bacteria 47889
129 Ga0207650_10266895 3300025925 Bacteria 1390
130 Ga0207644_10056724 3300025931 Unclassified 2827
131 Ga0207686_10038549 3300025934 Bacteria 2893
132 Ga0207709_10075452 3300025935 Bacteria 2155
133 Ga0207670_10002291 3300025936 Bacteria 10029
134 Ga0207691_10068124 3300025940 Bacteria 3216
135 Ga0207711_10067130 3300025941 Unclassified 3104
136 Ga0207711_10490480 3300025941 Viruses 1145
137 Ga0207689_10246861 3300025942 Unclassified 1476
138 Ga0207661_10279871 3300025944 Bacteria 1491
139 Ga0207667_10157148 3300025949 Unclassified 2339
140 Ga0207651_10129081 3300025960 Bacteria 1932
141 Ga0207712_10002894 3300025961 Bacteria 10973
142 Ga0207640_10553163 3300025981 Unclassified 967
143 Ga0207677_10425462 3300026023 Archaea 1132
144 Ga0207703_10165508 3300026035 Unclassified 1940
145 Ga0207703_10278360 3300026035 Unclassified 1518
146 Ga0207708_10054389 3300026075 Bacteria 3052
147 Ga0207708_10197816 3300026075 Unclassified 1602
148 Ga0207708_10252976 3300026075 Unclassified 1420
149 Ga0207641_10096122 3300026088 Bacteria 2601
150 Ga0207648_10103672 3300026089 Unclassified 2494
151 Ga0207676_10003354 3300026095 Bacteria 11349
152 Ga0207676_10047908 3300026095 Bacteria 3314
153 Ga0207676_10222957 3300026095 Unclassified 1680
154 Ga0207698_10161594 3300026142 Bacteria 1960
155 Ga0207698_10218968 3300026142 Unclassified 1719
156 Ga0268264_10115872 3300028381 Unclassified 2354
157 Ga0268264_10159843 3300028381 Unclassified 2028
158 Ga0307413_10067553 3300031824 Bacteria 2236
159 Ga0307410_10029728 3300031852 Bacteria 3483
160 Ga0307410_10071156 3300031852 Unclassified 2412
161 Ga0307409_100183828 3300031995 Bacteria 1853
162 Ga0307416_100324239 3300032002 Bacteria 1544
163 Ga0307411_10014482 3300032005 Bacteria 4391
164 Ga0307411_10088899 3300032005 Bacteria 2150
165 Ga0307415_100109304 3300032126 Unclassified 2048
166 Ga0307415_100136265 3300032126 Bacteria 1867
167 Ga0373951_0002266 3300035091 Unclassified 4891
168 Ga0373954_0043570 3300035118 Bacteria 2093
169 Ga0373931_0375241 3300035691 Unclassified 895
170 Ga0373937_0155464 3300036401 Bacteria 2143
171 Ga0395899_0234626 3300037312 Bacteria 1265
172 Ga0395900_0240161 3300037418 Bacteria 1818
173 Ga0395905_0294458 3300037471 Bacteria 1510
174 Ga0395901_0296561 3300038443 Bacteria 1677
175 Ga0439435_0006123 3300042436 Bacteria 2689
176 Ga0453683_0320061 3300044673 Unclassified 994
177 Ga0451576_0191744 3300045051 Bacteria 2135
178 Ga0495592_0035177 3300046454 Bacteria 3774
179 Ga0495629_0185736 3300046459 Bacteria 1440
180 Ga0495651_0120997 3300046462 Bacteria 1923
181 Ga0495580_0068129 3300046472 Bacteria 2489
182 Ga0495582_0016657 3300046473 Bacteria 4025
183 Ga0495662_0002595 3300046476 Bacteria 9134
184 Ga0495664_0006187 3300046477 Bacteria 6608
185 Ga0495594_0099530 3300046499 Unclassified 1635
186 Ga0495618_0020812 3300046514 Bacteria 4038
187 Ga0495628_0066390 3300046516 Bacteria 2820
188 Ga0495630_0036476 3300046517 Bacteria 3676
189 Ga0495640_0068237 3300046533 Bacteria 2393
190 Ga0495587_0048860 3300046536 Bacteria 2505
191 Ga0495645_0180328 3300046543 Bacteria 1447
192 Ga0495667_0246580 3300046559 Unclassified 1137
193 Ga0495634_0034761 3300046642 Bacteria 3456
194 Ga0495634_0097270 3300046642 Bacteria 1906
195 Ga0495635_0057728 3300046663 Bacteria 2670
196 Ga0495599_0070068 3300046678 Bacteria 2188
197 Ga0495623_0280293 3300046679 Bacteria 928
198 Ga0495646_0138828 3300046680 Bacteria 1361
199 Ga0495674_0043348 3300047319 Bacteria 4005
200 Ga0495680_0142141 3300047322 Bacteria 1755
201 Ga0495680_0175880 3300047322 Bacteria 1548
202 Ga0495675_0298140 3300047444 Bacteria 958
203 Ga0495684_0326637 3300047471 Bacteria 1095
204 Ga0495602_0160935 3300048088 Bacteria 1753
205 Ga0496110_0081738 3300048913 Bacteria 2881
206 Ga0496113_0094732 3300048916 Bacteria 2307
207 Ga0496114_0280090 3300048917 Bacteria 1470
208 Ga0501291_012602 3300049514 Bacteria 1237
209 Ga0501296_005408 3300049519 Bacteria 1424
210 Ga0501068_0323181 3300049584 Bacteria 989
211 Ga0501071_0140228 3300049587 Bacteria 1800
212 Ga0501076_0045056 3300049592 Bacteria 3481
213 Ga0501202_003710 3300049652 Bacteria 2631
214 Ga0501216_003022 3300049660 Bacteria 2430
215 Ga0501223_010890 3300049663 Bacteria 1826
216 Ga0501227_025122 3300049665 Bacteria 1396
217 Ga0501234_001878 3300049707 Bacteria 3316
218 Ga0501080_0071119 3300049742 Bacteria 3236
219 Ga0501278_002819 3300049774 Bacteria 1220
220 Ga0501045_0149006 3300049824 Bacteria 1740
221 Ga0501212_002558 3300049851 Bacteria 2205
222 nmdc:mga05p37_110_c1 3300050507 Bacteria 74328
223 nmdc:mga05p37_147431_c1 3300050507 Bacteria 2880
224 nmdc:mga05p37_621154_c1 3300050507 Unclassified 1216
225 nmdc:mga05p37_92329_c1 3300050507 Unclassified 3730
226 nmdc:mga09592_100715_c1 3300050508 Bacteria 2474
227 nmdc:mga09592_462189_c1 3300050508 Bacteria 1094
228 nmdc:mga0qj67_5696_c1 3300050509 Bacteria 9110
229 nmdc:mga0n895_107865_c1 3300050512 Bacteria 2799
230 nmdc:mga0n895_62241_c1 3300050512 Bacteria 3687
231 nmdc:mga0n895_93197_c1 3300050512 Bacteria 3015
232 nmdc:mga0rr50_187641_c1 3300050513 Bacteria 1693
233 nmdc:mga0rr50_20464_c1 3300050513 Bacteria 4495
234 nmdc:mga0a205_100079_c1 3300050515 Bacteria 2798
235 nmdc:mga0a205_17128_c1 3300050515 Bacteria 6786
236 nmdc:mga0a205_207614_c1 3300050515 Bacteria 1848
237 nmdc:mga0a205_54522_c1 3300050515 Bacteria 3860
238 Ga0495601_0066899 3300053077 Bacteria 2288
239 Ga0495601_0149682 3300053077 Bacteria 1524
240 Ga0501084_0192452 3300054114 Bacteria 1721
241 Ga0501082_0559636 3300060353 Bacteria 1000

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042436 Ga0439435_0006123 Ga0439435_0006123_1739_2626 267
2 3300005444 Ga0070694_100162476 Ga0070694_1001624762 271
3 3300005364 Ga0070673_100525446 Ga0070673_1005254461 273
4 3300005365 Ga0070688_100306712 Ga0070688_1003067122 273
5 3300031995 Ga0307409_100183828 Ga0307409_1001838282 273
6 3300049584 Ga0501068_0323181 Ga0501068_0323181_143_973 273
7 3300049587 Ga0501071_0140228 Ga0501071_0140228_61_891 273
8 3300049592 Ga0501076_0045056 Ga0501076_0045056_986_1816 273
9 3300049742 Ga0501080_0071119 Ga0501080_0071119_807_1637 273
10 3300049824 Ga0501045_0149006 Ga0501045_0149006_307_1137 273
11 3300054114 Ga0501084_0192452 Ga0501084_0192452_347_1177 273
12 3300005365 Ga0070688_100184594 Ga0070688_1001845942 274
13 3300036401 Ga0373937_0155464 Ga0373937_0155464_691_1548 274
14 3300003203 JGI25406J46586_10000678 JGI25406J46586_100006787 275
15 3300005340 Ga0070689_100001460 Ga0070689_10000146016 275
16 3300005459 Ga0068867_100086897 Ga0068867_1000868972 275
17 3300005617 Ga0068859_100098054 Ga0068859_1000980542 275
18 3300005618 Ga0068864_100009138 Ga0068864_1000091385 275
19 3300005840 Ga0068870_10224544 Ga0068870_102245441 275
20 3300005841 Ga0068863_100022684 Ga0068863_1000226843 275
21 3300005985 Ga0081539_10000545 Ga0081539_100005459 275
22 3300005985 Ga0081539_10004067 Ga0081539_1000406716 275
23 3300006871 Ga0075434_100154336 Ga0075434_1001543362 275
24 3300006871 Ga0075434_100250374 Ga0075434_1002503742 275
25 3300006931 Ga0097620_100098055 Ga0097620_1000980552 275
26 3300007076 Ga0075435_100015962 Ga0075435_1000159622 275
27 3300009093 Ga0105240_10190321 Ga0105240_101903212 275
28 3300009147 Ga0114129_10037470 Ga0114129_100374702 275
29 3300009177 Ga0105248_10515318 Ga0105248_105153182 275
30 3300009545 Ga0105237_10646037 Ga0105237_106460371 275
31 3300009553 Ga0105249_10208247 Ga0105249_102082471 275
32 3300010375 Ga0105239_10074262 Ga0105239_100742622 275
33 3300013306 Ga0163162_10498309 Ga0163162_104983092 275
34 3300013308 Ga0157375_10172440 Ga0157375_101724402 275
35 3300025936 Ga0207670_10002291 Ga0207670_1000229110 275
36 3300025941 Ga0207711_10067130 Ga0207711_100671304 275
37 3300026088 Ga0207641_10096122 Ga0207641_100961223 275
38 3300026095 Ga0207676_10003354 Ga0207676_1000335412 275
39 3300035118 Ga0373954_0043570 Ga0373954_0043570_1160_2020 275
40 3300035691 Ga0373931_0375241 Ga0373931_0375241_17_883 275
41 3300046454 Ga0495592_0035177 Ga0495592_0035177_2887_3747 275
42 3300046459 Ga0495629_0185736 Ga0495629_0185736_46_906 275
43 3300046462 Ga0495651_0120997 Ga0495651_0120997_856_1716 275
44 3300046476 Ga0495662_0002595 Ga0495662_0002595_4834_5694 275
45 3300046477 Ga0495664_0006187 Ga0495664_0006187_5549_6409 275
46 3300046514 Ga0495618_0020812 Ga0495618_0020812_3096_3956 275
47 3300046516 Ga0495628_0066390 Ga0495628_0066390_668_1528 275
48 3300046533 Ga0495640_0068237 Ga0495640_0068237_1181_2041 275
49 3300046536 Ga0495587_0048860 Ga0495587_0048860_893_1753 275
50 3300046543 Ga0495645_0180328 Ga0495645_0180328_396_1256 275
51 3300046642 Ga0495634_0034761 Ga0495634_0034761_2420_3280 275
52 3300046663 Ga0495635_0057728 Ga0495635_0057728_1785_2645 275
53 3300046678 Ga0495599_0070068 Ga0495599_0070068_995_1855 275
54 3300046679 Ga0495623_0280293 Ga0495623_0280293_45_905 275
55 3300046680 Ga0495646_0138828 Ga0495646_0138828_264_1124 275
56 3300047319 Ga0495674_0043348 Ga0495674_0043348_2921_3781 275
57 3300047322 Ga0495680_0142141 Ga0495680_0142141_300_1160 275
58 3300047444 Ga0495675_0298140 Ga0495675_0298140_11_871 275
59 3300048088 Ga0495602_0160935 Ga0495602_0160935_44_904 275
60 3300048913 Ga0496110_0081738 Ga0496110_0081738_1304_2152 275
61 3300050512 nmdc:mga0n895_62241_c1 nmdc:mga0n895_62241_c1_1393_2253 275
62 3300050513 nmdc:mga0rr50_20464_c1 nmdc:mga0rr50_20464_c1_687_1547 275
63 3300053077 Ga0495601_0149682 Ga0495601_0149682_620_1480 275
64 3300060353 Ga0501082_0559636 Ga0501082_0559636_93_965 275
65 3300005441 Ga0070700_100493526 Ga0070700_1004935261 276
66 3300005563 Ga0068855_100105882 Ga0068855_1001058824 276
67 3300006844 Ga0075428_100015087 Ga0075428_1000150874 276
68 3300009553 Ga0105249_10330075 Ga0105249_103300753 276
69 3300013308 Ga0157375_10129365 Ga0157375_101293653 276
70 3300025944 Ga0207661_10279871 Ga0207661_102798712 276
71 3300025949 Ga0207667_10157148 Ga0207667_101571482 276
72 3300026075 Ga0207708_10197816 Ga0207708_101978161 276
73 3300026142 Ga0207698_10218968 Ga0207698_102189682 276
74 3300046472 Ga0495580_0068129 Ga0495580_0068129_1570_2430 276
75 3300046642 Ga0495634_0097270 Ga0495634_0097270_427_1287 276
76 3300047471 Ga0495684_0326637 Ga0495684_0326637_120_980 276
77 3300053077 Ga0495601_0066899 Ga0495601_0066899_221_1081 276
78 3300005289 Ga0065704_10206580 Ga0065704_102065801 277
79 3300005330 Ga0070690_100240310 Ga0070690_1002403101 277
80 3300005340 Ga0070689_100507304 Ga0070689_1005073041 277
81 3300005355 Ga0070671_100001838 Ga0070671_1000018387 277
82 3300005440 Ga0070705_100196908 Ga0070705_1001969082 277
83 3300005456 Ga0070678_100360630 Ga0070678_1003606301 277
84 3300005518 Ga0070699_100097602 Ga0070699_1000976022 277
85 3300005518 Ga0070699_100112880 Ga0070699_1001128803 277
86 3300005530 Ga0070679_100001193 Ga0070679_1000011933 277
87 3300005545 Ga0070695_100416374 Ga0070695_1004163741 277
88 3300005546 Ga0070696_100000515 Ga0070696_10000051514 277
89 3300005564 Ga0070664_100188361 Ga0070664_1001883612 277
90 3300005617 Ga0068859_100466360 Ga0068859_1004663602 277
91 3300005842 Ga0068858_100248731 Ga0068858_1002487312 277
92 3300005843 Ga0068860_100250719 Ga0068860_1002507192 277
93 3300005844 Ga0068862_100081923 Ga0068862_1000819233 277
94 3300006846 Ga0075430_100001430 Ga0075430_1000014303 277
95 3300006847 Ga0075431_100054735 Ga0075431_1000547352 277
96 3300006914 Ga0075436_100019061 Ga0075436_1000190613 277
97 3300006931 Ga0097620_100466345 Ga0097620_1004663452 277
98 3300009093 Ga0105240_10341633 Ga0105240_103416332 277
99 3300009147 Ga0114129_10220402 Ga0114129_102204023 277
100 3300009174 Ga0105241_10070171 Ga0105241_100701712 277
101 3300009176 Ga0105242_10014689 Ga0105242_100146892 277
102 3300009177 Ga0105248_10336767 Ga0105248_103367672 277
103 3300009545 Ga0105237_10008860 Ga0105237_100088607 277
104 3300013296 Ga0157374_10024176 Ga0157374_100241766 277
105 3300013296 Ga0157374_10294158 Ga0157374_102941582 277
106 3300013297 Ga0157378_10131211 Ga0157378_101312113 277
107 3300013308 Ga0157375_10449360 Ga0157375_104493602 277
108 3300014325 Ga0163163_10064934 Ga0163163_100649343 277
109 3300014325 Ga0163163_10334201 Ga0163163_103342011 277
110 3300025921 Ga0207652_10006896 Ga0207652_100068962 277
111 3300025921 Ga0207652_10206410 Ga0207652_102064101 277
112 3300025923 Ga0207681_10029214 Ga0207681_100292142 277
113 3300025931 Ga0207644_10056724 Ga0207644_100567243 277
114 3300026035 Ga0207703_10278360 Ga0207703_102783602 277
115 3300026075 Ga0207708_10252976 Ga0207708_102529762 277
116 3300032126 Ga0307415_100109304 Ga0307415_1001093041 277
117 3300037471 Ga0395905_0294458 Ga0395905_0294458_534_1427 277
118 3300046473 Ga0495582_0016657 Ga0495582_0016657_288_1154 277
119 3300046499 Ga0495594_0099530 Ga0495594_0099530_681_1547 277
120 3300046559 Ga0495667_0246580 Ga0495667_0246580_201_1067 277
121 3300048917 Ga0496114_0280090 Ga0496114_0280090_117_992 277
122 3300050507 nmdc:mga05p37_110_c1 nmdc:mga05p37_110_c1_34577_35443 277
123 3300050508 nmdc:mga09592_100715_c1 nmdc:mga09592_100715_c1_931_1845 277
124 3300050508 nmdc:mga09592_462189_c1 nmdc:mga09592_462189_c1_68_946 277
125 3300050509 nmdc:mga0qj67_5696_c1 nmdc:mga0qj67_5696_c1_1496_2410 277
126 3300050515 nmdc:mga0a205_54522_c1 nmdc:mga0a205_54522_c1_2954_3838 277
127 3300025925 Ga0207650_10266895 Ga0207650_102668952 278
128 3300031824 Ga0307413_10067553 Ga0307413_100675531 278
129 3300031852 Ga0307410_10029728 Ga0307410_100297282 278
130 3300032005 Ga0307411_10088899 Ga0307411_100888992 278
131 3300005288 Ga0065714_10064424 Ga0065714_1006442494 279
132 3300005290 Ga0065712_10000117 Ga0065712_1000011794 279
133 3300005293 Ga0065715_10089364 Ga0065715_100893647 279
134 3300005337 Ga0070682_100000856 Ga0070682_1000008566 279
135 3300005353 Ga0070669_100116172 Ga0070669_1001161722 279
136 3300005438 Ga0070701_10070841 Ga0070701_100708412 279
137 3300005440 Ga0070705_100135256 Ga0070705_1001352562 279
138 3300005444 Ga0070694_100105680 Ga0070694_1001056802 279
139 3300005471 Ga0070698_100448261 Ga0070698_1004482611 279
140 3300005518 Ga0070699_100025203 Ga0070699_1000252033 279
141 3300005518 Ga0070699_100390640 Ga0070699_1003906402 279
142 3300005544 Ga0070686_100336087 Ga0070686_1003360871 279
143 3300005547 Ga0070693_100006294 Ga0070693_1000062943 279
144 3300005547 Ga0070693_100362599 Ga0070693_1003625992 279
145 3300005615 Ga0070702_100008995 Ga0070702_1000089952 279
146 3300005616 Ga0068852_100457477 Ga0068852_1004574772 279
147 3300005617 Ga0068859_100005380 Ga0068859_10000538010 279
148 3300005617 Ga0068859_100026463 Ga0068859_1000264636 279
149 3300005617 Ga0068859_100166603 Ga0068859_1001666032 279
150 3300005618 Ga0068864_100017410 Ga0068864_1000174103 279
151 3300005834 Ga0068851_10012842 Ga0068851_100128423 279
152 3300005842 Ga0068858_100054638 Ga0068858_1000546382 279
153 3300005843 Ga0068860_100156780 Ga0068860_1001567802 279
154 3300005843 Ga0068860_100205924 Ga0068860_1002059242 279
155 3300006852 Ga0075433_10066393 Ga0075433_100663932 279
156 3300006871 Ga0075434_100012285 Ga0075434_1000122853 279
157 3300006931 Ga0097620_100005380 Ga0097620_10000538010 279
158 3300006931 Ga0097620_100026463 Ga0097620_1000264636 279
159 3300006931 Ga0097620_100166604 Ga0097620_1001666042 279
160 3300009094 Ga0111539_10038722 Ga0111539_100387224 279
161 3300009098 Ga0105245_10705466 Ga0105245_107054662 279
162 3300009147 Ga0114129_10058525 Ga0114129_100585253 279
163 3300009147 Ga0114129_10328825 Ga0114129_103288251 279
164 3300009147 Ga0114129_10402431 Ga0114129_104024312 279
165 3300009148 Ga0105243_10068007 Ga0105243_100680072 279
166 3300009174 Ga0105241_10077480 Ga0105241_100774802 279
167 3300009174 Ga0105241_10383476 Ga0105241_103834762 279
168 3300009176 Ga0105242_10087813 Ga0105242_100878133 279
169 3300009545 Ga0105237_10006297 Ga0105237_100062976 279
170 3300009551 Ga0105238_10017354 Ga0105238_100173545 279
171 3300009553 Ga0105249_10032316 Ga0105249_100323163 279
172 3300011119 Ga0105246_10108194 Ga0105246_101081942 279
173 3300013100 Ga0157373_10007941 Ga0157373_100079412 279
174 3300013100 Ga0157373_10306107 Ga0157373_103061071 279
175 3300013307 Ga0157372_10013874 Ga0157372_1001387410 279
176 3300013308 Ga0157375_10034313 Ga0157375_100343136 279
177 3300014325 Ga0163163_10002089 Ga0163163_1000208910 279
178 3300014325 Ga0163163_10065528 Ga0163163_100655282 279
179 3300014745 Ga0157377_10268235 Ga0157377_102682352 279
180 3300025321 Ga0207656_10007814 Ga0207656_100078143 279
181 3300025900 Ga0207710_10003304 Ga0207710_100033042 279
182 3300025904 Ga0207647_10094655 Ga0207647_100946552 279
183 3300025910 Ga0207684_10000327 Ga0207684_1000032760 279
184 3300025911 Ga0207654_10054032 Ga0207654_100540323 279
185 3300025912 Ga0207707_10007357 Ga0207707_100073575 279
186 3300025914 Ga0207671_10005001 Ga0207671_100050015 279
187 3300025924 Ga0207694_10000842 Ga0207694_100008428 279
188 3300025934 Ga0207686_10038549 Ga0207686_100385493 279
189 3300025935 Ga0207709_10075452 Ga0207709_100754522 279
190 3300025941 Ga0207711_10490480 Ga0207711_104904801 279
191 3300025942 Ga0207689_10246861 Ga0207689_102468612 279
192 3300025960 Ga0207651_10129081 Ga0207651_101290812 279
193 3300025961 Ga0207712_10002894 Ga0207712_100028943 279
194 3300025981 Ga0207640_10553163 Ga0207640_105531631 279
195 3300026035 Ga0207703_10165508 Ga0207703_101655081 279
196 3300026075 Ga0207708_10054389 Ga0207708_100543892 279
197 3300026089 Ga0207648_10103672 Ga0207648_101036724 279
198 3300026095 Ga0207676_10047908 Ga0207676_100479084 279
199 3300026095 Ga0207676_10222957 Ga0207676_102229572 279
200 3300026142 Ga0207698_10161594 Ga0207698_101615942 279
201 3300028381 Ga0268264_10115872 Ga0268264_101158722 279
202 3300028381 Ga0268264_10159843 Ga0268264_101598432 279
203 3300031852 Ga0307410_10071156 Ga0307410_100711562 279
204 3300032002 Ga0307416_100324239 Ga0307416_1003242391 279
205 3300032005 Ga0307411_10014482 Ga0307411_100144823 279
206 3300032126 Ga0307415_100136265 Ga0307415_1001362652 279
207 3300035091 Ga0373951_0002266 Ga0373951_0002266_250_1089 279
208 3300037312 Ga0395899_0234626 Ga0395899_0234626_189_1040 279
209 3300037418 Ga0395900_0240161 Ga0395900_0240161_840_1691 279
210 3300038443 Ga0395901_0296561 Ga0395901_0296561_164_1015 279
211 3300044673 Ga0453683_0320061 Ga0453683_0320061_31_876 279
212 3300045051 Ga0451576_0191744 Ga0451576_0191744_766_1611 279
213 3300049514 Ga0501291_012602 Ga0501291_012602_79_918 279
214 3300049519 Ga0501296_005408 Ga0501296_005408_152_1024 279
215 3300049652 Ga0501202_003710 Ga0501202_003710_1646_2518 279
216 3300049660 Ga0501216_003022 Ga0501216_003022_229_1101 279
217 3300049665 Ga0501227_025122 Ga0501227_025122_164_1006 279
218 3300049707 Ga0501234_001878 Ga0501234_001878_1048_1887 279
219 3300049774 Ga0501278_002819 Ga0501278_002819_239_1111 279
220 3300049851 Ga0501212_002558 Ga0501212_002558_1057_1896 279
221 3300050507 nmdc:mga05p37_147431_c1 nmdc:mga05p37_147431_c1_1486_2325 279
222 3300050507 nmdc:mga05p37_621154_c1 nmdc:mga05p37_621154_c1_234_1079 279
223 3300050507 nmdc:mga05p37_92329_c1 nmdc:mga05p37_92329_c1_2503_3354 279
224 3300050512 nmdc:mga0n895_107865_c1 nmdc:mga0n895_107865_c1_1790_2632 279
225 3300050513 nmdc:mga0rr50_187641_c1 nmdc:mga0rr50_187641_c1_67_918 279
226 3300050515 nmdc:mga0a205_100079_c1 nmdc:mga0a205_100079_c1_329_1171 279
227 3300050515 nmdc:mga0a205_17128_c1 nmdc:mga0a205_17128_c1_4168_5019 279
228 3300050515 nmdc:mga0a205_207614_c1 nmdc:mga0a205_207614_c1_846_1685 279
229 3300005536 Ga0070697_100315068 Ga0070697_1003150682 281
230 3300006871 Ga0075434_100384189 Ga0075434_1003841891 281
231 3300050512 nmdc:mga0n895_93197_c1 nmdc:mga0n895_93197_c1_284_1165 281
232 3300005841 Ga0068863_100104853 Ga0068863_1001048532 282
233 3300026023 Ga0207677_10425462 Ga0207677_104254622 282
234 3300025940 Ga0207691_10068124 Ga0207691_100681243 283
235 3300046517 Ga0495630_0036476 Ga0495630_0036476_2182_3120 283
236 3300047322 Ga0495680_0175880 Ga0495680_0175880_389_1327 283
237 3300002459 JGI24751J29686_10000099 JGI24751J29686_1000009916 286
238 3300005331 Ga0070670_100000297 Ga0070670_10000029732 286
239 3300025925 Ga0207650_10000313 Ga0207650_1000031316 286
240 3300048916 Ga0496113_0094732 Ga0496113_0094732_1041_2240 286
241 3300049663 Ga0501223_010890 Ga0501223_010890_185_1294 286

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04679

DNA_ligase_A_C

ATP dependent DNA ligase C terminal region

250

344

0.93

PF01068

DNA_ligase_A_M

ATP dependent DNA ligase domain

77

151

0.84

PF01068

DNA_ligase_A_M

ATP dependent DNA ligase domain

147

232

0.81

PF09414

RNA_ligase

RNA ligase

90

232

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rpw-assembly1.cif.gz_E archaeal dna ligase and heterotrimeric pcna in complex with adenylated dna 0.8045 17 172
3vnn-assembly1.cif.gz_A crystal structure of a sub-domain of the nucleotidyltransferase (adenylation) domain of human dna ligase iv 0.8011 35 130
3nbz-assembly1.cif.gz_B crystal structure of the hiv-1 rev nes-crm1-rangtp nuclear export complex (crystal i) 0.7831 16 172
4e6n-assembly2.cif.gz_C crystal structure of bacterial pnkp-c/hen1-n heterodimer 0.7772 32 172
3ty9-assembly2.cif.gz_A crystal structure of c. thermocellum pnkp ligase domain amp-adenylate 0.7714 32 173
ID Description Score Start End Superfamily
af_P9WNV3_639_759_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9088 175 284 2.40.50.140
af_P9WNV5_183_380_3.30.470.30 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.8595 16 172 3.30.470.30
af_D4A0U6_241_453_3.30.470.30 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.8595 32 172 3.30.470.30
af_O74833_247_463_3.30.470.30 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.8594 32 172 3.30.470.30
af_Q08387_250_468_3.30.470.30 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.8553 16 172 3.30.470.30
ID Description Score Start End GO Terms
AF-A0A2V7TRP1-F1-model_v4 ATP-dependent DNA ligase 0.9553 8 143 GO:0003910
GO:0005524
GO:0006281
GO:0006310
AF-A0A1L7I4J2-F1-model_v4 DNA ligase (ATP) (EC 6.5.1.1) 0.9513 173 284 GO:0003910
GO:0006281
GO:0006310
AF-A0A3N5XLX0-F1-model_v4 ATP-dependent DNA ligase 0.9306 10 185 GO:0003677
GO:0003910
GO:0005524
GO:0006297
GO:0006303
GO:0006310
GO:0051103
AF-A0A2V7VG75-F1-model_v4 DNA ligase (ATP) (EC 6.5.1.1) 0.9287 175 284 GO:0003910
GO:0005524
GO:0006281
GO:0006310
GO:0046872
AF-A0A4Q3PR88-F1-model_v4 deleted 0.9248 95 280

Feature Viewer

pLDDT pTM Quality
88.62 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map