F353938

General Info

Members Datasets Scaffolds Average Seq Length
241 98 480 284

Family's Representative Sequence

Representative Sequence 3300035692|Ga0373935_0003590|Ga0373935_0003590_7905_8918
Length 337
Sequence MSCELNAGGKGHGAAVRKQFGRALPRSCRSADDPQKRSKGRHTVHYRKLIRAIGVAGAFTMICSGANAADRAKYPEWKGAWERWVPPVSVVSPSGLRTAGGQPSFDQTKPWARGQEAPLTPEYQKILEDSIADQAAGGQGNNFDRARCMPTGMPHMLTFGPLEFVVTPDTTYILIGTQARRIYTDGREWPKEIEPSYAGYSMGRWIDEDGDGNYDVLEAETRGFKGPRVYDASGLPLHFDNQSVFKERIHIDKADPKVIHDEITVIDHALTRPWTVDKRYVHNSNPHPEWREGSCVEGSGLVAIGKEMYVLRGDGLLMPAKKDQTPPDLRYFKPRAK

Samples

Sample ID Description Type Environment
1 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
2 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
3 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
4 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
5 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
6 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
9 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
10 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
11 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
12 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
13 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
14 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
15 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
16 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
17 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
18 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
22 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
23 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
24 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
25 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
26 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
27 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
34 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
35 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
36 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
37 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
38 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
39 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
40 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
41 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
42 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
43 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
44 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
45 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
46 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
47 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
48 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
49 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
50 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
51 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
52 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
53 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
54 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
55 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
56 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
57 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
58 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
59 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
60 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
61 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
62 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
63 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
64 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
65 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
66 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
67 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
68 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
69 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
70 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
71 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
72 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
73 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
74 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
75 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
76 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
77 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
78 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
79 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
80 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
81 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
82 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
83 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
84 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
85 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
86 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
87 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
88 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
89 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
90 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
91 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
92 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
93 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
94 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
95 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
96 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
97 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
98 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.66
Nodule 0
Rhizoplane 6.64
Rhizosphere 86.31
Stem 0
Stem Tuber 0
Unclassified 24.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373935_0003590 3300035692 Bacteria 9045
2 Ga0070714_100030015 3300005435 Bacteria 4523
3 Ga0070714_100384930 3300005435 Bacteria 1323
4 Ga0070713_100051443 3300005436 Bacteria 3406
5 Ga0070713_100057873 3300005436 Bacteria 3230
6 Ga0070713_100322138 3300005436 Bacteria 1428
7 Ga0070713_100375945 3300005436 Bacteria 1323
8 Ga0070713_100515986 3300005436 Bacteria 1129
9 Ga0070713_100604472 3300005436 Bacteria 1042
10 Ga0068863_100079930 3300005841 Bacteria 3097
11 Ga0068863_100463711 3300005841 Unclassified 1244
12 Ga0068860_100078596 3300005843 Bacteria 3137
13 Ga0068860_100855476 3300005843 Bacteria 924
14 Ga0081455_10012703 3300005937 Bacteria 8380
15 Ga0081455_10031393 3300005937 Bacteria 4808
16 Ga0081455_10051118 3300005937 Bacteria 3547
17 Ga0081540_1013381 3300005983 Bacteria 5336
18 Ga0081540_1041165 3300005983 Bacteria 2398
19 Ga0081540_1084808 3300005983 Unclassified 1413
20 Ga0070717_10587588 3300006028 Bacteria 1010
21 Ga0070712_100239222 3300006175 Unclassified 1446
22 Ga0075367_10026889 3300006178 Bacteria 3268
23 Ga0075367_10074964 3300006178 Bacteria 2040
24 Ga0097621_100087613 3300006237 Unclassified 2600
25 Ga0075428_100761289 3300006844 Unclassified 1030
26 Ga0075431_100155819 3300006847 Bacteria 2350
27 Ga0075433_10015604 3300006852 Bacteria 6239
28 Ga0075433_10019855 3300006852 Bacteria 5608
29 Ga0075433_10042785 3300006852 Bacteria 3931
30 Ga0075433_10065758 3300006852 Bacteria 3181
31 Ga0075434_100009529 3300006871 Bacteria 9060
32 Ga0075434_100012004 3300006871 Bacteria 8195
33 Ga0075434_100146184 3300006871 Bacteria 2384
34 Ga0075435_100397814 3300007076 Bacteria 1184
35 Ga0099794_10003583 3300007265 Bacteria 5953
36 Ga0099794_10022498 3300007265 Bacteria 2875
37 Ga0099794_10039258 3300007265 Bacteria 2246
38 Ga0099795_10000222 3300007788 Bacteria 9894
39 Ga0099795_10005896 3300007788 Unclassified 3300
40 Ga0099795_10010775 3300007788 Unclassified 2706
41 Ga0099795_10048914 3300007788 Bacteria 1533
42 Ga0099795_10071498 3300007788 Unclassified 1310
43 Ga0099795_10079207 3300007788 Unclassified 1254
44 Ga0099795_10119128 3300007788 Unclassified 1054
45 Ga0111539_10158805 3300009094 Bacteria 2645
46 Ga0114129_10237752 3300009147 Bacteria 2450
47 Ga0105248_10359120 3300009177 Bacteria 1640
48 Ga0099796_10000381 3300010159 Bacteria 7261
49 Ga0099796_10001485 3300010159 Unclassified 4741
50 Ga0099796_10003890 3300010159 Bacteria 3535
51 Ga0099796_10011449 3300010159 Unclassified 2475
52 Ga0099796_10026083 3300010159 Bacteria 1852
53 Ga0099796_10026161 3300010159 Bacteria 1850
54 Ga0099796_10033458 3300010159 Bacteria 1692
55 Ga0105246_10095325 3300011119 Bacteria 2154
56 Ga0105246_10410811 3300011119 Bacteria 1127
57 Ga0157375_10698088 3300013308 Bacteria 1168
58 Ga0157376_10123892 3300014969 Unclassified 2295
59 Ga0157376_10372641 3300014969 Bacteria 1373
60 Ga0213875_10034045 3300021388 Bacteria 2406
61 Ga0213875_10069817 3300021388 Bacteria 1640
62 Ga0207693_10246874 3300025915 Unclassified 1401
63 Ga0207700_10056379 3300025928 Bacteria 2958
64 Ga0207700_10235636 3300025928 Bacteria 1558
65 Ga0207700_10238214 3300025928 Unclassified 1550
66 Ga0207700_10262450 3300025928 Bacteria 1479
67 Ga0207700_10319583 3300025928 Bacteria 1345
68 Ga0207664_10254804 3300025929 Unclassified 1533
69 Ga0207711_10547085 3300025941 Bacteria 1080
70 Ga0209179_1010083 3300027512 Bacteria 1637
71 Ga0209179_1030057 3300027512 Bacteria 1109
72 Ga0209588_1039360 3300027671 Bacteria 1524
73 Ga0373934_0021485 3300035086 Unclassified 2485
74 Ga0373934_0121699 3300035086 Unclassified 1062
75 Ga0373944_0053059 3300035089 Bacteria 1282
76 Ga0373949_0016174 3300035090 Bacteria 1672
77 Ga0373952_0004075 3300035092 Bacteria 2640
78 Ga0373923_0142400 3300035111 Bacteria 1084
79 Ga0373936_0037536 3300035113 Bacteria 1935
80 Ga0373939_0030512 3300035114 Bacteria 1551
81 Ga0373945_0090695 3300035116 Bacteria 1183
82 Ga0373953_0031286 3300035117 Unclassified 2069
83 Ga0373953_0041782 3300035117 Unclassified 1825
84 Ga0373953_0064529 3300035117 Bacteria 1502
85 Ga0373954_0048889 3300035118 Bacteria 1982
86 Ga0373956_0010816 3300035119 Bacteria 3748
87 Ga0373956_0023522 3300035119 Bacteria 2645
88 Ga0373956_0040362 3300035119 Unclassified 2070
89 Ga0373956_0084709 3300035119 Bacteria 1457
90 Ga0373943_0025105 3300035170 Bacteria 2784
91 Ga0373943_0106215 3300035170 Bacteria 1475
92 Ga0373943_0177601 3300035170 Unclassified 1169
93 Ga0373946_0049122 3300035171 Bacteria 1759
94 Ga0373946_0073379 3300035171 Unclassified 1483
95 Ga0373955_0048026 3300035172 Bacteria 2313
96 Ga0373955_0090802 3300035172 Bacteria 1740
97 Ga0373924_0012459 3300035410 Bacteria 3178
98 Ga0373924_0021584 3300035410 Unclassified 2512
99 Ga0373931_0075932 3300035691 Unclassified 1844
100 Ga0373935_0008975 3300035692 Bacteria 5982
101 Ga0373935_0010579 3300035692 Bacteria 5537
102 Ga0373935_0101917 3300035692 Bacteria 1894
103 Ga0373935_0103801 3300035692 Bacteria 1878
104 Ga0373935_0128538 3300035692 Bacteria 1700
105 Ga0373935_0154134 3300035692 Bacteria 1561
106 Ga0373935_0250512 3300035692 Bacteria 1239
107 Ga0373935_0641309 3300035692 Bacteria 779
108 Ga0373927_0008577 3300035695 Bacteria 6868
109 Ga0373927_0011155 3300035695 Bacteria 5984
110 Ga0373927_0027738 3300035695 Bacteria 3697
111 Ga0373927_0034279 3300035695 Bacteria 3303
112 Ga0373927_0051144 3300035695 Bacteria 2672
113 Ga0373927_0080933 3300035695 Unclassified 2105
114 Ga0373927_0084186 3300035695 Bacteria 2062
115 Ga0373927_0105294 3300035695 Unclassified 1837
116 Ga0373927_0107169 3300035695 Unclassified 1820
117 Ga0373927_0207344 3300035695 Unclassified 1287
118 Ga0373927_0265310 3300035695 Unclassified 1129
119 Ga0373933_0020559 3300035724 Bacteria 3743
120 Ga0373933_0050995 3300035724 Bacteria 2472
121 Ga0373933_0053633 3300035724 Bacteria 2415
122 Ga0373933_0064678 3300035724 Bacteria 2213
123 Ga0373933_0074715 3300035724 Bacteria 2068
124 Ga0373933_0109177 3300035724 Bacteria 1724
125 Ga0373933_0171217 3300035724 Bacteria 1382
126 Ga0373933_0305062 3300035724 Unclassified 1031
127 Ga0373947_0067142 3300035725 Unclassified 2190
128 Ga0373947_0150683 3300035725 Bacteria 1498
129 Ga0373947_0180502 3300035725 Bacteria 1374
130 Ga0373947_0191373 3300035725 Unclassified 1335
131 Ga0373947_0204529 3300035725 Bacteria 1293
132 Ga0373937_0002055 3300036401 Bacteria 16831
133 Ga0373937_0003066 3300036401 Bacteria 13969
134 Ga0373937_0005536 3300036401 Bacteria 10830
135 Ga0373937_0005746 3300036401 Bacteria 10659
136 Ga0373937_0005910 3300036401 Bacteria 10524
137 Ga0373937_0007295 3300036401 Bacteria 9568
138 Ga0373937_0011269 3300036401 Bacteria 7839
139 Ga0373937_0017507 3300036401 Bacteria 6386
140 Ga0373937_0020714 3300036401 Bacteria 5897
141 Ga0373937_0023091 3300036401 Bacteria 5596
142 Ga0373937_0048247 3300036401 Unclassified 3897
143 Ga0373937_0092723 3300036401 Bacteria 2800
144 Ga0373937_0126943 3300036401 Bacteria 2380
145 Ga0373937_0134009 3300036401 Unclassified 2315
146 Ga0373925_0024592 3300037068 Bacteria 4398
147 Ga0373925_0039812 3300037068 Bacteria 3478
148 Ga0373925_0043444 3300037068 Bacteria 3336
149 Ga0373925_0049839 3300037068 Bacteria 3122
150 Ga0373925_0071802 3300037068 Bacteria 2619
151 Ga0373925_0073152 3300037068 Unclassified 2594
152 Ga0373925_0088191 3300037068 Bacteria 2369
153 Ga0373925_0118580 3300037068 Bacteria 2052
154 Ga0373925_0329209 3300037068 Unclassified 1237
155 Ga0436364_0127606 3300037853 Bacteria 3784
156 Ga0436364_0209173 3300037853 Bacteria 2945
157 Ga0436364_0518856 3300037853 Bacteria 4142
158 Ga0436364_0661347 3300037853 Bacteria 1467
159 Ga0436364_1373003 3300037853 Bacteria 2143
160 Ga0436364_1424170 3300037853 Bacteria 2450
161 Ga0436365_0316468 3300039437 Bacteria 3400
162 Ga0436365_1300513 3300039437 Bacteria 3001
163 Ga0436365_1928683 3300039437 Bacteria 5993
164 Ga0436360_0585603 3300039438 Bacteria 1039
165 Ga0436360_1100563 3300039438 Bacteria 1141
166 Ga0436360_1147159 3300039438 Bacteria 1000
167 Ga0436361_0679796 3300039447 Unclassified 986
168 Ga0436363_0553480 3300039450 Bacteria 4342
169 Ga0436363_1390679 3300039450 Bacteria 4680
170 Ga0495590_0067871 3300046457 Unclassified 1250
171 Ga0495629_0116294 3300046459 Unclassified 1864
172 Ga0495629_0141909 3300046459 Unclassified 1671
173 Ga0495638_0115579 3300046460 Unclassified 1590
174 Ga0495651_0157359 3300046462 Unclassified 1632
175 Ga0495639_0034355 3300046475 Bacteria 2268
176 Ga0495664_0075930 3300046477 Bacteria 2011
177 Ga0495584_0051321 3300046491 Unclassified 2077
178 Ga0495584_0195190 3300046491 Unclassified 1029
179 Ga0495594_0135808 3300046499 Bacteria 1394
180 Ga0495630_0094022 3300046517 Unclassified 2266
181 Ga0495630_0230755 3300046517 Bacteria 1414
182 Ga0495666_0076566 3300046526 Unclassified 1586
183 Ga0495665_0032573 3300046531 Unclassified 2788
184 Ga0495640_0007904 3300046533 Bacteria 8362
185 Ga0495640_0016373 3300046533 Bacteria 5547
186 Ga0495640_0137060 3300046533 Bacteria 1580
187 Ga0495640_0160298 3300046533 Bacteria 1442
188 Ga0495656_0044954 3300046615 Unclassified 1862
189 Ga0495634_0013469 3300046642 Bacteria 5907
190 Ga0495634_0024115 3300046642 Bacteria 4272
191 Ga0495634_0209931 3300046642 Unclassified 1206
192 Ga0495659_0120793 3300046664 Unclassified 1031
193 Ga0495658_0012368 3300046683 Bacteria 4321
194 Ga0495658_0123773 3300046683 Unclassified 1567
195 Ga0495613_0154414 3300046689 Bacteria 1636
196 Ga0495613_0180031 3300046689 Bacteria 1497
197 Ga0495624_0292889 3300046690 Bacteria 982
198 Ga0495671_0193708 3300046692 Unclassified 987
199 Ga0495600_0000866 3300046809 Bacteria 16169
200 Ga0495581_0224438 3300047315 Unclassified 1099
201 Ga0495674_0049677 3300047319 Bacteria 3705
202 Ga0495674_0082517 3300047319 Bacteria 2756
203 Ga0495674_0091930 3300047319 Bacteria 2591
204 Ga0495684_0113922 3300047471 Bacteria 2039
205 Ga0495684_0240502 3300047471 Bacteria 1321
206 Ga0496104_0049792 3300048907 Bacteria 3951
207 Ga0496104_0054568 3300048907 Bacteria 3777
208 Ga0496104_0072153 3300048907 Bacteria 3283
209 Ga0496105_0065249 3300048908 Bacteria 3005
210 Ga0496105_0299451 3300048908 Bacteria 1293
211 Ga0496106_0190922 3300048909 Unclassified 1628
212 Ga0496106_0419401 3300048909 Unclassified 1076
213 Ga0496107_0118447 3300048910 Bacteria 1950
214 Ga0496108_0362569 3300048911 Bacteria 1265
215 Ga0496110_0126632 3300048913 Bacteria 2305
216 Ga0496114_0143353 3300048917 Bacteria 2070
217 Ga0496114_0306270 3300048917 Bacteria 1403
218 Ga0496114_0319751 3300048917 Bacteria 1371
219 Ga0496114_0366219 3300048917 Bacteria 1275
220 Ga0496115_0024976 3300048918 Bacteria 4649
221 Ga0496115_0170473 3300048918 Bacteria 1800
222 nmdc:mga06z11_131613_c1 3300050494 Bacteria 1405
223 nmdc:mga06z11_55908_c1 3300050494 Bacteria 2039
224 nmdc:mga05p37_544196_c1 3300050507 Bacteria 1323
225 nmdc:mga05p37_582069_c1 3300050507 Bacteria 1267
226 nmdc:mga09592_287849_c1 3300050508 Bacteria 1424
227 nmdc:mga06r32_112790_c1 3300050510 Bacteria 2675
228 nmdc:mga08y16_448034_c1 3300050511 Bacteria 1317
229 nmdc:mga0n895_11648_c1 3300050512 Bacteria 7856
230 nmdc:mga0n895_130516_c1 3300050512 Bacteria 2538
231 nmdc:mga0n895_517026_c1 3300050512 Bacteria 1202
232 nmdc:mga0a205_26852_c1 3300050515 Bacteria 5494
233 nmdc:mga0a205_27269_c1 3300050515 Bacteria 5454
234 nmdc:mga0a205_52622_c1 3300050515 Unclassified 3929
235 nmdc:mga0a205_87452_c1 3300050515 Bacteria 3011
236 Ga0495601_0063321 3300053077 Bacteria 2351
237 Ga0495601_0089545 3300053077 Bacteria 1979
238 Ga0495601_0119190 3300053077 Bacteria 1713
239 Ga0495601_0229054 3300053077 Unclassified 1214
240 Ga0495619_0121157 3300053085 Bacteria 1793
241 Ga0373935_0003590
242 Ga0070714_100030015
243 Ga0070714_100384930
244 Ga0070713_100051443
245 Ga0070713_100057873
246 Ga0070713_100322138
247 Ga0070713_100375945
248 Ga0070713_100515986
249 Ga0070713_100604472
250 Ga0068863_100079930
251 Ga0068863_100463711
252 Ga0068860_100078596
253 Ga0068860_100855476
254 Ga0081455_10012703
255 Ga0081455_10031393
256 Ga0081455_10051118
257 Ga0081540_1013381
258 Ga0081540_1041165
259 Ga0081540_1084808
260 Ga0070717_10587588
261 Ga0070712_100239222
262 Ga0075367_10026889
263 Ga0075367_10074964
264 Ga0097621_100087613
265 Ga0075428_100761289
266 Ga0075431_100155819
267 Ga0075433_10015604
268 Ga0075433_10019855
269 Ga0075433_10042785
270 Ga0075433_10065758
271 Ga0075434_100009529
272 Ga0075434_100012004
273 Ga0075434_100146184
274 Ga0075435_100397814
275 Ga0099794_10003583
276 Ga0099794_10022498
277 Ga0099794_10039258
278 Ga0099795_10000222
279 Ga0099795_10005896
280 Ga0099795_10010775
281 Ga0099795_10048914
282 Ga0099795_10071498
283 Ga0099795_10079207
284 Ga0099795_10119128
285 Ga0111539_10158805
286 Ga0114129_10237752
287 Ga0105248_10359120
288 Ga0099796_10000381
289 Ga0099796_10001485
290 Ga0099796_10003890
291 Ga0099796_10011449
292 Ga0099796_10026083
293 Ga0099796_10026161
294 Ga0099796_10033458
295 Ga0105246_10095325
296 Ga0105246_10410811
297 Ga0157375_10698088
298 Ga0157376_10123892
299 Ga0157376_10372641
300 Ga0213875_10034045
301 Ga0213875_10069817
302 Ga0207693_10246874
303 Ga0207700_10056379
304 Ga0207700_10235636
305 Ga0207700_10238214
306 Ga0207700_10262450
307 Ga0207700_10319583
308 Ga0207664_10254804
309 Ga0207711_10547085
310 Ga0209179_1010083
311 Ga0209179_1030057
312 Ga0209588_1039360
313 Ga0373934_0021485
314 Ga0373934_0121699
315 Ga0373944_0053059
316 Ga0373949_0016174
317 Ga0373952_0004075
318 Ga0373923_0142400
319 Ga0373936_0037536
320 Ga0373939_0030512
321 Ga0373945_0090695
322 Ga0373953_0031286
323 Ga0373953_0041782
324 Ga0373953_0064529
325 Ga0373954_0048889
326 Ga0373956_0010816
327 Ga0373956_0023522
328 Ga0373956_0040362
329 Ga0373956_0084709
330 Ga0373943_0025105
331 Ga0373943_0106215
332 Ga0373943_0177601
333 Ga0373946_0049122
334 Ga0373946_0073379
335 Ga0373955_0048026
336 Ga0373955_0090802
337 Ga0373924_0012459
338 Ga0373924_0021584
339 Ga0373931_0075932
340 Ga0373935_0008975
341 Ga0373935_0010579
342 Ga0373935_0101917
343 Ga0373935_0103801
344 Ga0373935_0128538
345 Ga0373935_0154134
346 Ga0373935_0250512
347 Ga0373935_0641309
348 Ga0373927_0008577
349 Ga0373927_0011155
350 Ga0373927_0027738
351 Ga0373927_0034279
352 Ga0373927_0051144
353 Ga0373927_0080933
354 Ga0373927_0084186
355 Ga0373927_0105294
356 Ga0373927_0107169
357 Ga0373927_0207344
358 Ga0373927_0265310
359 Ga0373933_0020559
360 Ga0373933_0050995
361 Ga0373933_0053633
362 Ga0373933_0064678
363 Ga0373933_0074715
364 Ga0373933_0109177
365 Ga0373933_0171217
366 Ga0373933_0305062
367 Ga0373947_0067142
368 Ga0373947_0150683
369 Ga0373947_0180502
370 Ga0373947_0191373
371 Ga0373947_0204529
372 Ga0373937_0002055
373 Ga0373937_0003066
374 Ga0373937_0005536
375 Ga0373937_0005746
376 Ga0373937_0005910
377 Ga0373937_0007295
378 Ga0373937_0011269
379 Ga0373937_0017507
380 Ga0373937_0020714
381 Ga0373937_0023091
382 Ga0373937_0048247
383 Ga0373937_0092723
384 Ga0373937_0126943
385 Ga0373937_0134009
386 Ga0373925_0024592
387 Ga0373925_0039812
388 Ga0373925_0043444
389 Ga0373925_0049839
390 Ga0373925_0071802
391 Ga0373925_0073152
392 Ga0373925_0088191
393 Ga0373925_0118580
394 Ga0373925_0329209
395 Ga0436364_0127606
396 Ga0436364_0209173
397 Ga0436364_0518856
398 Ga0436364_0661347
399 Ga0436364_1373003
400 Ga0436364_1424170
401 Ga0436365_0316468
402 Ga0436365_1300513
403 Ga0436365_1928683
404 Ga0436360_0585603
405 Ga0436360_1100563
406 Ga0436360_1147159
407 Ga0436361_0679796
408 Ga0436363_0553480
409 Ga0436363_1390679
410 Ga0495590_0067871
411 Ga0495629_0116294
412 Ga0495629_0141909
413 Ga0495638_0115579
414 Ga0495651_0157359
415 Ga0495639_0034355
416 Ga0495664_0075930
417 Ga0495584_0051321
418 Ga0495584_0195190
419 Ga0495594_0135808
420 Ga0495630_0094022
421 Ga0495630_0230755
422 Ga0495666_0076566
423 Ga0495665_0032573
424 Ga0495640_0007904
425 Ga0495640_0016373
426 Ga0495640_0137060
427 Ga0495640_0160298
428 Ga0495656_0044954
429 Ga0495634_0013469
430 Ga0495634_0024115
431 Ga0495634_0209931
432 Ga0495659_0120793
433 Ga0495658_0012368
434 Ga0495658_0123773
435 Ga0495613_0154414
436 Ga0495613_0180031
437 Ga0495624_0292889
438 Ga0495671_0193708
439 Ga0495600_0000866
440 Ga0495581_0224438
441 Ga0495674_0049677
442 Ga0495674_0082517
443 Ga0495674_0091930
444 Ga0495684_0113922
445 Ga0495684_0240502
446 Ga0496104_0049792
447 Ga0496104_0054568
448 Ga0496104_0072153
449 Ga0496105_0065249
450 Ga0496105_0299451
451 Ga0496106_0190922
452 Ga0496106_0419401
453 Ga0496107_0118447
454 Ga0496108_0362569
455 Ga0496110_0126632
456 Ga0496114_0143353
457 Ga0496114_0306270
458 Ga0496114_0319751
459 Ga0496114_0366219
460 Ga0496115_0024976
461 Ga0496115_0170473
462 nmdc:mga06z11_131613_c1
463 nmdc:mga06z11_55908_c1
464 nmdc:mga05p37_544196_c1
465 nmdc:mga05p37_582069_c1
466 nmdc:mga09592_287849_c1
467 nmdc:mga06r32_112790_c1
468 nmdc:mga08y16_448034_c1
469 nmdc:mga0n895_11648_c1
470 nmdc:mga0n895_130516_c1
471 nmdc:mga0n895_517026_c1
472 nmdc:mga0a205_26852_c1
473 nmdc:mga0a205_27269_c1
474 nmdc:mga0a205_52622_c1
475 nmdc:mga0a205_87452_c1
476 Ga0495601_0063321
477 Ga0495601_0089545
478 Ga0495601_0119190
479 Ga0495601_0229054
480 Ga0495619_0121157

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1iu1-assembly1.cif.gz_A crystal structure of human gamma1-adaptin ear domain 0.75 179 226
1gyu-assembly1.cif.gz_A gamma-adaptin appendage domain from clathrin adaptor ap1 0.7433 179 226
1gyv-assembly1.cif.gz_A gamma-adaptin appendage domain from clathrin adaptor ap1, l762e mutant 0.7427 179 226
7rpg-assembly1.cif.gz_A x-ray crystal structure of oxa-24/40 k84d in complex with cefotaxime 0.6588 183 229
2ia7-assembly1.cif.gz_A crystal structure of putative tail lysozyme (np_952040.1) from geobacter sulfurreducens at 1.44 a resolution 0.6453 187 228
ID Description Score Start End Superfamily
3bdrA00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7282 145 225 2.40.128.20
3zhfA00 Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain 0.7167 179 226 2.60.40.1230
af_Q7T1H5_323_403_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7052 184 227 3.30.160.20
3hxlA05 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2; 0.6989 191 223 3.30.360.90
af_Q8IKS3_942_1080_2.60.40.1230 Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain 0.6947 179 224 2.60.40.1230
ID Description Score Start End GO Terms
AF-A0A317HW04-F1-model_v4 deleted 0.9579 20 213
AF-A0A317HZX2-F1-model_v4 deleted 0.9571 74 277
AF-A0A537UUM3-F1-model_v4 Uncharacterized protein 0.9433 36 237
AF-A0A317HZX2-F1-model_v4 deleted 0.9391 74 277
AF-A0A537UUM3-F1-model_v4 Uncharacterized protein 0.9247 36 237

Map