F353916

General Info

Members Datasets Scaffolds Average Seq Length
241 113 482 246

Family's Representative Sequence

Representative Sequence 3300032005|Ga0307411_10263096|Ga0307411_102630962
Length 283
Sequence MSVGIGAHSSDEPIPRFARDDTRAGAAAGTTRRILMDLEGRPGWQNMAIDRVLLERARRGEWWLRLYRWAPHCLSLGRHEPALRRYDRSRIEALGLDVVRRPTGGRAVWHAHELTYALAVPGGVFGGLKESYHEIHRMLLIAIHHLGVPAELAPAARAARLDAGACFAAPAGGEIVAGRRKLVGSAQLREGGALLQHXSILLGGRQDVVRDITRGGALPDLAGSLADVTGHAVACEDVARAVAAAAADRWGAGWEPGAISGELLEAAAPHGRTFRSPAWTWRS

Samples

Sample ID Description Type Environment
1 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
57 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
58 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
59 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
60 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
61 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
62 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
68 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
69 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
70 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
71 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
74 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
75 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
76 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
77 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
78 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
79 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
80 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
81 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
89 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
90 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
91 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
92 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
93 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
94 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
95 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
96 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
97 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
98 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
99 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
100 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
101 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
102 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
103 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
104 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
105 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
106 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
107 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
108 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
109 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
110 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
111 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
112 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
113 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.39
Rhizosphere 94.19
Stem 0
Stem Tuber 0
Unclassified 4.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307411_10263096 3300032005 Bacteria 1363
2 rootL2_10009041 3300003322 Bacteria 3312
3 Ga0065715_10279780 3300005293 Bacteria 1075
4 Ga0070670_100853077 3300005331 Unclassified 824
5 Ga0070668_100073955 3300005347 Bacteria 2658
6 Ga0070675_100084188 3300005354 Bacteria 2656
7 Ga0070675_100131688 3300005354 Bacteria 2132
8 Ga0070673_100592678 3300005364 Unclassified 1010
9 Ga0070659_100149956 3300005366 Bacteria 1902
10 Ga0070701_10077228 3300005438 Bacteria 1794
11 Ga0070705_100028781 3300005440 Bacteria 3047
12 Ga0070705_100327490 3300005440 Bacteria 1108
13 Ga0070694_100014109 3300005444 Bacteria 5001
14 Ga0070708_100013483 3300005445 Bacteria 6695
15 Ga0070708_100042780 3300005445 Bacteria 3978
16 Ga0070708_100116071 3300005445 Bacteria 2465
17 Ga0070681_10028053 3300005458 Bacteria 5659
18 Ga0070681_10050001 3300005458 Bacteria 4172
19 Ga0070706_100377045 3300005467 Bacteria 1321
20 Ga0070707_100002429 3300005468 Bacteria 17762
21 Ga0070707_100012668 3300005468 Bacteria 7876
22 Ga0070707_100034120 3300005468 Bacteria 4853
23 Ga0070707_100070577 3300005468 Bacteria 3365
24 Ga0070707_100218242 3300005468 Bacteria 1858
25 Ga0070707_100408358 3300005468 Unclassified 1318
26 Ga0070698_100061121 3300005471 Bacteria 3801
27 Ga0070698_100104640 3300005471 Bacteria 2800
28 Ga0070699_100000223 3300005518 Bacteria 56220
29 Ga0070699_100000517 3300005518 Bacteria 36574
30 Ga0070699_100011001 3300005518 Bacteria 7824
31 Ga0070699_100015741 3300005518 Bacteria 6494
32 Ga0070699_100175853 3300005518 Bacteria 1898
33 Ga0070679_100381812 3300005530 Bacteria 1355
34 Ga0070697_100000779 3300005536 Bacteria 23903
35 Ga0070697_100246646 3300005536 Bacteria 1526
36 Ga0070672_100022435 3300005543 Bacteria 4638
37 Ga0070695_100067779 3300005545 Bacteria 2328
38 Ga0070695_100141169 3300005545 Bacteria 1670
39 Ga0070695_100209168 3300005545 Bacteria 1399
40 Ga0070695_100218497 3300005545 Unclassified 1372
41 Ga0070696_100303187 3300005546 Bacteria 1224
42 Ga0070696_100443249 3300005546 Bacteria 1023
43 Ga0070665_100081533 3300005548 Bacteria 3241
44 Ga0070664_100170131 3300005564 Bacteria 1933
45 Ga0068857_100230460 3300005577 Bacteria 1694
46 Ga0068859_100003890 3300005617 Bacteria 15248
47 Ga0068859_100141983 3300005617 Bacteria 2475
48 Ga0068864_100054640 3300005618 Bacteria 3447
49 Ga0068864_100340568 3300005618 Bacteria 1413
50 Ga0068862_100051895 3300005844 Bacteria 3508
51 Ga0081455_10197675 3300005937 Bacteria 1508
52 Ga0075430_100118696 3300006846 Bacteria 2205
53 Ga0075430_100171298 3300006846 Bacteria 1806
54 Ga0075430_100233365 3300006846 Bacteria 1525
55 Ga0075431_100007015 3300006847 Bacteria 11193
56 Ga0075431_100119236 3300006847 Bacteria 2722
57 Ga0075431_100236171 3300006847 Bacteria 1861
58 Ga0075433_10003987 3300006852 Bacteria 11427
59 Ga0075433_10038607 3300006852 Bacteria 4125
60 Ga0075433_10132128 3300006852 Bacteria 2218
61 Ga0075433_10565464 3300006852 Bacteria 999
62 Ga0075434_100006497 3300006871 Bacteria 10722
63 Ga0075434_100009421 3300006871 Bacteria 9103
64 Ga0075434_100013626 3300006871 Bacteria 7749
65 Ga0075434_100068174 3300006871 Bacteria 3544
66 Ga0075429_100018276 3300006880 Bacteria 6070
67 Ga0075429_100093865 3300006880 Bacteria 2617
68 Ga0075436_100022796 3300006914 Bacteria 4301
69 Ga0075436_100028083 3300006914 Bacteria 3873
70 Ga0097620_100003890 3300006931 Bacteria 15248
71 Ga0097620_100141977 3300006931 Bacteria 2475
72 Ga0075435_100083770 3300007076 Bacteria 2622
73 Ga0075435_100147742 3300007076 Bacteria 1975
74 Ga0111539_10218502 3300009094 Bacteria 2220
75 Ga0111539_10372114 3300009094 Bacteria 1663
76 Ga0114129_10000088 3300009147 Bacteria 86607
77 Ga0114129_10072148 3300009147 Bacteria 4814
78 Ga0114129_10149662 3300009147 Bacteria 3195
79 Ga0114129_10998150 3300009147 Bacteria 1054
80 Ga0105248_10195494 3300009177 Bacteria 2279
81 Ga0105248_10405309 3300009177 Bacteria 1535
82 Ga0105249_10452116 3300009553 Bacteria 1323
83 Ga0163163_10098673 3300014325 Bacteria 2942
84 Ga0157380_10878726 3300014326 Bacteria 921
85 Ga0157379_10109722 3300014968 Bacteria 2478
86 Ga0157379_10138369 3300014968 Bacteria 2195
87 Ga0157376_10425754 3300014969 Bacteria 1289
88 Ga0207684_10392468 3300025910 Bacteria 1193
89 Ga0207707_10003168 3300025912 Bacteria 14608
90 Ga0207707_10205923 3300025912 Bacteria 1714
91 Ga0207652_10008460 3300025921 Bacteria 8277
92 Ga0207646_10039352 3300025922 Bacteria 4256
93 Ga0207646_10042057 3300025922 Bacteria 4106
94 Ga0207646_10048864 3300025922 Bacteria 3790
95 Ga0207646_10051362 3300025922 Bacteria 3689
96 Ga0207659_10079708 3300025926 Bacteria 2417
97 Ga0207679_10021335 3300025945 Bacteria 4390
98 Ga0207712_10228078 3300025961 Bacteria 1493
99 Ga0207668_10096363 3300025972 Bacteria 2186
100 Ga0207648_10050541 3300026089 Bacteria 3635
101 Ga0207676_10008046 3300026095 Bacteria 7497
102 Ga0207676_10027158 3300026095 Bacteria 4261
103 Ga0209998_10032263 3300027717 Bacteria 1164
104 Ga0307408_100070942 3300031548 Bacteria 2574
105 Ga0307408_100078092 3300031548 Bacteria 2467
106 Ga0307408_100103293 3300031548 Bacteria 2175
107 Ga0316576_10019473 3300031727 Bacteria 4653
108 Ga0307413_10001912 3300031824 Bacteria 8246
109 Ga0307410_10001791 3300031852 Bacteria 9954
110 Ga0307410_10177589 3300031852 Bacteria 1610
111 Ga0307406_10011020 3300031901 Bacteria 5119
112 Ga0307406_10060570 3300031901 Bacteria 2441
113 Ga0307412_10026564 3300031911 Bacteria 3600
114 Ga0307409_100180281 3300031995 Bacteria 1869
115 Ga0307409_100208124 3300031995 Unclassified 1756
116 Ga0307416_100001153 3300032002 Bacteria 14195
117 Ga0307416_100144232 3300032002 Bacteria 2171
118 Ga0307414_10020983 3300032004 Bacteria 4085
119 Ga0307411_10000866 3300032005 Bacteria 11404
120 Ga0307415_100000248 3300032126 Bacteria 23334
121 Ga0373931_0097547 3300035691 Bacteria 1648
122 Ga0242420_027208 3300038996 Bacteria 1047
123 Ga0439448_0004318 3300042005 Bacteria 4010
124 Ga0451577_0066630 3300042876 Bacteria 3211
125 Ga0451577_0270271 3300042876 Bacteria 1540
126 Ga0451577_0692965 3300042876 Unclassified 923
127 Ga0453683_0005240 3300044673 Bacteria 9079
128 Ga0453683_0012079 3300044673 Bacteria 5672
129 Ga0453683_0183654 3300044673 Bacteria 1327
130 Ga0453683_0337042 3300044673 Unclassified 968
131 Ga0451576_0131426 3300045051 Bacteria 2609
132 Ga0451576_0695186 3300045051 Unclassified 1068
133 Ga0496104_0004848 3300048907 Bacteria 11724
134 Ga0496105_0498428 3300048908 Archaea 956
135 Ga0496106_0064902 3300048909 Bacteria 2779
136 Ga0496108_0000454 3300048911 Bacteria 32702
137 Ga0496108_0222891 3300048911 Bacteria 1639
138 Ga0496109_0002963 3300048912 Bacteria 14207
139 Ga0496109_0004696 3300048912 Bacteria 11401
140 Ga0496110_0009965 3300048913 Bacteria 7708
141 Ga0496110_0386600 3300048913 Bacteria 1275
142 Ga0496112_0000336 3300048915 Bacteria 30511
143 Ga0496112_0005775 3300048915 Bacteria 10763
144 Ga0496113_0000286 3300048916 Bacteria 23871
145 Ga0496113_0055111 3300048916 Bacteria 2979
146 Ga0501034_0016000 3300049571 Bacteria 7700
147 Ga0501034_0026596 3300049571 Bacteria 5891
148 Ga0501034_0041344 3300049571 Bacteria 4664
149 Ga0501037_0190299 3300049573 Bacteria 1453
150 Ga0501038_0194352 3300049574 Bacteria 1631
151 Ga0501038_0298951 3300049574 Bacteria 1264
152 Ga0501039_0090944 3300049575 Bacteria 2378
153 Ga0501041_0374513 3300049577 Bacteria 901
154 Ga0501042_0026329 3300049578 Bacteria 4088
155 Ga0501048_0057313 3300049582 Bacteria 2763
156 Ga0501048_0265070 3300049582 Bacteria 1221
157 Ga0501067_0000231 3300049583 Bacteria 31040
158 Ga0501067_0005455 3300049583 Bacteria 7059
159 Ga0501067_0023071 3300049583 Bacteria 3446
160 Ga0501068_0000304 3300049584 Bacteria 24649
161 Ga0501068_0000800 3300049584 Bacteria 16291
162 Ga0501069_0013018 3300049585 Bacteria 4431
163 Ga0501069_0041193 3300049585 Bacteria 2552
164 Ga0501069_0073829 3300049585 Bacteria 1913
165 Ga0501070_0002351 3300049586 Bacteria 16606
166 Ga0501070_0003433 3300049586 Bacteria 13735
167 Ga0501070_0028949 3300049586 Bacteria 4645
168 Ga0501070_0271919 3300049586 Bacteria 1383
169 Ga0501071_0000299 3300049587 Bacteria 23755
170 Ga0501071_0008262 3300049587 Bacteria 6872
171 Ga0501071_0056823 3300049587 Bacteria 2828
172 Ga0501071_0084457 3300049587 Bacteria 2327
173 Ga0501071_0203137 3300049587 Bacteria 1489
174 Ga0501072_0000976 3300049588 Bacteria 21106
175 Ga0501072_0014570 3300049588 Bacteria 6024
176 Ga0501072_0041541 3300049588 Bacteria 3612
177 Ga0501073_0008146 3300049589 Bacteria 7774
178 Ga0501073_0011090 3300049589 Bacteria 6593
179 Ga0501073_0122564 3300049589 Bacteria 1802
180 Ga0501073_0136666 3300049589 Unclassified 1699
181 Ga0501074_0015128 3300049590 Bacteria 5609
182 Ga0501074_0109754 3300049590 Unclassified 1974
183 Ga0501075_0004823 3300049591 Bacteria 9178
184 Ga0501075_0157365 3300049591 Bacteria 1733
185 Ga0501076_0003299 3300049592 Bacteria 11307
186 Ga0501076_0037544 3300049592 Bacteria 3799
187 Ga0501076_0192503 3300049592 Bacteria 1664
188 Ga0501076_0222020 3300049592 Bacteria 1544
189 Ga0501077_0023261 3300049593 Bacteria 3929
190 Ga0501079_0006327 3300049741 Bacteria 8885
191 Ga0501079_0019540 3300049741 Bacteria 5174
192 Ga0501079_0033412 3300049741 Bacteria 3957
193 Ga0501079_0107389 3300049741 Bacteria 2167
194 Ga0501080_0008922 3300049742 Bacteria 9118
195 Ga0501080_0076861 3300049742 Bacteria 3105
196 Ga0501080_0116912 3300049742 Bacteria 2471
197 Ga0501080_0377009 3300049742 Bacteria 1278
198 Ga0501080_0494338 3300049742 Unclassified 1094
199 Ga0501081_0002874 3300049743 Bacteria 10940
200 Ga0501081_0019141 3300049743 Bacteria 4554
201 Ga0501081_0023729 3300049743 Bacteria 4113
202 Ga0501081_0200177 3300049743 Bacteria 1448
203 Ga0501081_0200574 3300049743 Bacteria 1447
204 Ga0501083_0019922 3300049744 Bacteria 4668
205 Ga0501083_0031707 3300049744 Bacteria 3627
206 Ga0501045_0006525 3300049824 Bacteria 8089
207 Ga0501045_0456606 3300049824 Bacteria 949
208 nmdc:mga05p37_114614_c1 3300050507 Bacteria 3313
209 nmdc:mga05p37_132304_c1 3300050507 Bacteria 3060
210 nmdc:mga05p37_185854_c1 3300050507 Bacteria 2527
211 nmdc:mga05p37_2000_c1 3300050507 Bacteria 23799
212 nmdc:mga05p37_52409_c1 3300050507 Bacteria 5017
213 nmdc:mga0qj67_117139_c1 3300050509 Bacteria 2153
214 nmdc:mga0qj67_46988_c1 3300050509 Bacteria 3409
215 nmdc:mga06r32_377153_c1 3300050510 Unclassified 1401
216 nmdc:mga06r32_62278_c1 3300050510 Bacteria 3594
217 nmdc:mga06r32_718901_c1 3300050510 Bacteria 963
218 nmdc:mga06r32_76602_c1 3300050510 Bacteria 3248
219 nmdc:mga06r32_90514_c1 3300050510 Bacteria 2989
220 nmdc:mga0n895_112948_c1 3300050512 Bacteria 2734
221 nmdc:mga0n895_237747_c1 3300050512 Bacteria 1848
222 nmdc:mga0n895_28077_c1 3300050512 Bacteria 5351
223 nmdc:mga0n895_530120_c1 3300050512 Bacteria 1185
224 nmdc:mga0n895_88004_c1 3300050512 Bacteria 3105
225 nmdc:mga0rr50_33212_c1 3300050513 Bacteria 3684
226 nmdc:mga08x19_34630_c1 3300050514 Bacteria 3193
227 nmdc:mga08x19_4854_c1 3300050514 Bacteria 3945
228 nmdc:mga0a205_125969_c1 3300050515 Bacteria 2461
229 nmdc:mga0a205_16984_c1 3300050515 Bacteria 6813
230 nmdc:mga0a205_345092_c1 3300050515 Bacteria 1357
231 nmdc:mga0a205_38589_c1 3300050515 Bacteria 4595
232 Ga0501084_0003949 3300054114 Bacteria 12082
233 Ga0501084_0007109 3300054114 Bacteria 9225
234 Ga0501084_0012910 3300054114 Bacteria 6916
235 Ga0501084_0062239 3300054114 Bacteria 3124
236 Ga0590071_000835 3300059421 Bacteria 8573
237 Ga0501082_0009233 3300060353 Bacteria 8501
238 Ga0501082_0015338 3300060353 Bacteria 6593
239 Ga0501082_0021388 3300060353 Bacteria 5580
240 Ga0501082_0054793 3300060353 Bacteria 3437
241 Ga0501082_0417040 3300060353 Bacteria 1172
242 Ga0307411_10263096
243 rootL2_10009041
244 Ga0065715_10279780
245 Ga0070670_100853077
246 Ga0070668_100073955
247 Ga0070675_100084188
248 Ga0070675_100131688
249 Ga0070673_100592678
250 Ga0070659_100149956
251 Ga0070701_10077228
252 Ga0070705_100028781
253 Ga0070705_100327490
254 Ga0070694_100014109
255 Ga0070708_100013483
256 Ga0070708_100042780
257 Ga0070708_100116071
258 Ga0070681_10028053
259 Ga0070681_10050001
260 Ga0070706_100377045
261 Ga0070707_100002429
262 Ga0070707_100012668
263 Ga0070707_100034120
264 Ga0070707_100070577
265 Ga0070707_100218242
266 Ga0070707_100408358
267 Ga0070698_100061121
268 Ga0070698_100104640
269 Ga0070699_100000223
270 Ga0070699_100000517
271 Ga0070699_100011001
272 Ga0070699_100015741
273 Ga0070699_100175853
274 Ga0070679_100381812
275 Ga0070697_100000779
276 Ga0070697_100246646
277 Ga0070672_100022435
278 Ga0070695_100067779
279 Ga0070695_100141169
280 Ga0070695_100209168
281 Ga0070695_100218497
282 Ga0070696_100303187
283 Ga0070696_100443249
284 Ga0070665_100081533
285 Ga0070664_100170131
286 Ga0068857_100230460
287 Ga0068859_100003890
288 Ga0068859_100141983
289 Ga0068864_100054640
290 Ga0068864_100340568
291 Ga0068862_100051895
292 Ga0081455_10197675
293 Ga0075430_100118696
294 Ga0075430_100171298
295 Ga0075430_100233365
296 Ga0075431_100007015
297 Ga0075431_100119236
298 Ga0075431_100236171
299 Ga0075433_10003987
300 Ga0075433_10038607
301 Ga0075433_10132128
302 Ga0075433_10565464
303 Ga0075434_100006497
304 Ga0075434_100009421
305 Ga0075434_100013626
306 Ga0075434_100068174
307 Ga0075429_100018276
308 Ga0075429_100093865
309 Ga0075436_100022796
310 Ga0075436_100028083
311 Ga0097620_100003890
312 Ga0097620_100141977
313 Ga0075435_100083770
314 Ga0075435_100147742
315 Ga0111539_10218502
316 Ga0111539_10372114
317 Ga0114129_10000088
318 Ga0114129_10072148
319 Ga0114129_10149662
320 Ga0114129_10998150
321 Ga0105248_10195494
322 Ga0105248_10405309
323 Ga0105249_10452116
324 Ga0163163_10098673
325 Ga0157380_10878726
326 Ga0157379_10109722
327 Ga0157379_10138369
328 Ga0157376_10425754
329 Ga0207684_10392468
330 Ga0207707_10003168
331 Ga0207707_10205923
332 Ga0207652_10008460
333 Ga0207646_10039352
334 Ga0207646_10042057
335 Ga0207646_10048864
336 Ga0207646_10051362
337 Ga0207659_10079708
338 Ga0207679_10021335
339 Ga0207712_10228078
340 Ga0207668_10096363
341 Ga0207648_10050541
342 Ga0207676_10008046
343 Ga0207676_10027158
344 Ga0209998_10032263
345 Ga0307408_100070942
346 Ga0307408_100078092
347 Ga0307408_100103293
348 Ga0316576_10019473
349 Ga0307413_10001912
350 Ga0307410_10001791
351 Ga0307410_10177589
352 Ga0307406_10011020
353 Ga0307406_10060570
354 Ga0307412_10026564
355 Ga0307409_100180281
356 Ga0307409_100208124
357 Ga0307416_100001153
358 Ga0307416_100144232
359 Ga0307414_10020983
360 Ga0307411_10000866
361 Ga0307415_100000248
362 Ga0373931_0097547
363 Ga0242420_027208
364 Ga0439448_0004318
365 Ga0451577_0066630
366 Ga0451577_0270271
367 Ga0451577_0692965
368 Ga0453683_0005240
369 Ga0453683_0012079
370 Ga0453683_0183654
371 Ga0453683_0337042
372 Ga0451576_0131426
373 Ga0451576_0695186
374 Ga0496104_0004848
375 Ga0496105_0498428
376 Ga0496106_0064902
377 Ga0496108_0000454
378 Ga0496108_0222891
379 Ga0496109_0002963
380 Ga0496109_0004696
381 Ga0496110_0009965
382 Ga0496110_0386600
383 Ga0496112_0000336
384 Ga0496112_0005775
385 Ga0496113_0000286
386 Ga0496113_0055111
387 Ga0501034_0016000
388 Ga0501034_0026596
389 Ga0501034_0041344
390 Ga0501037_0190299
391 Ga0501038_0194352
392 Ga0501038_0298951
393 Ga0501039_0090944
394 Ga0501041_0374513
395 Ga0501042_0026329
396 Ga0501048_0057313
397 Ga0501048_0265070
398 Ga0501067_0000231
399 Ga0501067_0005455
400 Ga0501067_0023071
401 Ga0501068_0000304
402 Ga0501068_0000800
403 Ga0501069_0013018
404 Ga0501069_0041193
405 Ga0501069_0073829
406 Ga0501070_0002351
407 Ga0501070_0003433
408 Ga0501070_0028949
409 Ga0501070_0271919
410 Ga0501071_0000299
411 Ga0501071_0008262
412 Ga0501071_0056823
413 Ga0501071_0084457
414 Ga0501071_0203137
415 Ga0501072_0000976
416 Ga0501072_0014570
417 Ga0501072_0041541
418 Ga0501073_0008146
419 Ga0501073_0011090
420 Ga0501073_0122564
421 Ga0501073_0136666
422 Ga0501074_0015128
423 Ga0501074_0109754
424 Ga0501075_0004823
425 Ga0501075_0157365
426 Ga0501076_0003299
427 Ga0501076_0037544
428 Ga0501076_0192503
429 Ga0501076_0222020
430 Ga0501077_0023261
431 Ga0501079_0006327
432 Ga0501079_0019540
433 Ga0501079_0033412
434 Ga0501079_0107389
435 Ga0501080_0008922
436 Ga0501080_0076861
437 Ga0501080_0116912
438 Ga0501080_0377009
439 Ga0501080_0494338
440 Ga0501081_0002874
441 Ga0501081_0019141
442 Ga0501081_0023729
443 Ga0501081_0200177
444 Ga0501081_0200574
445 Ga0501083_0019922
446 Ga0501083_0031707
447 Ga0501045_0006525
448 Ga0501045_0456606
449 nmdc:mga05p37_114614_c1
450 nmdc:mga05p37_132304_c1
451 nmdc:mga05p37_185854_c1
452 nmdc:mga05p37_2000_c1
453 nmdc:mga05p37_52409_c1
454 nmdc:mga0qj67_117139_c1
455 nmdc:mga0qj67_46988_c1
456 nmdc:mga06r32_377153_c1
457 nmdc:mga06r32_62278_c1
458 nmdc:mga06r32_718901_c1
459 nmdc:mga06r32_76602_c1
460 nmdc:mga06r32_90514_c1
461 nmdc:mga0n895_112948_c1
462 nmdc:mga0n895_237747_c1
463 nmdc:mga0n895_28077_c1
464 nmdc:mga0n895_530120_c1
465 nmdc:mga0n895_88004_c1
466 nmdc:mga0rr50_33212_c1
467 nmdc:mga08x19_34630_c1
468 nmdc:mga08x19_4854_c1
469 nmdc:mga0a205_125969_c1
470 nmdc:mga0a205_16984_c1
471 nmdc:mga0a205_345092_c1
472 nmdc:mga0a205_38589_c1
473 Ga0501084_0003949
474 Ga0501084_0007109
475 Ga0501084_0012910
476 Ga0501084_0062239
477 Ga0590071_000835
478 Ga0501082_0009233
479 Ga0501082_0015338
480 Ga0501082_0021388
481 Ga0501082_0054793
482 Ga0501082_0417040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21948

LplA-B_cat

Lipoyl protein ligase A/B catalytic domain

42

247

0.95

PF03099

BPL_LplA_LipB

Biotin/lipoate A/B protein ligase family

80

204

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8crl-assembly2.cif.gz_B crystal structure of lpla1 in complex with the inhibitor c3 (listeria monocytogenes) 0.8088 5 91
2c7i-assembly3.cif.gz_C structure of protein ta0514, putative lipoate protein ligase from t. acidophilum. 0.7888 1 247
2c7i-assembly2.cif.gz_B structure of protein ta0514, putative lipoate protein ligase from t. acidophilum. 0.7872 1 247
2c7i-assembly4.cif.gz_D structure of protein ta0514, putative lipoate protein ligase from t. acidophilum. 0.7862 1 247
2c7i-assembly3.cif.gz_C structure of protein ta0514, putative lipoate protein ligase from t. acidophilum. 0.7858 1 247
ID Description Score Start End Superfamily
af_P09391_1_67_3.30.70.2350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8442 105 124 3.30.70.2350
af_Q2FY37_5_276_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8025 1 247 3.30.930.10
af_Q2FY37_5_276_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.7996 1 247 3.30.930.10
af_Q54KY1_54_299_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.7474 1 247 3.30.930.10
af_Q2FZN7_2_241_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.7464 5 246 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A6N8ZMC1-F1-model_v4 deleted 0.9364 1 147
AF-A0A382RXC9-F1-model_v4 BPL/LPL catalytic domain-containing protein 0.9348 3 92 GO:0036211
AF-A0A7C7GMP9-F1-model_v4 BPL/LPL catalytic domain-containing protein 0.9317 3 91 GO:0036211
AF-A0A6L8FCS1-F1-model_v4 deleted 0.9316 1 108
AF-A0A2V7G5C7-F1-model_v4 BPL/LPL catalytic domain-containing protein 0.9313 6 128 GO:0036211

Map