F353896

General Info

Members Datasets Scaffolds Average Seq Length
241 101 482 178

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10258924|Ga0265316_102589242
Length 188
Sequence MSAQPDADKKPSAQTPLGLLAEFETAAEIKQAAMRVRDAGYQHWDVFTPFPIHGLEDAMGLRGSRVGWFAFVGGAIGFCSGMLMIWFMNGFDFPLVVGGKPLFSPVFAFPVSYELTILFGSFGAVLGMLVTNRLPRWHNPLFANERFIRATHDRFFIVIECRDPKFSETQTRELLSAAGARHIELIAG

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
19 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
23 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
24 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
31 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
32 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
33 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
34 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
35 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
36 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
37 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
38 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
39 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
40 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
41 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
42 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
43 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
44 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
45 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
46 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
47 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
48 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
49 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
50 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
51 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
52 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
53 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
54 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
55 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
56 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
57 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
58 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
59 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
63 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
64 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
65 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
66 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
67 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
68 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
69 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
90 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
91 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
92 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
93 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
94 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
95 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
97 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
98 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
99 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
100 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
101 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.93
Metatranscriptomes 1.66
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 0.41
Rhizosphere 94.61
Stem 0
Stem Tuber 0
Unclassified 4.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10258924 3300031344 Bacteria 1276
2 rootH2_10018239 3300003320 Bacteria 6763
3 rootH2_10022113 3300003320 Bacteria 13857
4 rootL2_10117528 3300003322 Bacteria 1960
5 rootH1_10004607 3300003323 Bacteria 2980
6 rootH1_10145147 3300003323 Bacteria 2886
7 Ga0058862_12318234 3300004803 Bacteria 1245
8 Ga0070683_100002455 3300005329 Bacteria 14752
9 Ga0070683_100176685 3300005329 Bacteria 2027
10 Ga0070690_100176247 3300005330 Bacteria 1475
11 Ga0068869_100000073 3300005334 Bacteria 46167
12 Ga0070680_100353686 3300005336 Bacteria 1249
13 Ga0068868_100764005 3300005338 Unclassified 869
14 Ga0068867_100017105 3300005459 Bacteria 5151
15 Ga0070684_100132141 3300005535 Bacteria 2252
16 Ga0068853_100863574 3300005539 Bacteria 868
17 Ga0068856_100000714 3300005614 Bacteria 36072
18 Ga0068856_100230900 3300005614 Unclassified 1866
19 Ga0068859_101517461 3300005617 Unclassified 740
20 Ga0070717_10000016 3300006028 Bacteria 205932
21 Ga0097621_100003421 3300006237 Bacteria 10930
22 Ga0068871_100446833 3300006358 Bacteria 1158
23 Ga0068865_100024994 3300006881 Bacteria 3924
24 Ga0097620_101517428 3300006931 Unclassified 740
25 Ga0105240_11194921 3300009093 Unclassified 805
26 Ga0163163_10006854 3300014325 Bacteria 10001
27 Ga0157376_10241072 3300014969 Bacteria 1684
28 Ga0207704_10003359 3300025938 Bacteria 7260
29 Ga0207689_10001238 3300025942 Bacteria 24606
30 Ga0207661_10038316 3300025944 Bacteria 3756
31 Ga0207639_10822549 3300026041 Bacteria 866
32 Ga0207702_10010953 3300026078 Bacteria 7564
33 Ga0207648_10003781 3300026089 Bacteria 15815
34 Ga0265337_1002393 3300028556 Bacteria 8648
35 Ga0265337_1011806 3300028556 Bacteria 2996
36 Ga0265337_1021389 3300028556 Bacteria 2016
37 Ga0265337_1046299 3300028556 Bacteria 1235
38 Ga0265337_1056024 3300028556 Bacteria 1100
39 Ga0265337_1149876 3300028556 Bacteria 632
40 Ga0265326_10097316 3300028558 Bacteria 835
41 Ga0265326_10134349 3300028558 Unclassified 705
42 Ga0265319_1000665 3300028563 Bacteria 22578
43 Ga0265319_1001446 3300028563 Bacteria 14186
44 Ga0265319_1001980 3300028563 Bacteria 11551
45 Ga0265319_1007888 3300028563 Bacteria 4730
46 Ga0265319_1013238 3300028563 Bacteria 3292
47 Ga0265319_1022808 3300028563 Bacteria 2274
48 Ga0265319_1023410 3300028563 Bacteria 2239
49 Ga0265319_1038803 3300028563 Bacteria 1617
50 Ga0265319_1145084 3300028563 Bacteria 736
51 Ga0265334_10001745 3300028573 Bacteria 10386
52 Ga0265318_10000548 3300028577 Bacteria 26669
53 Ga0265318_10001547 3300028577 Bacteria 13394
54 Ga0265318_10001825 3300028577 Bacteria 12068
55 Ga0265318_10002847 3300028577 Bacteria 9034
56 Ga0265318_10013943 3300028577 Bacteria 3382
57 Ga0265318_10076140 3300028577 Bacteria 1241
58 Ga0265318_10077976 3300028577 Bacteria 1224
59 Ga0265318_10114590 3300028577 Bacteria 991
60 Ga0265323_10000084 3300028653 Bacteria 53536
61 Ga0265323_10003487 3300028653 Bacteria 6936
62 Ga0265323_10007294 3300028653 Bacteria 4605
63 Ga0265323_10008940 3300028653 Bacteria 4114
64 Ga0265323_10026778 3300028653 Bacteria 2171
65 Ga0265322_10000652 3300028654 Bacteria 13008
66 Ga0265322_10001185 3300028654 Bacteria 8934
67 Ga0265322_10014107 3300028654 Bacteria 2312
68 Ga0265322_10051140 3300028654 Bacteria 1173
69 Ga0265336_10028990 3300028666 Bacteria 1727
70 Ga0265336_10114242 3300028666 Bacteria 804
71 Ga0307515_10359462 3300028794 Bacteria 1098
72 Ga0265338_10021567 3300028800 Bacteria 6711
73 Ga0265338_10025430 3300028800 Bacteria 6005
74 Ga0265338_10027044 3300028800 Bacteria 5766
75 Ga0265338_10125284 3300028800 Bacteria 2039
76 Ga0265324_10006967 3300029957 Bacteria 4652
77 Ga0265324_10017452 3300029957 Bacteria 2610
78 Ga0265324_10044996 3300029957 Bacteria 1521
79 Ga0265324_10048188 3300029957 Bacteria 1465
80 Ga0265324_10053872 3300029957 Bacteria 1381
81 Ga0265330_10003711 3300031235 Bacteria 7907
82 Ga0265332_10091947 3300031238 Bacteria 1282
83 Ga0265332_10100670 3300031238 Bacteria 1219
84 Ga0265328_10113555 3300031239 Unclassified 1007
85 Ga0265328_10161277 3300031239 Bacteria 845
86 Ga0265320_10000996 3300031240 Bacteria 21016
87 Ga0265320_10001746 3300031240 Bacteria 15409
88 Ga0265320_10001816 3300031240 Bacteria 15138
89 Ga0265320_10004326 3300031240 Bacteria 9324
90 Ga0265320_10021397 3300031240 Bacteria 3479
91 Ga0265320_10025626 3300031240 Bacteria 3098
92 Ga0265320_10026744 3300031240 Bacteria 3015
93 Ga0265320_10038821 3300031240 Bacteria 2385
94 Ga0265320_10065694 3300031240 Bacteria 1721
95 Ga0265320_10095990 3300031240 Bacteria 1369
96 Ga0265320_10114184 3300031240 Bacteria 1235
97 Ga0265320_10143083 3300031240 Bacteria 1082
98 Ga0265325_10078543 3300031241 Bacteria 1644
99 Ga0265325_10140172 3300031241 Unclassified 1151
100 Ga0265329_10015111 3300031242 Bacteria 2706
101 Ga0265340_10201445 3300031247 Unclassified 895
102 Ga0265339_10072022 3300031249 Bacteria 1840
103 Ga0265339_10162813 3300031249 Bacteria 1122
104 Ga0265331_10022680 3300031250 Bacteria 3201
105 Ga0265331_10022938 3300031250 Bacteria 3178
106 Ga0265331_10037117 3300031250 Bacteria 2387
107 Ga0265327_10000902 3300031251 Bacteria 43665
108 Ga0265327_10006995 3300031251 Bacteria 8847
109 Ga0265327_10014108 3300031251 Bacteria 5249
110 Ga0265327_10037541 3300031251 Bacteria 2651
111 Ga0265327_10042318 3300031251 Bacteria 2446
112 Ga0265327_10173417 3300031251 Bacteria 990
113 Ga0265316_10013056 3300031344 Bacteria 7408
114 Ga0265316_10026297 3300031344 Bacteria 4843
115 Ga0265316_10036593 3300031344 Bacteria 3968
116 Ga0265316_10101158 3300031344 Bacteria 2190
117 Ga0265316_10296377 3300031344 Bacteria 1179
118 Ga0265316_10360017 3300031344 Bacteria 1052
119 Ga0265316_10422363 3300031344 Bacteria 958
120 Ga0265316_10422927 3300031344 Bacteria 958
121 Ga0265316_10569431 3300031344 Bacteria 805
122 Ga0307408_100000007 3300031548 Bacteria 463086
123 Ga0265313_10000973 3300031595 Bacteria 28336
124 Ga0265313_10001121 3300031595 Bacteria 25609
125 Ga0265313_10005645 3300031595 Bacteria 9143
126 Ga0265313_10005770 3300031595 Bacteria 9001
127 Ga0265313_10007700 3300031595 Bacteria 7294
128 Ga0265313_10014282 3300031595 Bacteria 4703
129 Ga0265313_10058574 3300031595 Bacteria 1815
130 Ga0265313_10066802 3300031595 Bacteria 1665
131 Ga0265313_10080186 3300031595 Bacteria 1484
132 Ga0265313_10105052 3300031595 Bacteria 1248
133 Ga0307508_10000229 3300031616 Bacteria 68303
134 Ga0307508_10581686 3300031616 Bacteria 720
135 Ga0265314_10005920 3300031711 Bacteria 10938
136 Ga0265314_10013461 3300031711 Bacteria 6606
137 Ga0265314_10033182 3300031711 Bacteria 3789
138 Ga0265314_10073029 3300031711 Bacteria 2289
139 Ga0265314_10096757 3300031711 Bacteria 1909
140 Ga0265314_10182872 3300031711 Bacteria 1254
141 Ga0265314_10261498 3300031711 Bacteria 988
142 Ga0265314_10405438 3300031711 Bacteria 736
143 Ga0265342_10012187 3300031712 Bacteria 5832
144 Ga0265342_10014976 3300031712 Bacteria 5123
145 Ga0265342_10031216 3300031712 Bacteria 3295
146 Ga0265342_10049648 3300031712 Bacteria 2510
147 Ga0265342_10066663 3300031712 Bacteria 2108
148 Ga0265342_10100993 3300031712 Bacteria 1643
149 Ga0265342_10158200 3300031712 Bacteria 1254
150 Ga0265342_10180338 3300031712 Bacteria 1157
151 Ga0265342_10193608 3300031712 Unclassified 1108
152 Ga0265342_10252851 3300031712 Bacteria 940
153 Ga0307413_11110583 3300031824 Bacteria 683
154 Ga0307410_10000053 3300031852 Bacteria 40797
155 Ga0307407_10327254 3300031903 Bacteria 1077
156 Ga0307412_10641942 3300031911 Bacteria 904
157 Ga0307409_100000152 3300031995 Bacteria 26310
158 Ga0307416_100000678 3300032002 Bacteria 17716
159 Ga0307411_10304085 3300032005 Bacteria 1280
160 Ga0307411_11266288 3300032005 Bacteria 671
161 Ga0373954_0405215 3300035118 Bacteria 674
162 Ga0373933_0050637 3300035724 Bacteria 2480
163 Ga0451802_0462415 3300041460 Bacteria 658
164 Ga0439443_044298 3300042003 Bacteria 766
165 Ga0439445_0012432 3300042004 Bacteria 2046
166 Ga0451577_0000167 3300042876 Bacteria 144675
167 Ga0451577_0008076 3300042876 Bacteria 10267
168 Ga0451577_0080269 3300042876 Bacteria 2909
169 Ga0451577_0130578 3300042876 Bacteria 2253
170 Ga0451577_0132097 3300042876 Bacteria 2240
171 Ga0451577_0165438 3300042876 Bacteria 1992
172 Ga0451577_0196028 3300042876 Bacteria 1823
173 Ga0451577_0441456 3300042876 Bacteria 1182
174 Ga0453683_0001303 3300044673 Bacteria 21995
175 Ga0453683_0803166 3300044673 Bacteria 619
176 Ga0466965_0262821 3300044683 Bacteria 928
177 Ga0453684_0000001 3300044712 Bacteria 2623166
178 Ga0453684_0011425 3300044712 Bacteria 14897
179 Ga0453684_0038631 3300044712 Bacteria 6522
180 Ga0453684_0135277 3300044712 Bacteria 2952
181 Ga0453684_0221333 3300044712 Bacteria 2192
182 Ga0453684_0345010 3300044712 Bacteria 1680
183 Ga0453684_1090851 3300044712 Bacteria 844
184 Ga0453684_1403307 3300044712 Bacteria 724
185 Ga0451576_0000183 3300045051 Bacteria 157422
186 Ga0451576_0000901 3300045051 Bacteria 56452
187 Ga0451576_0012572 3300045051 Bacteria 9502
188 Ga0451576_0022587 3300045051 Bacteria 6820
189 Ga0451576_0023837 3300045051 Bacteria 6621
190 Ga0451576_0833521 3300045051 Unclassified 968
191 Ga0451576_0946588 3300045051 Bacteria 903
192 Ga0451576_0990007 3300045051 Bacteria 881
193 Ga0466967_0027423 3300045976 Bacteria 4738
194 Ga0501305_000419 3300049161 Bacteria 3435
195 Ga0501307_009122 3300049162 Bacteria 1129
196 Ga0501312_000650 3300049528 Bacteria 2955
197 Ga0501031_0026865 3300049568 Bacteria 3752
198 Ga0501032_0000259 3300049569 Bacteria 44300
199 Ga0501032_0016013 3300049569 Bacteria 5278
200 Ga0501032_0054467 3300049569 Bacteria 2692
201 Ga0501033_0010007 3300049570 Bacteria 7282
202 Ga0501033_0014158 3300049570 Bacteria 6064
203 Ga0501034_0033587 3300049571 Bacteria 5203
204 Ga0501034_0153584 3300049571 Bacteria 2277
205 Ga0501036_0064560 3300049572 Bacteria 3098
206 Ga0501037_0035403 3300049573 Bacteria 3682
207 Ga0501037_0037505 3300049573 Bacteria 3573
208 Ga0501038_0009952 3300049574 Bacteria 8709
209 Ga0501039_0053951 3300049575 Bacteria 3111
210 Ga0501042_0061001 3300049578 Bacteria 2694
211 Ga0501046_0001857 3300049580 Bacteria 20108
212 Ga0501046_0027049 3300049580 Bacteria 4682
213 Ga0501046_0030968 3300049580 Bacteria 4342
214 Ga0501046_0064883 3300049580 Bacteria 2849
215 Ga0501047_0005365 3300049581 Bacteria 12046
216 Ga0501047_0041871 3300049581 Bacteria 4425
217 Ga0501047_0477862 3300049581 Bacteria 1074
218 Ga0501047_0811069 3300049581 Unclassified 750
219 Ga0501048_0033631 3300049582 Bacteria 3703
220 Ga0501048_0081469 3300049582 Bacteria 2283
221 Ga0501068_0171888 3300049584 Bacteria 1368
222 Ga0501070_1162562 3300049586 Bacteria 593
223 Ga0501227_035451 3300049665 Bacteria 1214
224 Ga0501243_000069 3300049675 Bacteria 10232
225 Ga0501080_0089657 3300049742 Bacteria 2857
226 Ga0501083_0000237 3300049744 Bacteria 35480
227 Ga0501083_0012373 3300049744 Bacteria 5971
228 Ga0501083_0152071 3300049744 Bacteria 1515
229 Ga0501035_0000828 3300049822 Bacteria 33006
230 Ga0501035_0077631 3300049822 Bacteria 2934
231 Ga0501035_0146038 3300049822 Bacteria 2054
232 Ga0501035_0169454 3300049822 Bacteria 1887
233 Ga0501044_0000358 3300049823 Bacteria 57147
234 Ga0501044_0004412 3300049823 Bacteria 15742
235 Ga0501044_0236789 3300049823 Bacteria 1771
236 Ga0501044_0979386 3300049823 Bacteria 718
237 Ga0500568_0108506 3300053139 Bacteria 1038
238 Ga0500588_0090594 3300053146 Bacteria 1039
239 Ga0500622_0085055 3300053156 Bacteria 1578
240 Ga0466962_0034471 3300061719 Bacteria 2423
241 2788435041 2786546940 Bacteria 6396474
242 Ga0265316_10258924
243 rootH2_10018239
244 rootH2_10022113
245 rootL2_10117528
246 rootH1_10004607
247 rootH1_10145147
248 Ga0058862_12318234
249 Ga0070683_100002455
250 Ga0070683_100176685
251 Ga0070690_100176247
252 Ga0068869_100000073
253 Ga0070680_100353686
254 Ga0068868_100764005
255 Ga0068867_100017105
256 Ga0070684_100132141
257 Ga0068853_100863574
258 Ga0068856_100000714
259 Ga0068856_100230900
260 Ga0068859_101517461
261 Ga0070717_10000016
262 Ga0097621_100003421
263 Ga0068871_100446833
264 Ga0068865_100024994
265 Ga0097620_101517428
266 Ga0105240_11194921
267 Ga0163163_10006854
268 Ga0157376_10241072
269 Ga0207704_10003359
270 Ga0207689_10001238
271 Ga0207661_10038316
272 Ga0207639_10822549
273 Ga0207702_10010953
274 Ga0207648_10003781
275 Ga0265337_1002393
276 Ga0265337_1011806
277 Ga0265337_1021389
278 Ga0265337_1046299
279 Ga0265337_1056024
280 Ga0265337_1149876
281 Ga0265326_10097316
282 Ga0265326_10134349
283 Ga0265319_1000665
284 Ga0265319_1001446
285 Ga0265319_1001980
286 Ga0265319_1007888
287 Ga0265319_1013238
288 Ga0265319_1022808
289 Ga0265319_1023410
290 Ga0265319_1038803
291 Ga0265319_1145084
292 Ga0265334_10001745
293 Ga0265318_10000548
294 Ga0265318_10001547
295 Ga0265318_10001825
296 Ga0265318_10002847
297 Ga0265318_10013943
298 Ga0265318_10076140
299 Ga0265318_10077976
300 Ga0265318_10114590
301 Ga0265323_10000084
302 Ga0265323_10003487
303 Ga0265323_10007294
304 Ga0265323_10008940
305 Ga0265323_10026778
306 Ga0265322_10000652
307 Ga0265322_10001185
308 Ga0265322_10014107
309 Ga0265322_10051140
310 Ga0265336_10028990
311 Ga0265336_10114242
312 Ga0307515_10359462
313 Ga0265338_10021567
314 Ga0265338_10025430
315 Ga0265338_10027044
316 Ga0265338_10125284
317 Ga0265324_10006967
318 Ga0265324_10017452
319 Ga0265324_10044996
320 Ga0265324_10048188
321 Ga0265324_10053872
322 Ga0265330_10003711
323 Ga0265332_10091947
324 Ga0265332_10100670
325 Ga0265328_10113555
326 Ga0265328_10161277
327 Ga0265320_10000996
328 Ga0265320_10001746
329 Ga0265320_10001816
330 Ga0265320_10004326
331 Ga0265320_10021397
332 Ga0265320_10025626
333 Ga0265320_10026744
334 Ga0265320_10038821
335 Ga0265320_10065694
336 Ga0265320_10095990
337 Ga0265320_10114184
338 Ga0265320_10143083
339 Ga0265325_10078543
340 Ga0265325_10140172
341 Ga0265329_10015111
342 Ga0265340_10201445
343 Ga0265339_10072022
344 Ga0265339_10162813
345 Ga0265331_10022680
346 Ga0265331_10022938
347 Ga0265331_10037117
348 Ga0265327_10000902
349 Ga0265327_10006995
350 Ga0265327_10014108
351 Ga0265327_10037541
352 Ga0265327_10042318
353 Ga0265327_10173417
354 Ga0265316_10013056
355 Ga0265316_10026297
356 Ga0265316_10036593
357 Ga0265316_10101158
358 Ga0265316_10296377
359 Ga0265316_10360017
360 Ga0265316_10422363
361 Ga0265316_10422927
362 Ga0265316_10569431
363 Ga0307408_100000007
364 Ga0265313_10000973
365 Ga0265313_10001121
366 Ga0265313_10005645
367 Ga0265313_10005770
368 Ga0265313_10007700
369 Ga0265313_10014282
370 Ga0265313_10058574
371 Ga0265313_10066802
372 Ga0265313_10080186
373 Ga0265313_10105052
374 Ga0307508_10000229
375 Ga0307508_10581686
376 Ga0265314_10005920
377 Ga0265314_10013461
378 Ga0265314_10033182
379 Ga0265314_10073029
380 Ga0265314_10096757
381 Ga0265314_10182872
382 Ga0265314_10261498
383 Ga0265314_10405438
384 Ga0265342_10012187
385 Ga0265342_10014976
386 Ga0265342_10031216
387 Ga0265342_10049648
388 Ga0265342_10066663
389 Ga0265342_10100993
390 Ga0265342_10158200
391 Ga0265342_10180338
392 Ga0265342_10193608
393 Ga0265342_10252851
394 Ga0307413_11110583
395 Ga0307410_10000053
396 Ga0307407_10327254
397 Ga0307412_10641942
398 Ga0307409_100000152
399 Ga0307416_100000678
400 Ga0307411_10304085
401 Ga0307411_11266288
402 Ga0373954_0405215
403 Ga0373933_0050637
404 Ga0451802_0462415
405 Ga0439443_044298
406 Ga0439445_0012432
407 Ga0451577_0000167
408 Ga0451577_0008076
409 Ga0451577_0080269
410 Ga0451577_0130578
411 Ga0451577_0132097
412 Ga0451577_0165438
413 Ga0451577_0196028
414 Ga0451577_0441456
415 Ga0453683_0001303
416 Ga0453683_0803166
417 Ga0466965_0262821
418 Ga0453684_0000001
419 Ga0453684_0011425
420 Ga0453684_0038631
421 Ga0453684_0135277
422 Ga0453684_0221333
423 Ga0453684_0345010
424 Ga0453684_1090851
425 Ga0453684_1403307
426 Ga0451576_0000183
427 Ga0451576_0000901
428 Ga0451576_0012572
429 Ga0451576_0022587
430 Ga0451576_0023837
431 Ga0451576_0833521
432 Ga0451576_0946588
433 Ga0451576_0990007
434 Ga0466967_0027423
435 Ga0501305_000419
436 Ga0501307_009122
437 Ga0501312_000650
438 Ga0501031_0026865
439 Ga0501032_0000259
440 Ga0501032_0016013
441 Ga0501032_0054467
442 Ga0501033_0010007
443 Ga0501033_0014158
444 Ga0501034_0033587
445 Ga0501034_0153584
446 Ga0501036_0064560
447 Ga0501037_0035403
448 Ga0501037_0037505
449 Ga0501038_0009952
450 Ga0501039_0053951
451 Ga0501042_0061001
452 Ga0501046_0001857
453 Ga0501046_0027049
454 Ga0501046_0030968
455 Ga0501046_0064883
456 Ga0501047_0005365
457 Ga0501047_0041871
458 Ga0501047_0477862
459 Ga0501047_0811069
460 Ga0501048_0033631
461 Ga0501048_0081469
462 Ga0501068_0171888
463 Ga0501070_1162562
464 Ga0501227_035451
465 Ga0501243_000069
466 Ga0501080_0089657
467 Ga0501083_0000237
468 Ga0501083_0012373
469 Ga0501083_0152071
470 Ga0501035_0000828
471 Ga0501035_0077631
472 Ga0501035_0146038
473 Ga0501035_0169454
474 Ga0501044_0000358
475 Ga0501044_0004412
476 Ga0501044_0236789
477 Ga0501044_0979386
478 Ga0500568_0108506
479 Ga0500588_0090594
480 Ga0500622_0085055
481 Ga0466962_0034471
482 2788435041

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11821

ActD

Alternative complex III, ActD subunit

17

185

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6loe-assembly1.cif.gz_D cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.7787 4 177
6loe-assembly1.cif.gz_D cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.775 4 177
6f0k-assembly1.cif.gz_D alternative complex iii 0.7133 6 174
6f0k-assembly1.cif.gz_D alternative complex iii 0.7035 6 174
6btm-assembly1.cif.gz_D structure of alternative complex iii from flavobacterium johnsoniae (wild type) 0.6865 4 177
ID Description Score Start End Superfamily
af_A4HU35_25_141_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7992 55 116 1.10.10.1740
af_Q5AEB7_1_155_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7175 52 116 1.20.1250.20
3rrkA03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.5674 2 47 3.30.70.2750
3mtjA03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.5596 1 37 3.30.70.260
af_Q10MT3_41_141_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.5502 54 119 1.10.10.1740
ID Description Score Start End GO Terms
AF-M6K509-F1-model_v4 PF11821 domain protein 0.8649 48 119 GO:0016020
AF-M6K509-F1-model_v4 PF11821 domain protein 0.854 48 119 GO:0016020
AF-A0A4Q5X0C8-F1-model_v4 DUF3341 domain-containing protein 0.8293 1 177 GO:0009055
GO:0016020
GO:0020037
GO:0046872
AF-A0A2E1VQN1-F1-model_v4 Cytochrome c domain-containing protein 0.8264 2 177 GO:0009055
GO:0016020
GO:0020037
GO:0046872
AF-A0A4Q5X0C8-F1-model_v4 DUF3341 domain-containing protein 0.8252 1 177 GO:0009055
GO:0016020
GO:0020037
GO:0046872

Map