F353859

General Info

Members Datasets Scaffolds Average Seq Length
241 157 239 272

Family's Representative Sequence

Representative Sequence 3300026088|Ga0207641_10019489|Ga0207641_100194892
Length 292
Sequence LASFGVFGGYNIRREPVSQFSKMSIPLEDNLSDIIGKAQRGLKISDSQLAEQAGISLRQVQEIRAGGFDAIAITQIAAVLHLNADALADSGRKAWYPEPVEPTDGLASFNTPFDDMTVNSYLLWDPETRRAGAFDTGSDCSDMLDFLEQNTLRLDAIFLTHTHGDHIYDLDRLKARTGATAFVCKRERLEGAHSFEEGRRFEIGGLRVETRLTRGHSAGGITYVVTGLSKPVAVVGDAIFAGSMGGGMVSYEDALRTNREKILTLPEETVLCPGHGPMSTVGEEKRHNPFFA

Samples

Sample ID Description Type Environment
1 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
2 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300025227 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in- M7 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
126 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
138 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
154 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
155 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
156 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
157 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.49
Nodule 0
Rhizoplane 7.05
Rhizosphere 87.14
Stem 0
Stem Tuber 0
Unclassified 3.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10001740 3300001991 Bacteria 3113
2 JGI24035J26624_1003070 3300002126 Unclassified 1562
3 rootL2_10156963 3300003322 Bacteria 1634
4 rootH1_10066215 3300003323 Bacteria 25527
5 Ga0055530_10010031 3300003791 Bacteria 3559
6 Ga0070676_10009065 3300005328 Bacteria 5383
7 Ga0070676_10034245 3300005328 Bacteria 2916
8 Ga0070690_100040955 3300005330 Bacteria 2931
9 Ga0070690_100073808 3300005330 Bacteria 2220
10 Ga0070670_100019426 3300005331 Bacteria 5830
11 Ga0070670_100231075 3300005331 Bacteria 1610
12 Ga0070677_10027570 3300005333 Unclassified 2139
13 Ga0070666_10003440 3300005335 Bacteria 9591
14 Ga0070666_10022363 3300005335 Bacteria 4106
15 Ga0070666_10132350 3300005335 Bacteria 1733
16 Ga0068868_100113087 3300005338 Bacteria 2207
17 Ga0068868_100424032 3300005338 Bacteria 1152
18 Ga0070660_100551712 3300005339 Unclassified 961
19 Ga0070689_100018747 3300005340 Bacteria 5104
20 Ga0070689_100293336 3300005340 Bacteria 1352
21 Ga0070661_100000158 3300005344 Bacteria 55403
22 Ga0070661_100046725 3300005344 Bacteria 3168
23 Ga0070668_100050803 3300005347 Bacteria 3193
24 Ga0070668_100089373 3300005347 Bacteria 2426
25 Ga0070669_100006145 3300005353 Bacteria 8671
26 Ga0070669_100040774 3300005353 Bacteria 3375
27 Ga0070669_100163481 3300005353 Bacteria 1731
28 Ga0070675_100014482 3300005354 Bacteria 6220
29 Ga0070675_100041141 3300005354 Bacteria 3775
30 Ga0070671_100016952 3300005355 Bacteria 5892
31 Ga0070671_100048570 3300005355 Bacteria 3529
32 Ga0070671_100331804 3300005355 Bacteria 1296
33 Ga0070674_100004132 3300005356 Bacteria 8249
34 Ga0070673_100003933 3300005364 Bacteria 9333
35 Ga0070673_100072909 3300005364 Bacteria 2763
36 Ga0070688_100000527 3300005365 Bacteria 19316
37 Ga0070659_100075303 3300005366 Bacteria 2690
38 Ga0070659_100559824 3300005366 Unclassified 979
39 Ga0070667_100004695 3300005367 Bacteria 11463
40 Ga0070667_100121836 3300005367 Bacteria 2269
41 Ga0070667_100395705 3300005367 Unclassified 1257
42 Ga0070714_100266168 3300005435 Bacteria 1588
43 Ga0070713_100017517 3300005436 Bacteria 5420
44 Ga0070705_100425141 3300005440 Bacteria 990
45 Ga0070663_100398081 3300005455 Bacteria 1125
46 Ga0070678_100001827 3300005456 Bacteria 11474
47 Ga0070678_100005793 3300005456 Bacteria 7189
48 Ga0070678_100405302 3300005456 Unclassified 1185
49 Ga0070662_100057001 3300005457 Bacteria 2837
50 Ga0068867_100014888 3300005459 Bacteria 5512
51 Ga0068867_100184382 3300005459 Bacteria 1661
52 Ga0070685_10056986 3300005466 Unclassified 2273
53 Ga0070706_100081455 3300005467 Bacteria 2997
54 Ga0068853_100000006 3300005539 Bacteria 295921
55 Ga0068853_100205632 3300005539 Bacteria 1793
56 Ga0068853_100493917 3300005539 Bacteria 1155
57 Ga0070672_100000507 3300005543 Bacteria 22759
58 Ga0070665_100469921 3300005548 Bacteria 1268
59 Ga0068855_100001572 3300005563 Bacteria 28658
60 Ga0070664_100070572 3300005564 Unclassified 2992
61 Ga0068866_10130726 3300005718 Bacteria 1428
62 Ga0068858_100234535 3300005842 Bacteria 1740
63 Ga0068860_100068259 3300005843 Bacteria 3378
64 Ga0068862_100110871 3300005844 Unclassified 2408
65 Ga0081539_10003184 3300005985 Bacteria 20777
66 Ga0070716_100184969 3300006173 Bacteria 1371
67 Ga0070712_100005821 3300006175 Bacteria 7627
68 Ga0097621_100087635 3300006237 Bacteria 2600
69 Ga0097621_100110200 3300006237 Bacteria 2325
70 Ga0097621_100352055 3300006237 Unclassified 1310
71 Ga0068871_100015881 3300006358 Bacteria 5653
72 Ga0068865_100026395 3300006881 Bacteria 3829
73 Ga0111539_10439948 3300009094 Unclassified 1518
74 Ga0105242_10525978 3300009176 Unclassified 1129
75 Ga0105237_10068069 3300009545 Bacteria 3555
76 Ga0105239_10132355 3300010375 Bacteria 2775
77 Ga0105239_10382509 3300010375 Archaea 1591
78 Ga0105239_10482415 3300010375 Bacteria 1408
79 Ga0157373_10190311 3300013100 Bacteria 1446
80 Ga0157374_10013389 3300013296 Bacteria 7161
81 Ga0157374_10013540 3300013296 Bacteria 7121
82 Ga0157374_10025878 3300013296 Bacteria 5275
83 Ga0157374_10068203 3300013296 Bacteria 3346
84 Ga0157374_10816922 3300013296 Bacteria 948
85 Ga0157378_10029064 3300013297 Bacteria 4879
86 Ga0157378_10035625 3300013297 Bacteria 4403
87 Ga0157378_10055986 3300013297 Bacteria 3513
88 Ga0157378_10062578 3300013297 Bacteria 3323
89 Ga0157378_10144706 3300013297 Bacteria 2210
90 Ga0163162_10002963 3300013306 Bacteria 16201
91 Ga0163162_10032165 3300013306 Bacteria 5208
92 Ga0157372_10007030 3300013307 Bacteria 11988
93 Ga0157375_10002525 3300013308 Bacteria 15888
94 Ga0157375_10011067 3300013308 Bacteria 7956
95 Ga0157375_10021659 3300013308 Bacteria 5900
96 Ga0157375_10163959 3300013308 Bacteria 2366
97 Ga0157375_10234974 3300013308 Bacteria 1992
98 Ga0163163_11084152 3300014325 Bacteria 864
99 Ga0157379_10309078 3300014968 Bacteria 1442
100 Ga0157376_10045142 3300014969 Bacteria 3627
101 Ga0213876_10093765 3300021384 Bacteria 1590
102 Ga0213876_10116342 3300021384 Bacteria 1419
103 Ga0207638_1000375 3300025227 Bacteria 1176
104 Ga0209050_1000151 3300025298 Bacteria 162058
105 Ga0207697_10000683 3300025315 Bacteria 19313
106 Ga0207697_10003337 3300025315 Bacteria 7982
107 Ga0207688_10025872 3300025901 Bacteria 3226
108 Ga0207688_10033826 3300025901 Bacteria 2828
109 Ga0207688_10041068 3300025901 Unclassified 2572
110 Ga0207680_10014109 3300025903 Bacteria 4123
111 Ga0207680_10017224 3300025903 Bacteria 3813
112 Ga0207685_10111630 3300025905 Bacteria 1186
113 Ga0207645_10027556 3300025907 Unclassified 3667
114 Ga0207645_10041753 3300025907 Bacteria 2935
115 Ga0207645_10081938 3300025907 Bacteria 2068
116 Ga0207705_10000742 3300025909 Bacteria 26882
117 Ga0207695_10000484 3300025913 Bacteria 85269
118 Ga0207671_10033800 3300025914 Bacteria 3803
119 Ga0207693_10001246 3300025915 Bacteria 22647
120 Ga0207657_10013229 3300025919 Bacteria 8098
121 Ga0207657_10432196 3300025919 Unclassified 1034
122 Ga0207649_10049084 3300025920 Bacteria 2604
123 Ga0207681_10012256 3300025923 Bacteria 5286
124 Ga0207650_10007381 3300025925 Bacteria 7481
125 Ga0207650_10058508 3300025925 Unclassified 2870
126 Ga0207650_10165897 3300025925 Bacteria 1752
127 Ga0207650_10185279 3300025925 Unclassified 1660
128 Ga0207659_10023331 3300025926 Bacteria 4127
129 Ga0207700_10128968 3300025928 Unclassified 2062
130 Ga0207644_10151155 3300025931 Bacteria 1796
131 Ga0207690_10084863 3300025932 Bacteria 2221
132 Ga0207690_10130113 3300025932 Bacteria 1841
133 Ga0207706_10196089 3300025933 Bacteria 1772
134 Ga0207706_10303422 3300025933 Bacteria 1391
135 Ga0207670_10104781 3300025936 Bacteria 2026
136 Ga0207670_10177766 3300025936 Unclassified 1601
137 Ga0207670_10242560 3300025936 Bacteria 1389
138 Ga0207669_10013699 3300025937 Bacteria 4039
139 Ga0207704_10144039 3300025938 Bacteria 1671
140 Ga0207665_10024188 3300025939 Bacteria 4004
141 Ga0207665_10107379 3300025939 Bacteria 1957
142 Ga0207691_10001154 3300025940 Bacteria 26239
143 Ga0207691_10039831 3300025940 Bacteria 4346
144 Ga0207667_10006025 3300025949 Bacteria 14751
145 Ga0207651_10049008 3300025960 Bacteria 2859
146 Ga0207651_10301327 3300025960 Bacteria 1333
147 Ga0207668_10096139 3300025972 Bacteria 2188
148 Ga0207658_10107372 3300025986 Bacteria 2200
149 Ga0207658_10117232 3300025986 Bacteria 2116
150 Ga0207677_10395876 3300026023 Bacteria 1170
151 Ga0207703_10164976 3300026035 Bacteria 1943
152 Ga0207639_10000001 3300026041 Bacteria 1431562
153 Ga0207639_10405682 3300026041 Bacteria 1229
154 Ga0207678_10433784 3300026067 Bacteria 1140
155 Ga0207702_10772120 3300026078 Bacteria 949
156 Ga0207641_10019489 3300026088 Bacteria 5570
157 Ga0207648_10009854 3300026089 Bacteria 9111
158 Ga0207648_10192314 3300026089 Bacteria 1809
159 Ga0207648_10213044 3300026089 Bacteria 1715
160 Ga0207683_10015937 3300026121 Bacteria 6397
161 Ga0207683_10022088 3300026121 Bacteria 5461
162 Ga0207683_10038184 3300026121 Bacteria 4184
163 Ga0207683_10047470 3300026121 Bacteria 3761
164 Ga0268266_10015972 3300028379 Bacteria 6421
165 Ga0268266_10214705 3300028379 Bacteria 1766
166 Ga0268266_10292601 3300028379 Bacteria 1517
167 Ga0268264_10797281 3300028381 Unclassified 943
168 Ga0307414_10026037 3300032004 Bacteria 3759
169 Ga0373931_0371204 3300035691 Bacteria 900
170 Ga0373935_0172058 3300035692 Bacteria 1482
171 Ga0373937_0030113 3300036401 Bacteria 4917
172 Ga0395899_0000067 3300037312 Bacteria 202348
173 Ga0395899_0065904 3300037312 Bacteria 2661
174 Ga0395900_0008838 3300037418 Bacteria 10348
175 Ga0395898_0000067 3300037466 Bacteria 255955
176 Ga0395905_0539170 3300037471 Unclassified 1068
177 Ga0395901_0134926 3300038443 Bacteria 2594
178 Ga0436365_0526245 3300039437 Bacteria 8971
179 Ga0436365_0997021 3300039437 Bacteria 2736
180 Ga0453683_0286712 3300044673 Bacteria 1052
181 Ga0466965_0127539 3300044683 Bacteria 1317
182 Ga0466971_0000081 3300044719 Bacteria 34909
183 Ga0466957_0008871 3300044842 Bacteria 5728
184 Ga0466957_0038034 3300044842 Bacteria 2898
185 Ga0451576_0040238 3300045051 Bacteria 4949
186 Ga0466967_0092512 3300045976 Bacteria 2750
187 Ga0495580_0185733 3300046472 Bacteria 1435
188 Ga0495605_0132244 3300046474 Bacteria 1125
189 Ga0495628_0070016 3300046516 Unclassified 2735
190 Ga0495628_0197755 3300046516 Bacteria 1516
191 Ga0495630_0080002 3300046517 Unclassified 2465
192 Ga0495643_0000220 3300046522 Bacteria 87736
193 Ga0495640_0106020 3300046533 Bacteria 1841
194 Ga0495598_0009453 3300046537 Bacteria 2305
195 Ga0495669_0024680 3300046684 Bacteria 2618
196 Ga0496101_0023400 3300048904 Bacteria 4267
197 Ga0496102_0369111 3300048905 Unclassified 1351
198 Ga0496103_0076626 3300048906 Bacteria 2099
199 Ga0496105_0239190 3300048908 Bacteria 1474
200 Ga0496105_0350664 3300048908 Bacteria 1179
201 Ga0496106_0084137 3300048909 Bacteria 2447
202 Ga0496108_0047861 3300048911 Bacteria 3575
203 Ga0496112_0041101 3300048915 Bacteria 4524
204 Ga0496112_0274875 3300048915 Bacteria 1632
205 Ga0496112_0405575 3300048915 Unclassified 1302
206 Ga0496112_0573401 3300048915 Unclassified 1061
207 Ga0496113_0053752 3300048916 Bacteria 3012
208 Ga0496114_0202769 3300048917 Bacteria 1738
209 Ga0496114_0662800 3300048917 Unclassified 917
210 Ga0496115_0004860 3300048918 Bacteria 9750
211 Ga0496115_0045379 3300048918 Bacteria 3508
212 Ga0496125_0000006 3300048928 Bacteria 759385
213 Ga0501031_0000196 3300049568 Bacteria 34298
214 Ga0501032_0000359 3300049569 Bacteria 37996
215 Ga0501032_0265624 3300049569 Bacteria 1112
216 Ga0501033_0000072 3300049570 Bacteria 95370
217 Ga0501033_0000909 3300049570 Bacteria 27041
218 Ga0501036_0038072 3300049572 Bacteria 4069
219 Ga0501037_0000073 3300049573 Bacteria 93756
220 Ga0501038_0024537 3300049574 Bacteria 5379
221 Ga0501038_0135385 3300049574 Bacteria 2019
222 Ga0501039_0001009 3300049575 Bacteria 20516
223 Ga0501043_0000640 3300049579 Bacteria 30930
224 Ga0501043_0000854 3300049579 Bacteria 27003
225 Ga0501047_0008693 3300049581 Bacteria 9589
226 Ga0501047_0229106 3300049581 Bacteria 1712
227 Ga0501070_0001365 3300049586 Bacteria 21863
228 Ga0501070_0065689 3300049586 Bacteria 3004
229 Ga0501080_0106740 3300049742 Bacteria 2595
230 Ga0501035_0000002 3300049822 Bacteria 585447
231 Ga0501044_0001262 3300049823 Bacteria 29942
232 Ga0501044_0643317 3300049823 Unclassified 950
233 nmdc:mga08y16_217731_c1 3300050511 Unclassified 1977
234 nmdc:mga0n895_501324_c1 3300050512 Bacteria 1223
235 Ga0500556_0019404 3300053104 Bacteria 2160
236 Ga0500642_0056692 3300053130 Bacteria 1746
237 Ga0500616_0004599 3300053153 Bacteria 9752
238 Ga0500645_015655 3300053730 Bacteria 2400
239 Ga0466962_0000047 3300061719 Bacteria 50198

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053104 Ga0500556_0019404 Ga0500556_0019404_24_731 234
2 3300049570 Ga0501033_0000909 Ga0501033_0000909_11599_12405 241
3 3300049574 Ga0501038_0024537 Ga0501038_0024537_3948_4754 241
4 3300021384 Ga0213876_10093765 Ga0213876_100937652 243
5 3300039437 Ga0436365_0526245 Ga0436365_0526245_6035_6856 243
6 3300025227 Ga0207638_1000375 Ga0207638_10003752 245
7 3300045051 Ga0451576_0040238 Ga0451576_0040238_2636_3448 254
8 3300049586 Ga0501070_0065689 Ga0501070_0065689_318_1133 261
9 3300049742 Ga0501080_0106740 Ga0501080_0106740_787_1596 262
10 iso_pu_bacteria 2786546517 2787437689 264
11 3300038443 Ga0395901_0134926 Ga0395901_0134926_1403_2206 266
12 iso_pu_bacteria 2786546548 2787508674 266
13 3300025932 Ga0207690_10084863 Ga0207690_100848631 267
14 3300037466 Ga0395898_0000067 Ga0395898_0000067_145789_146601 267
15 3300001991 JGI24743J22301_10001740 JGI24743J22301_100017402 268
16 3300002126 JGI24035J26624_1003070 JGI24035J26624_10030702 268
17 3300003322 rootL2_10156963 rootL2_101569632 268
18 3300003323 rootH1_10066215 rootH1_100662154 268
19 3300003791 Ga0055530_10010031 Ga0055530_100100313 268
20 3300005328 Ga0070676_10009065 Ga0070676_100090653 268
21 3300005328 Ga0070676_10034245 Ga0070676_100342452 268
22 3300005330 Ga0070690_100040955 Ga0070690_1000409553 268
23 3300005330 Ga0070690_100073808 Ga0070690_1000738082 268
24 3300005331 Ga0070670_100019426 Ga0070670_1000194265 268
25 3300005331 Ga0070670_100231075 Ga0070670_1002310751 268
26 3300005333 Ga0070677_10027570 Ga0070677_100275702 268
27 3300005335 Ga0070666_10003440 Ga0070666_1000344010 268
28 3300005335 Ga0070666_10022363 Ga0070666_100223634 268
29 3300005335 Ga0070666_10132350 Ga0070666_101323502 268
30 3300005338 Ga0068868_100113087 Ga0068868_1001130872 268
31 3300005338 Ga0068868_100424032 Ga0068868_1004240321 268
32 3300005339 Ga0070660_100551712 Ga0070660_1005517121 268
33 3300005340 Ga0070689_100018747 Ga0070689_1000187471 268
34 3300005340 Ga0070689_100293336 Ga0070689_1002933361 268
35 3300005344 Ga0070661_100000158 Ga0070661_10000015822 268
36 3300005344 Ga0070661_100046725 Ga0070661_1000467252 268
37 3300005347 Ga0070668_100050803 Ga0070668_1000508033 268
38 3300005347 Ga0070668_100089373 Ga0070668_1000893734 268
39 3300005353 Ga0070669_100006145 Ga0070669_1000061453 268
40 3300005353 Ga0070669_100040774 Ga0070669_1000407742 268
41 3300005353 Ga0070669_100163481 Ga0070669_1001634812 268
42 3300005354 Ga0070675_100014482 Ga0070675_1000144824 268
43 3300005354 Ga0070675_100041141 Ga0070675_1000411415 268
44 3300005355 Ga0070671_100016952 Ga0070671_1000169527 268
45 3300005355 Ga0070671_100048570 Ga0070671_1000485702 268
46 3300005355 Ga0070671_100331804 Ga0070671_1003318042 268
47 3300005356 Ga0070674_100004132 Ga0070674_1000041324 268
48 3300005364 Ga0070673_100003933 Ga0070673_1000039338 268
49 3300005364 Ga0070673_100072909 Ga0070673_1000729092 268
50 3300005365 Ga0070688_100000527 Ga0070688_10000052716 268
51 3300005366 Ga0070659_100075303 Ga0070659_1000753031 268
52 3300005366 Ga0070659_100559824 Ga0070659_1005598241 268
53 3300005367 Ga0070667_100004695 Ga0070667_10000469511 268
54 3300005367 Ga0070667_100121836 Ga0070667_1001218361 268
55 3300005367 Ga0070667_100395705 Ga0070667_1003957052 268
56 3300005435 Ga0070714_100266168 Ga0070714_1002661682 268
57 3300005436 Ga0070713_100017517 Ga0070713_1000175173 268
58 3300005440 Ga0070705_100425141 Ga0070705_1004251411 268
59 3300005455 Ga0070663_100398081 Ga0070663_1003980811 268
60 3300005456 Ga0070678_100001827 Ga0070678_1000018272 268
61 3300005456 Ga0070678_100005793 Ga0070678_1000057932 268
62 3300005456 Ga0070678_100405302 Ga0070678_1004053021 268
63 3300005457 Ga0070662_100057001 Ga0070662_1000570012 268
64 3300005459 Ga0068867_100014888 Ga0068867_1000148884 268
65 3300005459 Ga0068867_100184382 Ga0068867_1001843821 268
66 3300005466 Ga0070685_10056986 Ga0070685_100569862 268
67 3300005467 Ga0070706_100081455 Ga0070706_1000814554 268
68 3300005539 Ga0068853_100000006 Ga0068853_1000000068 268
69 3300005539 Ga0068853_100205632 Ga0068853_1002056322 268
70 3300005539 Ga0068853_100493917 Ga0068853_1004939172 268
71 3300005543 Ga0070672_100000507 Ga0070672_1000005072 268
72 3300005548 Ga0070665_100469921 Ga0070665_1004699212 268
73 3300005563 Ga0068855_100001572 Ga0068855_10000157210 268
74 3300005564 Ga0070664_100070572 Ga0070664_1000705722 268
75 3300005718 Ga0068866_10130726 Ga0068866_101307262 268
76 3300005842 Ga0068858_100234535 Ga0068858_1002345352 268
77 3300005843 Ga0068860_100068259 Ga0068860_1000682595 268
78 3300005844 Ga0068862_100110871 Ga0068862_1001108712 268
79 3300005985 Ga0081539_10003184 Ga0081539_1000318425 268
80 3300006173 Ga0070716_100184969 Ga0070716_1001849692 268
81 3300006175 Ga0070712_100005821 Ga0070712_1000058217 268
82 3300006237 Ga0097621_100087635 Ga0097621_1000876352 268
83 3300006237 Ga0097621_100110200 Ga0097621_1001102002 268
84 3300006237 Ga0097621_100352055 Ga0097621_1003520551 268
85 3300006358 Ga0068871_100015881 Ga0068871_1000158814 268
86 3300006881 Ga0068865_100026395 Ga0068865_1000263954 268
87 3300009094 Ga0111539_10439948 Ga0111539_104399482 268
88 3300009176 Ga0105242_10525978 Ga0105242_105259782 268
89 3300009545 Ga0105237_10068069 Ga0105237_100680692 268
90 3300010375 Ga0105239_10132355 Ga0105239_101323552 268
91 3300010375 Ga0105239_10382509 Ga0105239_103825091 268
92 3300010375 Ga0105239_10482415 Ga0105239_104824151 268
93 3300013100 Ga0157373_10190311 Ga0157373_101903112 268
94 3300013296 Ga0157374_10013389 Ga0157374_100133896 268
95 3300013296 Ga0157374_10013540 Ga0157374_100135406 268
96 3300013296 Ga0157374_10025878 Ga0157374_100258783 268
97 3300013296 Ga0157374_10068203 Ga0157374_100682033 268
98 3300013296 Ga0157374_10816922 Ga0157374_108169221 268
99 3300013297 Ga0157378_10029064 Ga0157378_100290643 268
100 3300013297 Ga0157378_10035625 Ga0157378_100356254 268
101 3300013297 Ga0157378_10055986 Ga0157378_100559862 268
102 3300013297 Ga0157378_10062578 Ga0157378_100625782 268
103 3300013297 Ga0157378_10144706 Ga0157378_101447063 268
104 3300013306 Ga0163162_10002963 Ga0163162_1000296317 268
105 3300013306 Ga0163162_10032165 Ga0163162_100321657 268
106 3300013307 Ga0157372_10007030 Ga0157372_100070309 268
107 3300013308 Ga0157375_10002525 Ga0157375_100025252 268
108 3300013308 Ga0157375_10011067 Ga0157375_100110677 268
109 3300013308 Ga0157375_10021659 Ga0157375_100216594 268
110 3300013308 Ga0157375_10163959 Ga0157375_101639591 268
111 3300013308 Ga0157375_10234974 Ga0157375_102349741 268
112 3300014325 Ga0163163_11084152 Ga0163163_110841521 268
113 3300014968 Ga0157379_10309078 Ga0157379_103090781 268
114 3300014969 Ga0157376_10045142 Ga0157376_100451422 268
115 3300021384 Ga0213876_10116342 Ga0213876_101163421 268
116 3300025298 Ga0209050_1000151 Ga0209050_100015132 268
117 3300025315 Ga0207697_10000683 Ga0207697_1000068323 268
118 3300025315 Ga0207697_10003337 Ga0207697_100033373 268
119 3300025901 Ga0207688_10025872 Ga0207688_100258723 268
120 3300025901 Ga0207688_10033826 Ga0207688_100338262 268
121 3300025901 Ga0207688_10041068 Ga0207688_100410682 268
122 3300025903 Ga0207680_10014109 Ga0207680_100141094 268
123 3300025903 Ga0207680_10017224 Ga0207680_100172243 268
124 3300025905 Ga0207685_10111630 Ga0207685_101116302 268
125 3300025907 Ga0207645_10027556 Ga0207645_100275564 268
126 3300025907 Ga0207645_10041753 Ga0207645_100417532 268
127 3300025907 Ga0207645_10081938 Ga0207645_100819383 268
128 3300025909 Ga0207705_10000742 Ga0207705_100007423 268
129 3300025913 Ga0207695_10000484 Ga0207695_1000048425 268
130 3300025914 Ga0207671_10033800 Ga0207671_100338003 268
131 3300025915 Ga0207693_10001246 Ga0207693_1000124619 268
132 3300025919 Ga0207657_10013229 Ga0207657_100132295 268
133 3300025919 Ga0207657_10432196 Ga0207657_104321961 268
134 3300025920 Ga0207649_10049084 Ga0207649_100490842 268
135 3300025923 Ga0207681_10012256 Ga0207681_100122563 268
136 3300025925 Ga0207650_10007381 Ga0207650_100073812 268
137 3300025925 Ga0207650_10058508 Ga0207650_100585084 268
138 3300025925 Ga0207650_10165897 Ga0207650_101658972 268
139 3300025925 Ga0207650_10185279 Ga0207650_101852792 268
140 3300025926 Ga0207659_10023331 Ga0207659_100233312 268
141 3300025928 Ga0207700_10128968 Ga0207700_101289682 268
142 3300025931 Ga0207644_10151155 Ga0207644_101511551 268
143 3300025932 Ga0207690_10130113 Ga0207690_101301132 268
144 3300025933 Ga0207706_10196089 Ga0207706_101960893 268
145 3300025933 Ga0207706_10303422 Ga0207706_103034221 268
146 3300025936 Ga0207670_10104781 Ga0207670_101047812 268
147 3300025936 Ga0207670_10177766 Ga0207670_101777662 268
148 3300025936 Ga0207670_10242560 Ga0207670_102425601 268
149 3300025937 Ga0207669_10013699 Ga0207669_100136993 268
150 3300025938 Ga0207704_10144039 Ga0207704_101440392 268
151 3300025939 Ga0207665_10024188 Ga0207665_100241882 268
152 3300025939 Ga0207665_10107379 Ga0207665_101073792 268
153 3300025940 Ga0207691_10001154 Ga0207691_1000115425 268
154 3300025940 Ga0207691_10039831 Ga0207691_100398315 268
155 3300025949 Ga0207667_10006025 Ga0207667_1000602511 268
156 3300025960 Ga0207651_10049008 Ga0207651_100490082 268
157 3300025960 Ga0207651_10301327 Ga0207651_103013272 268
158 3300025972 Ga0207668_10096139 Ga0207668_100961391 268
159 3300025986 Ga0207658_10107372 Ga0207658_101073723 268
160 3300025986 Ga0207658_10117232 Ga0207658_101172322 268
161 3300026023 Ga0207677_10395876 Ga0207677_103958762 268
162 3300026035 Ga0207703_10164976 Ga0207703_101649762 268
163 3300026041 Ga0207639_10000001 Ga0207639_10000001911 268
164 3300026041 Ga0207639_10405682 Ga0207639_104056821 268
165 3300026067 Ga0207678_10433784 Ga0207678_104337841 268
166 3300026078 Ga0207702_10772120 Ga0207702_107721201 268
167 3300026088 Ga0207641_10019489 Ga0207641_100194892 268
168 3300026089 Ga0207648_10009854 Ga0207648_100098544 268
169 3300026089 Ga0207648_10192314 Ga0207648_101923141 268
170 3300026089 Ga0207648_10213044 Ga0207648_102130442 268
171 3300026121 Ga0207683_10015937 Ga0207683_100159372 268
172 3300026121 Ga0207683_10022088 Ga0207683_100220883 268
173 3300026121 Ga0207683_10038184 Ga0207683_100381846 268
174 3300026121 Ga0207683_10047470 Ga0207683_100474701 268
175 3300028379 Ga0268266_10015972 Ga0268266_100159724 268
176 3300028379 Ga0268266_10214705 Ga0268266_102147052 268
177 3300028379 Ga0268266_10292601 Ga0268266_102926012 268
178 3300028381 Ga0268264_10797281 Ga0268264_107972811 268
179 3300032004 Ga0307414_10026037 Ga0307414_100260374 268
180 3300035691 Ga0373931_0371204 Ga0373931_0371204_72_887 268
181 3300035692 Ga0373935_0172058 Ga0373935_0172058_133_951 268
182 3300036401 Ga0373937_0030113 Ga0373937_0030113_1099_1917 268
183 3300037312 Ga0395899_0000067 Ga0395899_0000067_70425_71237 268
184 3300037312 Ga0395899_0065904 Ga0395899_0065904_1035_1853 268
185 3300037418 Ga0395900_0008838 Ga0395900_0008838_7939_8757 268
186 3300037471 Ga0395905_0539170 Ga0395905_0539170_139_954 268
187 3300039437 Ga0436365_0997021 Ga0436365_0997021_1690_2505 268
188 3300044673 Ga0453683_0286712 Ga0453683_0286712_37_849 268
189 3300044683 Ga0466965_0127539 Ga0466965_0127539_269_1084 268
190 3300044719 Ga0466971_0000081 Ga0466971_0000081_7853_8668 268
191 3300044842 Ga0466957_0008871 Ga0466957_0008871_2436_3248 268
192 3300044842 Ga0466957_0038034 Ga0466957_0038034_1759_2574 268
193 3300045976 Ga0466967_0092512 Ga0466967_0092512_1225_2043 268
194 3300046472 Ga0495580_0185733 Ga0495580_0185733_138_953 268
195 3300046474 Ga0495605_0132244 Ga0495605_0132244_42_857 268
196 3300046516 Ga0495628_0070016 Ga0495628_0070016_1142_1978 268
197 3300046516 Ga0495628_0197755 Ga0495628_0197755_371_1189 268
198 3300046517 Ga0495630_0080002 Ga0495630_0080002_1313_2131 268
199 3300046522 Ga0495643_0000220 Ga0495643_0000220_71688_72500 268
200 3300046533 Ga0495640_0106020 Ga0495640_0106020_16_834 268
201 3300046537 Ga0495598_0009453 Ga0495598_0009453_217_1032 268
202 3300046684 Ga0495669_0024680 Ga0495669_0024680_202_1017 268
203 3300048904 Ga0496101_0023400 Ga0496101_0023400_3244_4059 268
204 3300048905 Ga0496102_0369111 Ga0496102_0369111_398_1213 268
205 3300048906 Ga0496103_0076626 Ga0496103_0076626_800_1615 268
206 3300048908 Ga0496105_0239190 Ga0496105_0239190_450_1265 268
207 3300048908 Ga0496105_0350664 Ga0496105_0350664_204_1022 268
208 3300048909 Ga0496106_0084137 Ga0496106_0084137_933_1748 268
209 3300048911 Ga0496108_0047861 Ga0496108_0047861_1601_2419 268
210 3300048915 Ga0496112_0041101 Ga0496112_0041101_1255_2073 268
211 3300048915 Ga0496112_0274875 Ga0496112_0274875_233_1051 268
212 3300048915 Ga0496112_0405575 Ga0496112_0405575_465_1283 268
213 3300048915 Ga0496112_0573401 Ga0496112_0573401_83_901 268
214 3300048916 Ga0496113_0053752 Ga0496113_0053752_695_1513 268
215 3300048917 Ga0496114_0202769 Ga0496114_0202769_367_1182 268
216 3300048917 Ga0496114_0662800 Ga0496114_0662800_84_902 268
217 3300048918 Ga0496115_0004860 Ga0496115_0004860_3728_4546 268
218 3300048918 Ga0496115_0045379 Ga0496115_0045379_88_903 268
219 3300048928 Ga0496125_0000006 Ga0496125_0000006_127045_127860 268
220 3300049568 Ga0501031_0000196 Ga0501031_0000196_18838_19689 268
221 3300049569 Ga0501032_0000359 Ga0501032_0000359_25232_26044 268
222 3300049569 Ga0501032_0265624 Ga0501032_0265624_69_920 268
223 3300049570 Ga0501033_0000072 Ga0501033_0000072_25251_26063 268
224 3300049572 Ga0501036_0038072 Ga0501036_0038072_1911_2762 268
225 3300049573 Ga0501037_0000073 Ga0501037_0000073_87469_88299 268
226 3300049574 Ga0501038_0135385 Ga0501038_0135385_877_1728 268
227 3300049575 Ga0501039_0001009 Ga0501039_0001009_12451_13302 268
228 3300049579 Ga0501043_0000640 Ga0501043_0000640_29389_30240 268
229 3300049579 Ga0501043_0000854 Ga0501043_0000854_25319_26134 268
230 3300049581 Ga0501047_0008693 Ga0501047_0008693_1876_2727 268
231 3300049581 Ga0501047_0229106 Ga0501047_0229106_69_884 268
232 3300049586 Ga0501070_0001365 Ga0501070_0001365_7497_8348 268
233 3300049822 Ga0501035_0000002 Ga0501035_0000002_184330_185181 268
234 3300049823 Ga0501044_0001262 Ga0501044_0001262_19555_20385 268
235 3300049823 Ga0501044_0643317 Ga0501044_0643317_35_841 268
236 3300050511 nmdc:mga08y16_217731_c1 nmdc:mga08y16_217731_c1_364_1182 268
237 3300050512 nmdc:mga0n895_501324_c1 nmdc:mga0n895_501324_c1_27_845 268
238 3300053130 Ga0500642_0056692 Ga0500642_0056692_842_1657 268
239 3300053153 Ga0500616_0004599 Ga0500616_0004599_8892_9701 268
240 3300053730 Ga0500645_015655 Ga0500645_015655_966_1781 268
241 3300061719 Ga0466962_0000047 Ga0466962_0000047_48588_49403 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

114

275

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fym-assembly1.cif.gz_A the 1a structure of ymfm, a putative dna-binding membrane protein from staphylococcus aureus 0.8682 6 73
4efz-assembly3.cif.gz_B crystal structure of a hypothetical metallo-beta-lactamase from burkholderia pseudomallei 0.8677 82 264
4chl-assembly1.cif.gz_A human ethylmalonic encephalopathy protein 1 (hethe1) 0.8602 74 265
4ysl-assembly1.cif.gz_B crystal structure of sdoa from pseudomonas putida in complex with glutathione 0.8587 77 264
1r69-assembly1.cif.gz_A structure of the amino-terminal domain of phage 434 repressor at 2.0 angstroms resolution 0.8573 7 65
ID Description Score Start End Superfamily
af_K7KLP6_1_199_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8849 83 263 3.60.15.10
af_A0A0R0KZP1_7_202_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8843 158 251 3.60.15.10
af_P9WMW3_3_221_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8743 85 268 3.60.15.10
af_Q6PII5_1_211_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8695 82 251 3.60.15.10
3fymA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8682 6 73 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A353F1Y2-F1-model_v4 MBL fold metallo-hydrolase 0.9756 1 200 GO:0006749
GO:0016787
GO:0050313
GO:0070813
AF-A0A2V5Q5J5-F1-model_v4 MBL fold metallo-hydrolase 0.972 1 163 GO:0016787
AF-A0A2E3NBR2-F1-model_v4 MBL fold metallo-hydrolase 0.9718 2 268 GO:0016787
AF-A0A2D5AQ81-F1-model_v4 MBL fold metallo-hydrolase 0.9712 1 147 GO:0003677
GO:0016787
AF-A0A2V5UG96-F1-model_v4 MBL fold metallo-hydrolase 0.9708 1 183 GO:0016787

Feature Viewer

pLDDT pTM Quality
94.44 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map