F353859
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 241 | 157 | 239 | 272 |
Family's Representative Sequence
| Representative Sequence | 3300026088|Ga0207641_10019489|Ga0207641_100194892 |
| Length | 292 |
| Sequence | LASFGVFGGYNIRREPVSQFSKMSIPLEDNLSDIIGKAQRGLKISDSQLAEQAGISLRQVQEIRAGGFDAIAITQIAAVLHLNADALADSGRKAWYPEPVEPTDGLASFNTPFDDMTVNSYLLWDPETRRAGAFDTGSDCSDMLDFLEQNTLRLDAIFLTHTHGDHIYDLDRLKARTGATAFVCKRERLEGAHSFEEGRRFEIGGLRVETRLTRGHSAGGITYVVTGLSKPVAVVGDAIFAGSMGGGMVSYEDALRTNREKILTLPEETVLCPGHGPMSTVGEEKRHNPFFA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2786546517 | Verrucomicrobia bacterium LW23 | Isolate | Rhizoplane |
| 2 | 2786546548 | Spartobacteria bacterium LR76 | Isolate | Unclassified |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 45 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 64 | 3300025227 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in- M7 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 104 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 105 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 106 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 107 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 108 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 109 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 110 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 111 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 112 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 113 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 114 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 115 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 116 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 117 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 118 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 119 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 128 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 129 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 130 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 131 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 132 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 134 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 135 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 136 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 137 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 138 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 154 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 155 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 156 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 157 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.17 |
| Metatranscriptomes | 0 |
| Isolates | 0.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.49 |
| Nodule | 0 |
| Rhizoplane | 7.05 |
| Rhizosphere | 87.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10001740 | 3300001991 | Bacteria | 3113 |
| 2 | JGI24035J26624_1003070 | 3300002126 | Unclassified | 1562 |
| 3 | rootL2_10156963 | 3300003322 | Bacteria | 1634 |
| 4 | rootH1_10066215 | 3300003323 | Bacteria | 25527 |
| 5 | Ga0055530_10010031 | 3300003791 | Bacteria | 3559 |
| 6 | Ga0070676_10009065 | 3300005328 | Bacteria | 5383 |
| 7 | Ga0070676_10034245 | 3300005328 | Bacteria | 2916 |
| 8 | Ga0070690_100040955 | 3300005330 | Bacteria | 2931 |
| 9 | Ga0070690_100073808 | 3300005330 | Bacteria | 2220 |
| 10 | Ga0070670_100019426 | 3300005331 | Bacteria | 5830 |
| 11 | Ga0070670_100231075 | 3300005331 | Bacteria | 1610 |
| 12 | Ga0070677_10027570 | 3300005333 | Unclassified | 2139 |
| 13 | Ga0070666_10003440 | 3300005335 | Bacteria | 9591 |
| 14 | Ga0070666_10022363 | 3300005335 | Bacteria | 4106 |
| 15 | Ga0070666_10132350 | 3300005335 | Bacteria | 1733 |
| 16 | Ga0068868_100113087 | 3300005338 | Bacteria | 2207 |
| 17 | Ga0068868_100424032 | 3300005338 | Bacteria | 1152 |
| 18 | Ga0070660_100551712 | 3300005339 | Unclassified | 961 |
| 19 | Ga0070689_100018747 | 3300005340 | Bacteria | 5104 |
| 20 | Ga0070689_100293336 | 3300005340 | Bacteria | 1352 |
| 21 | Ga0070661_100000158 | 3300005344 | Bacteria | 55403 |
| 22 | Ga0070661_100046725 | 3300005344 | Bacteria | 3168 |
| 23 | Ga0070668_100050803 | 3300005347 | Bacteria | 3193 |
| 24 | Ga0070668_100089373 | 3300005347 | Bacteria | 2426 |
| 25 | Ga0070669_100006145 | 3300005353 | Bacteria | 8671 |
| 26 | Ga0070669_100040774 | 3300005353 | Bacteria | 3375 |
| 27 | Ga0070669_100163481 | 3300005353 | Bacteria | 1731 |
| 28 | Ga0070675_100014482 | 3300005354 | Bacteria | 6220 |
| 29 | Ga0070675_100041141 | 3300005354 | Bacteria | 3775 |
| 30 | Ga0070671_100016952 | 3300005355 | Bacteria | 5892 |
| 31 | Ga0070671_100048570 | 3300005355 | Bacteria | 3529 |
| 32 | Ga0070671_100331804 | 3300005355 | Bacteria | 1296 |
| 33 | Ga0070674_100004132 | 3300005356 | Bacteria | 8249 |
| 34 | Ga0070673_100003933 | 3300005364 | Bacteria | 9333 |
| 35 | Ga0070673_100072909 | 3300005364 | Bacteria | 2763 |
| 36 | Ga0070688_100000527 | 3300005365 | Bacteria | 19316 |
| 37 | Ga0070659_100075303 | 3300005366 | Bacteria | 2690 |
| 38 | Ga0070659_100559824 | 3300005366 | Unclassified | 979 |
| 39 | Ga0070667_100004695 | 3300005367 | Bacteria | 11463 |
| 40 | Ga0070667_100121836 | 3300005367 | Bacteria | 2269 |
| 41 | Ga0070667_100395705 | 3300005367 | Unclassified | 1257 |
| 42 | Ga0070714_100266168 | 3300005435 | Bacteria | 1588 |
| 43 | Ga0070713_100017517 | 3300005436 | Bacteria | 5420 |
| 44 | Ga0070705_100425141 | 3300005440 | Bacteria | 990 |
| 45 | Ga0070663_100398081 | 3300005455 | Bacteria | 1125 |
| 46 | Ga0070678_100001827 | 3300005456 | Bacteria | 11474 |
| 47 | Ga0070678_100005793 | 3300005456 | Bacteria | 7189 |
| 48 | Ga0070678_100405302 | 3300005456 | Unclassified | 1185 |
| 49 | Ga0070662_100057001 | 3300005457 | Bacteria | 2837 |
| 50 | Ga0068867_100014888 | 3300005459 | Bacteria | 5512 |
| 51 | Ga0068867_100184382 | 3300005459 | Bacteria | 1661 |
| 52 | Ga0070685_10056986 | 3300005466 | Unclassified | 2273 |
| 53 | Ga0070706_100081455 | 3300005467 | Bacteria | 2997 |
| 54 | Ga0068853_100000006 | 3300005539 | Bacteria | 295921 |
| 55 | Ga0068853_100205632 | 3300005539 | Bacteria | 1793 |
| 56 | Ga0068853_100493917 | 3300005539 | Bacteria | 1155 |
| 57 | Ga0070672_100000507 | 3300005543 | Bacteria | 22759 |
| 58 | Ga0070665_100469921 | 3300005548 | Bacteria | 1268 |
| 59 | Ga0068855_100001572 | 3300005563 | Bacteria | 28658 |
| 60 | Ga0070664_100070572 | 3300005564 | Unclassified | 2992 |
| 61 | Ga0068866_10130726 | 3300005718 | Bacteria | 1428 |
| 62 | Ga0068858_100234535 | 3300005842 | Bacteria | 1740 |
| 63 | Ga0068860_100068259 | 3300005843 | Bacteria | 3378 |
| 64 | Ga0068862_100110871 | 3300005844 | Unclassified | 2408 |
| 65 | Ga0081539_10003184 | 3300005985 | Bacteria | 20777 |
| 66 | Ga0070716_100184969 | 3300006173 | Bacteria | 1371 |
| 67 | Ga0070712_100005821 | 3300006175 | Bacteria | 7627 |
| 68 | Ga0097621_100087635 | 3300006237 | Bacteria | 2600 |
| 69 | Ga0097621_100110200 | 3300006237 | Bacteria | 2325 |
| 70 | Ga0097621_100352055 | 3300006237 | Unclassified | 1310 |
| 71 | Ga0068871_100015881 | 3300006358 | Bacteria | 5653 |
| 72 | Ga0068865_100026395 | 3300006881 | Bacteria | 3829 |
| 73 | Ga0111539_10439948 | 3300009094 | Unclassified | 1518 |
| 74 | Ga0105242_10525978 | 3300009176 | Unclassified | 1129 |
| 75 | Ga0105237_10068069 | 3300009545 | Bacteria | 3555 |
| 76 | Ga0105239_10132355 | 3300010375 | Bacteria | 2775 |
| 77 | Ga0105239_10382509 | 3300010375 | Archaea | 1591 |
| 78 | Ga0105239_10482415 | 3300010375 | Bacteria | 1408 |
| 79 | Ga0157373_10190311 | 3300013100 | Bacteria | 1446 |
| 80 | Ga0157374_10013389 | 3300013296 | Bacteria | 7161 |
| 81 | Ga0157374_10013540 | 3300013296 | Bacteria | 7121 |
| 82 | Ga0157374_10025878 | 3300013296 | Bacteria | 5275 |
| 83 | Ga0157374_10068203 | 3300013296 | Bacteria | 3346 |
| 84 | Ga0157374_10816922 | 3300013296 | Bacteria | 948 |
| 85 | Ga0157378_10029064 | 3300013297 | Bacteria | 4879 |
| 86 | Ga0157378_10035625 | 3300013297 | Bacteria | 4403 |
| 87 | Ga0157378_10055986 | 3300013297 | Bacteria | 3513 |
| 88 | Ga0157378_10062578 | 3300013297 | Bacteria | 3323 |
| 89 | Ga0157378_10144706 | 3300013297 | Bacteria | 2210 |
| 90 | Ga0163162_10002963 | 3300013306 | Bacteria | 16201 |
| 91 | Ga0163162_10032165 | 3300013306 | Bacteria | 5208 |
| 92 | Ga0157372_10007030 | 3300013307 | Bacteria | 11988 |
| 93 | Ga0157375_10002525 | 3300013308 | Bacteria | 15888 |
| 94 | Ga0157375_10011067 | 3300013308 | Bacteria | 7956 |
| 95 | Ga0157375_10021659 | 3300013308 | Bacteria | 5900 |
| 96 | Ga0157375_10163959 | 3300013308 | Bacteria | 2366 |
| 97 | Ga0157375_10234974 | 3300013308 | Bacteria | 1992 |
| 98 | Ga0163163_11084152 | 3300014325 | Bacteria | 864 |
| 99 | Ga0157379_10309078 | 3300014968 | Bacteria | 1442 |
| 100 | Ga0157376_10045142 | 3300014969 | Bacteria | 3627 |
| 101 | Ga0213876_10093765 | 3300021384 | Bacteria | 1590 |
| 102 | Ga0213876_10116342 | 3300021384 | Bacteria | 1419 |
| 103 | Ga0207638_1000375 | 3300025227 | Bacteria | 1176 |
| 104 | Ga0209050_1000151 | 3300025298 | Bacteria | 162058 |
| 105 | Ga0207697_10000683 | 3300025315 | Bacteria | 19313 |
| 106 | Ga0207697_10003337 | 3300025315 | Bacteria | 7982 |
| 107 | Ga0207688_10025872 | 3300025901 | Bacteria | 3226 |
| 108 | Ga0207688_10033826 | 3300025901 | Bacteria | 2828 |
| 109 | Ga0207688_10041068 | 3300025901 | Unclassified | 2572 |
| 110 | Ga0207680_10014109 | 3300025903 | Bacteria | 4123 |
| 111 | Ga0207680_10017224 | 3300025903 | Bacteria | 3813 |
| 112 | Ga0207685_10111630 | 3300025905 | Bacteria | 1186 |
| 113 | Ga0207645_10027556 | 3300025907 | Unclassified | 3667 |
| 114 | Ga0207645_10041753 | 3300025907 | Bacteria | 2935 |
| 115 | Ga0207645_10081938 | 3300025907 | Bacteria | 2068 |
| 116 | Ga0207705_10000742 | 3300025909 | Bacteria | 26882 |
| 117 | Ga0207695_10000484 | 3300025913 | Bacteria | 85269 |
| 118 | Ga0207671_10033800 | 3300025914 | Bacteria | 3803 |
| 119 | Ga0207693_10001246 | 3300025915 | Bacteria | 22647 |
| 120 | Ga0207657_10013229 | 3300025919 | Bacteria | 8098 |
| 121 | Ga0207657_10432196 | 3300025919 | Unclassified | 1034 |
| 122 | Ga0207649_10049084 | 3300025920 | Bacteria | 2604 |
| 123 | Ga0207681_10012256 | 3300025923 | Bacteria | 5286 |
| 124 | Ga0207650_10007381 | 3300025925 | Bacteria | 7481 |
| 125 | Ga0207650_10058508 | 3300025925 | Unclassified | 2870 |
| 126 | Ga0207650_10165897 | 3300025925 | Bacteria | 1752 |
| 127 | Ga0207650_10185279 | 3300025925 | Unclassified | 1660 |
| 128 | Ga0207659_10023331 | 3300025926 | Bacteria | 4127 |
| 129 | Ga0207700_10128968 | 3300025928 | Unclassified | 2062 |
| 130 | Ga0207644_10151155 | 3300025931 | Bacteria | 1796 |
| 131 | Ga0207690_10084863 | 3300025932 | Bacteria | 2221 |
| 132 | Ga0207690_10130113 | 3300025932 | Bacteria | 1841 |
| 133 | Ga0207706_10196089 | 3300025933 | Bacteria | 1772 |
| 134 | Ga0207706_10303422 | 3300025933 | Bacteria | 1391 |
| 135 | Ga0207670_10104781 | 3300025936 | Bacteria | 2026 |
| 136 | Ga0207670_10177766 | 3300025936 | Unclassified | 1601 |
| 137 | Ga0207670_10242560 | 3300025936 | Bacteria | 1389 |
| 138 | Ga0207669_10013699 | 3300025937 | Bacteria | 4039 |
| 139 | Ga0207704_10144039 | 3300025938 | Bacteria | 1671 |
| 140 | Ga0207665_10024188 | 3300025939 | Bacteria | 4004 |
| 141 | Ga0207665_10107379 | 3300025939 | Bacteria | 1957 |
| 142 | Ga0207691_10001154 | 3300025940 | Bacteria | 26239 |
| 143 | Ga0207691_10039831 | 3300025940 | Bacteria | 4346 |
| 144 | Ga0207667_10006025 | 3300025949 | Bacteria | 14751 |
| 145 | Ga0207651_10049008 | 3300025960 | Bacteria | 2859 |
| 146 | Ga0207651_10301327 | 3300025960 | Bacteria | 1333 |
| 147 | Ga0207668_10096139 | 3300025972 | Bacteria | 2188 |
| 148 | Ga0207658_10107372 | 3300025986 | Bacteria | 2200 |
| 149 | Ga0207658_10117232 | 3300025986 | Bacteria | 2116 |
| 150 | Ga0207677_10395876 | 3300026023 | Bacteria | 1170 |
| 151 | Ga0207703_10164976 | 3300026035 | Bacteria | 1943 |
| 152 | Ga0207639_10000001 | 3300026041 | Bacteria | 1431562 |
| 153 | Ga0207639_10405682 | 3300026041 | Bacteria | 1229 |
| 154 | Ga0207678_10433784 | 3300026067 | Bacteria | 1140 |
| 155 | Ga0207702_10772120 | 3300026078 | Bacteria | 949 |
| 156 | Ga0207641_10019489 | 3300026088 | Bacteria | 5570 |
| 157 | Ga0207648_10009854 | 3300026089 | Bacteria | 9111 |
| 158 | Ga0207648_10192314 | 3300026089 | Bacteria | 1809 |
| 159 | Ga0207648_10213044 | 3300026089 | Bacteria | 1715 |
| 160 | Ga0207683_10015937 | 3300026121 | Bacteria | 6397 |
| 161 | Ga0207683_10022088 | 3300026121 | Bacteria | 5461 |
| 162 | Ga0207683_10038184 | 3300026121 | Bacteria | 4184 |
| 163 | Ga0207683_10047470 | 3300026121 | Bacteria | 3761 |
| 164 | Ga0268266_10015972 | 3300028379 | Bacteria | 6421 |
| 165 | Ga0268266_10214705 | 3300028379 | Bacteria | 1766 |
| 166 | Ga0268266_10292601 | 3300028379 | Bacteria | 1517 |
| 167 | Ga0268264_10797281 | 3300028381 | Unclassified | 943 |
| 168 | Ga0307414_10026037 | 3300032004 | Bacteria | 3759 |
| 169 | Ga0373931_0371204 | 3300035691 | Bacteria | 900 |
| 170 | Ga0373935_0172058 | 3300035692 | Bacteria | 1482 |
| 171 | Ga0373937_0030113 | 3300036401 | Bacteria | 4917 |
| 172 | Ga0395899_0000067 | 3300037312 | Bacteria | 202348 |
| 173 | Ga0395899_0065904 | 3300037312 | Bacteria | 2661 |
| 174 | Ga0395900_0008838 | 3300037418 | Bacteria | 10348 |
| 175 | Ga0395898_0000067 | 3300037466 | Bacteria | 255955 |
| 176 | Ga0395905_0539170 | 3300037471 | Unclassified | 1068 |
| 177 | Ga0395901_0134926 | 3300038443 | Bacteria | 2594 |
| 178 | Ga0436365_0526245 | 3300039437 | Bacteria | 8971 |
| 179 | Ga0436365_0997021 | 3300039437 | Bacteria | 2736 |
| 180 | Ga0453683_0286712 | 3300044673 | Bacteria | 1052 |
| 181 | Ga0466965_0127539 | 3300044683 | Bacteria | 1317 |
| 182 | Ga0466971_0000081 | 3300044719 | Bacteria | 34909 |
| 183 | Ga0466957_0008871 | 3300044842 | Bacteria | 5728 |
| 184 | Ga0466957_0038034 | 3300044842 | Bacteria | 2898 |
| 185 | Ga0451576_0040238 | 3300045051 | Bacteria | 4949 |
| 186 | Ga0466967_0092512 | 3300045976 | Bacteria | 2750 |
| 187 | Ga0495580_0185733 | 3300046472 | Bacteria | 1435 |
| 188 | Ga0495605_0132244 | 3300046474 | Bacteria | 1125 |
| 189 | Ga0495628_0070016 | 3300046516 | Unclassified | 2735 |
| 190 | Ga0495628_0197755 | 3300046516 | Bacteria | 1516 |
| 191 | Ga0495630_0080002 | 3300046517 | Unclassified | 2465 |
| 192 | Ga0495643_0000220 | 3300046522 | Bacteria | 87736 |
| 193 | Ga0495640_0106020 | 3300046533 | Bacteria | 1841 |
| 194 | Ga0495598_0009453 | 3300046537 | Bacteria | 2305 |
| 195 | Ga0495669_0024680 | 3300046684 | Bacteria | 2618 |
| 196 | Ga0496101_0023400 | 3300048904 | Bacteria | 4267 |
| 197 | Ga0496102_0369111 | 3300048905 | Unclassified | 1351 |
| 198 | Ga0496103_0076626 | 3300048906 | Bacteria | 2099 |
| 199 | Ga0496105_0239190 | 3300048908 | Bacteria | 1474 |
| 200 | Ga0496105_0350664 | 3300048908 | Bacteria | 1179 |
| 201 | Ga0496106_0084137 | 3300048909 | Bacteria | 2447 |
| 202 | Ga0496108_0047861 | 3300048911 | Bacteria | 3575 |
| 203 | Ga0496112_0041101 | 3300048915 | Bacteria | 4524 |
| 204 | Ga0496112_0274875 | 3300048915 | Bacteria | 1632 |
| 205 | Ga0496112_0405575 | 3300048915 | Unclassified | 1302 |
| 206 | Ga0496112_0573401 | 3300048915 | Unclassified | 1061 |
| 207 | Ga0496113_0053752 | 3300048916 | Bacteria | 3012 |
| 208 | Ga0496114_0202769 | 3300048917 | Bacteria | 1738 |
| 209 | Ga0496114_0662800 | 3300048917 | Unclassified | 917 |
| 210 | Ga0496115_0004860 | 3300048918 | Bacteria | 9750 |
| 211 | Ga0496115_0045379 | 3300048918 | Bacteria | 3508 |
| 212 | Ga0496125_0000006 | 3300048928 | Bacteria | 759385 |
| 213 | Ga0501031_0000196 | 3300049568 | Bacteria | 34298 |
| 214 | Ga0501032_0000359 | 3300049569 | Bacteria | 37996 |
| 215 | Ga0501032_0265624 | 3300049569 | Bacteria | 1112 |
| 216 | Ga0501033_0000072 | 3300049570 | Bacteria | 95370 |
| 217 | Ga0501033_0000909 | 3300049570 | Bacteria | 27041 |
| 218 | Ga0501036_0038072 | 3300049572 | Bacteria | 4069 |
| 219 | Ga0501037_0000073 | 3300049573 | Bacteria | 93756 |
| 220 | Ga0501038_0024537 | 3300049574 | Bacteria | 5379 |
| 221 | Ga0501038_0135385 | 3300049574 | Bacteria | 2019 |
| 222 | Ga0501039_0001009 | 3300049575 | Bacteria | 20516 |
| 223 | Ga0501043_0000640 | 3300049579 | Bacteria | 30930 |
| 224 | Ga0501043_0000854 | 3300049579 | Bacteria | 27003 |
| 225 | Ga0501047_0008693 | 3300049581 | Bacteria | 9589 |
| 226 | Ga0501047_0229106 | 3300049581 | Bacteria | 1712 |
| 227 | Ga0501070_0001365 | 3300049586 | Bacteria | 21863 |
| 228 | Ga0501070_0065689 | 3300049586 | Bacteria | 3004 |
| 229 | Ga0501080_0106740 | 3300049742 | Bacteria | 2595 |
| 230 | Ga0501035_0000002 | 3300049822 | Bacteria | 585447 |
| 231 | Ga0501044_0001262 | 3300049823 | Bacteria | 29942 |
| 232 | Ga0501044_0643317 | 3300049823 | Unclassified | 950 |
| 233 | nmdc:mga08y16_217731_c1 | 3300050511 | Unclassified | 1977 |
| 234 | nmdc:mga0n895_501324_c1 | 3300050512 | Bacteria | 1223 |
| 235 | Ga0500556_0019404 | 3300053104 | Bacteria | 2160 |
| 236 | Ga0500642_0056692 | 3300053130 | Bacteria | 1746 |
| 237 | Ga0500616_0004599 | 3300053153 | Bacteria | 9752 |
| 238 | Ga0500645_015655 | 3300053730 | Bacteria | 2400 |
| 239 | Ga0466962_0000047 | 3300061719 | Bacteria | 50198 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053104 | Ga0500556_0019404 | Ga0500556_0019404_24_731 | 234 |
| 2 | 3300049570 | Ga0501033_0000909 | Ga0501033_0000909_11599_12405 | 241 |
| 3 | 3300049574 | Ga0501038_0024537 | Ga0501038_0024537_3948_4754 | 241 |
| 4 | 3300021384 | Ga0213876_10093765 | Ga0213876_100937652 | 243 |
| 5 | 3300039437 | Ga0436365_0526245 | Ga0436365_0526245_6035_6856 | 243 |
| 6 | 3300025227 | Ga0207638_1000375 | Ga0207638_10003752 | 245 |
| 7 | 3300045051 | Ga0451576_0040238 | Ga0451576_0040238_2636_3448 | 254 |
| 8 | 3300049586 | Ga0501070_0065689 | Ga0501070_0065689_318_1133 | 261 |
| 9 | 3300049742 | Ga0501080_0106740 | Ga0501080_0106740_787_1596 | 262 |
| 10 | iso_pu_bacteria | 2786546517 | 2787437689 | 264 |
| 11 | 3300038443 | Ga0395901_0134926 | Ga0395901_0134926_1403_2206 | 266 |
| 12 | iso_pu_bacteria | 2786546548 | 2787508674 | 266 |
| 13 | 3300025932 | Ga0207690_10084863 | Ga0207690_100848631 | 267 |
| 14 | 3300037466 | Ga0395898_0000067 | Ga0395898_0000067_145789_146601 | 267 |
| 15 | 3300001991 | JGI24743J22301_10001740 | JGI24743J22301_100017402 | 268 |
| 16 | 3300002126 | JGI24035J26624_1003070 | JGI24035J26624_10030702 | 268 |
| 17 | 3300003322 | rootL2_10156963 | rootL2_101569632 | 268 |
| 18 | 3300003323 | rootH1_10066215 | rootH1_100662154 | 268 |
| 19 | 3300003791 | Ga0055530_10010031 | Ga0055530_100100313 | 268 |
| 20 | 3300005328 | Ga0070676_10009065 | Ga0070676_100090653 | 268 |
| 21 | 3300005328 | Ga0070676_10034245 | Ga0070676_100342452 | 268 |
| 22 | 3300005330 | Ga0070690_100040955 | Ga0070690_1000409553 | 268 |
| 23 | 3300005330 | Ga0070690_100073808 | Ga0070690_1000738082 | 268 |
| 24 | 3300005331 | Ga0070670_100019426 | Ga0070670_1000194265 | 268 |
| 25 | 3300005331 | Ga0070670_100231075 | Ga0070670_1002310751 | 268 |
| 26 | 3300005333 | Ga0070677_10027570 | Ga0070677_100275702 | 268 |
| 27 | 3300005335 | Ga0070666_10003440 | Ga0070666_1000344010 | 268 |
| 28 | 3300005335 | Ga0070666_10022363 | Ga0070666_100223634 | 268 |
| 29 | 3300005335 | Ga0070666_10132350 | Ga0070666_101323502 | 268 |
| 30 | 3300005338 | Ga0068868_100113087 | Ga0068868_1001130872 | 268 |
| 31 | 3300005338 | Ga0068868_100424032 | Ga0068868_1004240321 | 268 |
| 32 | 3300005339 | Ga0070660_100551712 | Ga0070660_1005517121 | 268 |
| 33 | 3300005340 | Ga0070689_100018747 | Ga0070689_1000187471 | 268 |
| 34 | 3300005340 | Ga0070689_100293336 | Ga0070689_1002933361 | 268 |
| 35 | 3300005344 | Ga0070661_100000158 | Ga0070661_10000015822 | 268 |
| 36 | 3300005344 | Ga0070661_100046725 | Ga0070661_1000467252 | 268 |
| 37 | 3300005347 | Ga0070668_100050803 | Ga0070668_1000508033 | 268 |
| 38 | 3300005347 | Ga0070668_100089373 | Ga0070668_1000893734 | 268 |
| 39 | 3300005353 | Ga0070669_100006145 | Ga0070669_1000061453 | 268 |
| 40 | 3300005353 | Ga0070669_100040774 | Ga0070669_1000407742 | 268 |
| 41 | 3300005353 | Ga0070669_100163481 | Ga0070669_1001634812 | 268 |
| 42 | 3300005354 | Ga0070675_100014482 | Ga0070675_1000144824 | 268 |
| 43 | 3300005354 | Ga0070675_100041141 | Ga0070675_1000411415 | 268 |
| 44 | 3300005355 | Ga0070671_100016952 | Ga0070671_1000169527 | 268 |
| 45 | 3300005355 | Ga0070671_100048570 | Ga0070671_1000485702 | 268 |
| 46 | 3300005355 | Ga0070671_100331804 | Ga0070671_1003318042 | 268 |
| 47 | 3300005356 | Ga0070674_100004132 | Ga0070674_1000041324 | 268 |
| 48 | 3300005364 | Ga0070673_100003933 | Ga0070673_1000039338 | 268 |
| 49 | 3300005364 | Ga0070673_100072909 | Ga0070673_1000729092 | 268 |
| 50 | 3300005365 | Ga0070688_100000527 | Ga0070688_10000052716 | 268 |
| 51 | 3300005366 | Ga0070659_100075303 | Ga0070659_1000753031 | 268 |
| 52 | 3300005366 | Ga0070659_100559824 | Ga0070659_1005598241 | 268 |
| 53 | 3300005367 | Ga0070667_100004695 | Ga0070667_10000469511 | 268 |
| 54 | 3300005367 | Ga0070667_100121836 | Ga0070667_1001218361 | 268 |
| 55 | 3300005367 | Ga0070667_100395705 | Ga0070667_1003957052 | 268 |
| 56 | 3300005435 | Ga0070714_100266168 | Ga0070714_1002661682 | 268 |
| 57 | 3300005436 | Ga0070713_100017517 | Ga0070713_1000175173 | 268 |
| 58 | 3300005440 | Ga0070705_100425141 | Ga0070705_1004251411 | 268 |
| 59 | 3300005455 | Ga0070663_100398081 | Ga0070663_1003980811 | 268 |
| 60 | 3300005456 | Ga0070678_100001827 | Ga0070678_1000018272 | 268 |
| 61 | 3300005456 | Ga0070678_100005793 | Ga0070678_1000057932 | 268 |
| 62 | 3300005456 | Ga0070678_100405302 | Ga0070678_1004053021 | 268 |
| 63 | 3300005457 | Ga0070662_100057001 | Ga0070662_1000570012 | 268 |
| 64 | 3300005459 | Ga0068867_100014888 | Ga0068867_1000148884 | 268 |
| 65 | 3300005459 | Ga0068867_100184382 | Ga0068867_1001843821 | 268 |
| 66 | 3300005466 | Ga0070685_10056986 | Ga0070685_100569862 | 268 |
| 67 | 3300005467 | Ga0070706_100081455 | Ga0070706_1000814554 | 268 |
| 68 | 3300005539 | Ga0068853_100000006 | Ga0068853_1000000068 | 268 |
| 69 | 3300005539 | Ga0068853_100205632 | Ga0068853_1002056322 | 268 |
| 70 | 3300005539 | Ga0068853_100493917 | Ga0068853_1004939172 | 268 |
| 71 | 3300005543 | Ga0070672_100000507 | Ga0070672_1000005072 | 268 |
| 72 | 3300005548 | Ga0070665_100469921 | Ga0070665_1004699212 | 268 |
| 73 | 3300005563 | Ga0068855_100001572 | Ga0068855_10000157210 | 268 |
| 74 | 3300005564 | Ga0070664_100070572 | Ga0070664_1000705722 | 268 |
| 75 | 3300005718 | Ga0068866_10130726 | Ga0068866_101307262 | 268 |
| 76 | 3300005842 | Ga0068858_100234535 | Ga0068858_1002345352 | 268 |
| 77 | 3300005843 | Ga0068860_100068259 | Ga0068860_1000682595 | 268 |
| 78 | 3300005844 | Ga0068862_100110871 | Ga0068862_1001108712 | 268 |
| 79 | 3300005985 | Ga0081539_10003184 | Ga0081539_1000318425 | 268 |
| 80 | 3300006173 | Ga0070716_100184969 | Ga0070716_1001849692 | 268 |
| 81 | 3300006175 | Ga0070712_100005821 | Ga0070712_1000058217 | 268 |
| 82 | 3300006237 | Ga0097621_100087635 | Ga0097621_1000876352 | 268 |
| 83 | 3300006237 | Ga0097621_100110200 | Ga0097621_1001102002 | 268 |
| 84 | 3300006237 | Ga0097621_100352055 | Ga0097621_1003520551 | 268 |
| 85 | 3300006358 | Ga0068871_100015881 | Ga0068871_1000158814 | 268 |
| 86 | 3300006881 | Ga0068865_100026395 | Ga0068865_1000263954 | 268 |
| 87 | 3300009094 | Ga0111539_10439948 | Ga0111539_104399482 | 268 |
| 88 | 3300009176 | Ga0105242_10525978 | Ga0105242_105259782 | 268 |
| 89 | 3300009545 | Ga0105237_10068069 | Ga0105237_100680692 | 268 |
| 90 | 3300010375 | Ga0105239_10132355 | Ga0105239_101323552 | 268 |
| 91 | 3300010375 | Ga0105239_10382509 | Ga0105239_103825091 | 268 |
| 92 | 3300010375 | Ga0105239_10482415 | Ga0105239_104824151 | 268 |
| 93 | 3300013100 | Ga0157373_10190311 | Ga0157373_101903112 | 268 |
| 94 | 3300013296 | Ga0157374_10013389 | Ga0157374_100133896 | 268 |
| 95 | 3300013296 | Ga0157374_10013540 | Ga0157374_100135406 | 268 |
| 96 | 3300013296 | Ga0157374_10025878 | Ga0157374_100258783 | 268 |
| 97 | 3300013296 | Ga0157374_10068203 | Ga0157374_100682033 | 268 |
| 98 | 3300013296 | Ga0157374_10816922 | Ga0157374_108169221 | 268 |
| 99 | 3300013297 | Ga0157378_10029064 | Ga0157378_100290643 | 268 |
| 100 | 3300013297 | Ga0157378_10035625 | Ga0157378_100356254 | 268 |
| 101 | 3300013297 | Ga0157378_10055986 | Ga0157378_100559862 | 268 |
| 102 | 3300013297 | Ga0157378_10062578 | Ga0157378_100625782 | 268 |
| 103 | 3300013297 | Ga0157378_10144706 | Ga0157378_101447063 | 268 |
| 104 | 3300013306 | Ga0163162_10002963 | Ga0163162_1000296317 | 268 |
| 105 | 3300013306 | Ga0163162_10032165 | Ga0163162_100321657 | 268 |
| 106 | 3300013307 | Ga0157372_10007030 | Ga0157372_100070309 | 268 |
| 107 | 3300013308 | Ga0157375_10002525 | Ga0157375_100025252 | 268 |
| 108 | 3300013308 | Ga0157375_10011067 | Ga0157375_100110677 | 268 |
| 109 | 3300013308 | Ga0157375_10021659 | Ga0157375_100216594 | 268 |
| 110 | 3300013308 | Ga0157375_10163959 | Ga0157375_101639591 | 268 |
| 111 | 3300013308 | Ga0157375_10234974 | Ga0157375_102349741 | 268 |
| 112 | 3300014325 | Ga0163163_11084152 | Ga0163163_110841521 | 268 |
| 113 | 3300014968 | Ga0157379_10309078 | Ga0157379_103090781 | 268 |
| 114 | 3300014969 | Ga0157376_10045142 | Ga0157376_100451422 | 268 |
| 115 | 3300021384 | Ga0213876_10116342 | Ga0213876_101163421 | 268 |
| 116 | 3300025298 | Ga0209050_1000151 | Ga0209050_100015132 | 268 |
| 117 | 3300025315 | Ga0207697_10000683 | Ga0207697_1000068323 | 268 |
| 118 | 3300025315 | Ga0207697_10003337 | Ga0207697_100033373 | 268 |
| 119 | 3300025901 | Ga0207688_10025872 | Ga0207688_100258723 | 268 |
| 120 | 3300025901 | Ga0207688_10033826 | Ga0207688_100338262 | 268 |
| 121 | 3300025901 | Ga0207688_10041068 | Ga0207688_100410682 | 268 |
| 122 | 3300025903 | Ga0207680_10014109 | Ga0207680_100141094 | 268 |
| 123 | 3300025903 | Ga0207680_10017224 | Ga0207680_100172243 | 268 |
| 124 | 3300025905 | Ga0207685_10111630 | Ga0207685_101116302 | 268 |
| 125 | 3300025907 | Ga0207645_10027556 | Ga0207645_100275564 | 268 |
| 126 | 3300025907 | Ga0207645_10041753 | Ga0207645_100417532 | 268 |
| 127 | 3300025907 | Ga0207645_10081938 | Ga0207645_100819383 | 268 |
| 128 | 3300025909 | Ga0207705_10000742 | Ga0207705_100007423 | 268 |
| 129 | 3300025913 | Ga0207695_10000484 | Ga0207695_1000048425 | 268 |
| 130 | 3300025914 | Ga0207671_10033800 | Ga0207671_100338003 | 268 |
| 131 | 3300025915 | Ga0207693_10001246 | Ga0207693_1000124619 | 268 |
| 132 | 3300025919 | Ga0207657_10013229 | Ga0207657_100132295 | 268 |
| 133 | 3300025919 | Ga0207657_10432196 | Ga0207657_104321961 | 268 |
| 134 | 3300025920 | Ga0207649_10049084 | Ga0207649_100490842 | 268 |
| 135 | 3300025923 | Ga0207681_10012256 | Ga0207681_100122563 | 268 |
| 136 | 3300025925 | Ga0207650_10007381 | Ga0207650_100073812 | 268 |
| 137 | 3300025925 | Ga0207650_10058508 | Ga0207650_100585084 | 268 |
| 138 | 3300025925 | Ga0207650_10165897 | Ga0207650_101658972 | 268 |
| 139 | 3300025925 | Ga0207650_10185279 | Ga0207650_101852792 | 268 |
| 140 | 3300025926 | Ga0207659_10023331 | Ga0207659_100233312 | 268 |
| 141 | 3300025928 | Ga0207700_10128968 | Ga0207700_101289682 | 268 |
| 142 | 3300025931 | Ga0207644_10151155 | Ga0207644_101511551 | 268 |
| 143 | 3300025932 | Ga0207690_10130113 | Ga0207690_101301132 | 268 |
| 144 | 3300025933 | Ga0207706_10196089 | Ga0207706_101960893 | 268 |
| 145 | 3300025933 | Ga0207706_10303422 | Ga0207706_103034221 | 268 |
| 146 | 3300025936 | Ga0207670_10104781 | Ga0207670_101047812 | 268 |
| 147 | 3300025936 | Ga0207670_10177766 | Ga0207670_101777662 | 268 |
| 148 | 3300025936 | Ga0207670_10242560 | Ga0207670_102425601 | 268 |
| 149 | 3300025937 | Ga0207669_10013699 | Ga0207669_100136993 | 268 |
| 150 | 3300025938 | Ga0207704_10144039 | Ga0207704_101440392 | 268 |
| 151 | 3300025939 | Ga0207665_10024188 | Ga0207665_100241882 | 268 |
| 152 | 3300025939 | Ga0207665_10107379 | Ga0207665_101073792 | 268 |
| 153 | 3300025940 | Ga0207691_10001154 | Ga0207691_1000115425 | 268 |
| 154 | 3300025940 | Ga0207691_10039831 | Ga0207691_100398315 | 268 |
| 155 | 3300025949 | Ga0207667_10006025 | Ga0207667_1000602511 | 268 |
| 156 | 3300025960 | Ga0207651_10049008 | Ga0207651_100490082 | 268 |
| 157 | 3300025960 | Ga0207651_10301327 | Ga0207651_103013272 | 268 |
| 158 | 3300025972 | Ga0207668_10096139 | Ga0207668_100961391 | 268 |
| 159 | 3300025986 | Ga0207658_10107372 | Ga0207658_101073723 | 268 |
| 160 | 3300025986 | Ga0207658_10117232 | Ga0207658_101172322 | 268 |
| 161 | 3300026023 | Ga0207677_10395876 | Ga0207677_103958762 | 268 |
| 162 | 3300026035 | Ga0207703_10164976 | Ga0207703_101649762 | 268 |
| 163 | 3300026041 | Ga0207639_10000001 | Ga0207639_10000001911 | 268 |
| 164 | 3300026041 | Ga0207639_10405682 | Ga0207639_104056821 | 268 |
| 165 | 3300026067 | Ga0207678_10433784 | Ga0207678_104337841 | 268 |
| 166 | 3300026078 | Ga0207702_10772120 | Ga0207702_107721201 | 268 |
| 167 | 3300026088 | Ga0207641_10019489 | Ga0207641_100194892 | 268 |
| 168 | 3300026089 | Ga0207648_10009854 | Ga0207648_100098544 | 268 |
| 169 | 3300026089 | Ga0207648_10192314 | Ga0207648_101923141 | 268 |
| 170 | 3300026089 | Ga0207648_10213044 | Ga0207648_102130442 | 268 |
| 171 | 3300026121 | Ga0207683_10015937 | Ga0207683_100159372 | 268 |
| 172 | 3300026121 | Ga0207683_10022088 | Ga0207683_100220883 | 268 |
| 173 | 3300026121 | Ga0207683_10038184 | Ga0207683_100381846 | 268 |
| 174 | 3300026121 | Ga0207683_10047470 | Ga0207683_100474701 | 268 |
| 175 | 3300028379 | Ga0268266_10015972 | Ga0268266_100159724 | 268 |
| 176 | 3300028379 | Ga0268266_10214705 | Ga0268266_102147052 | 268 |
| 177 | 3300028379 | Ga0268266_10292601 | Ga0268266_102926012 | 268 |
| 178 | 3300028381 | Ga0268264_10797281 | Ga0268264_107972811 | 268 |
| 179 | 3300032004 | Ga0307414_10026037 | Ga0307414_100260374 | 268 |
| 180 | 3300035691 | Ga0373931_0371204 | Ga0373931_0371204_72_887 | 268 |
| 181 | 3300035692 | Ga0373935_0172058 | Ga0373935_0172058_133_951 | 268 |
| 182 | 3300036401 | Ga0373937_0030113 | Ga0373937_0030113_1099_1917 | 268 |
| 183 | 3300037312 | Ga0395899_0000067 | Ga0395899_0000067_70425_71237 | 268 |
| 184 | 3300037312 | Ga0395899_0065904 | Ga0395899_0065904_1035_1853 | 268 |
| 185 | 3300037418 | Ga0395900_0008838 | Ga0395900_0008838_7939_8757 | 268 |
| 186 | 3300037471 | Ga0395905_0539170 | Ga0395905_0539170_139_954 | 268 |
| 187 | 3300039437 | Ga0436365_0997021 | Ga0436365_0997021_1690_2505 | 268 |
| 188 | 3300044673 | Ga0453683_0286712 | Ga0453683_0286712_37_849 | 268 |
| 189 | 3300044683 | Ga0466965_0127539 | Ga0466965_0127539_269_1084 | 268 |
| 190 | 3300044719 | Ga0466971_0000081 | Ga0466971_0000081_7853_8668 | 268 |
| 191 | 3300044842 | Ga0466957_0008871 | Ga0466957_0008871_2436_3248 | 268 |
| 192 | 3300044842 | Ga0466957_0038034 | Ga0466957_0038034_1759_2574 | 268 |
| 193 | 3300045976 | Ga0466967_0092512 | Ga0466967_0092512_1225_2043 | 268 |
| 194 | 3300046472 | Ga0495580_0185733 | Ga0495580_0185733_138_953 | 268 |
| 195 | 3300046474 | Ga0495605_0132244 | Ga0495605_0132244_42_857 | 268 |
| 196 | 3300046516 | Ga0495628_0070016 | Ga0495628_0070016_1142_1978 | 268 |
| 197 | 3300046516 | Ga0495628_0197755 | Ga0495628_0197755_371_1189 | 268 |
| 198 | 3300046517 | Ga0495630_0080002 | Ga0495630_0080002_1313_2131 | 268 |
| 199 | 3300046522 | Ga0495643_0000220 | Ga0495643_0000220_71688_72500 | 268 |
| 200 | 3300046533 | Ga0495640_0106020 | Ga0495640_0106020_16_834 | 268 |
| 201 | 3300046537 | Ga0495598_0009453 | Ga0495598_0009453_217_1032 | 268 |
| 202 | 3300046684 | Ga0495669_0024680 | Ga0495669_0024680_202_1017 | 268 |
| 203 | 3300048904 | Ga0496101_0023400 | Ga0496101_0023400_3244_4059 | 268 |
| 204 | 3300048905 | Ga0496102_0369111 | Ga0496102_0369111_398_1213 | 268 |
| 205 | 3300048906 | Ga0496103_0076626 | Ga0496103_0076626_800_1615 | 268 |
| 206 | 3300048908 | Ga0496105_0239190 | Ga0496105_0239190_450_1265 | 268 |
| 207 | 3300048908 | Ga0496105_0350664 | Ga0496105_0350664_204_1022 | 268 |
| 208 | 3300048909 | Ga0496106_0084137 | Ga0496106_0084137_933_1748 | 268 |
| 209 | 3300048911 | Ga0496108_0047861 | Ga0496108_0047861_1601_2419 | 268 |
| 210 | 3300048915 | Ga0496112_0041101 | Ga0496112_0041101_1255_2073 | 268 |
| 211 | 3300048915 | Ga0496112_0274875 | Ga0496112_0274875_233_1051 | 268 |
| 212 | 3300048915 | Ga0496112_0405575 | Ga0496112_0405575_465_1283 | 268 |
| 213 | 3300048915 | Ga0496112_0573401 | Ga0496112_0573401_83_901 | 268 |
| 214 | 3300048916 | Ga0496113_0053752 | Ga0496113_0053752_695_1513 | 268 |
| 215 | 3300048917 | Ga0496114_0202769 | Ga0496114_0202769_367_1182 | 268 |
| 216 | 3300048917 | Ga0496114_0662800 | Ga0496114_0662800_84_902 | 268 |
| 217 | 3300048918 | Ga0496115_0004860 | Ga0496115_0004860_3728_4546 | 268 |
| 218 | 3300048918 | Ga0496115_0045379 | Ga0496115_0045379_88_903 | 268 |
| 219 | 3300048928 | Ga0496125_0000006 | Ga0496125_0000006_127045_127860 | 268 |
| 220 | 3300049568 | Ga0501031_0000196 | Ga0501031_0000196_18838_19689 | 268 |
| 221 | 3300049569 | Ga0501032_0000359 | Ga0501032_0000359_25232_26044 | 268 |
| 222 | 3300049569 | Ga0501032_0265624 | Ga0501032_0265624_69_920 | 268 |
| 223 | 3300049570 | Ga0501033_0000072 | Ga0501033_0000072_25251_26063 | 268 |
| 224 | 3300049572 | Ga0501036_0038072 | Ga0501036_0038072_1911_2762 | 268 |
| 225 | 3300049573 | Ga0501037_0000073 | Ga0501037_0000073_87469_88299 | 268 |
| 226 | 3300049574 | Ga0501038_0135385 | Ga0501038_0135385_877_1728 | 268 |
| 227 | 3300049575 | Ga0501039_0001009 | Ga0501039_0001009_12451_13302 | 268 |
| 228 | 3300049579 | Ga0501043_0000640 | Ga0501043_0000640_29389_30240 | 268 |
| 229 | 3300049579 | Ga0501043_0000854 | Ga0501043_0000854_25319_26134 | 268 |
| 230 | 3300049581 | Ga0501047_0008693 | Ga0501047_0008693_1876_2727 | 268 |
| 231 | 3300049581 | Ga0501047_0229106 | Ga0501047_0229106_69_884 | 268 |
| 232 | 3300049586 | Ga0501070_0001365 | Ga0501070_0001365_7497_8348 | 268 |
| 233 | 3300049822 | Ga0501035_0000002 | Ga0501035_0000002_184330_185181 | 268 |
| 234 | 3300049823 | Ga0501044_0001262 | Ga0501044_0001262_19555_20385 | 268 |
| 235 | 3300049823 | Ga0501044_0643317 | Ga0501044_0643317_35_841 | 268 |
| 236 | 3300050511 | nmdc:mga08y16_217731_c1 | nmdc:mga08y16_217731_c1_364_1182 | 268 |
| 237 | 3300050512 | nmdc:mga0n895_501324_c1 | nmdc:mga0n895_501324_c1_27_845 | 268 |
| 238 | 3300053130 | Ga0500642_0056692 | Ga0500642_0056692_842_1657 | 268 |
| 239 | 3300053153 | Ga0500616_0004599 | Ga0500616_0004599_8892_9701 | 268 |
| 240 | 3300053730 | Ga0500645_015655 | Ga0500645_015655_966_1781 | 268 |
| 241 | 3300061719 | Ga0466962_0000047 | Ga0466962_0000047_48588_49403 | 268 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fym-assembly1.cif.gz_A | the 1a structure of ymfm, a putative dna-binding membrane protein from staphylococcus aureus | 0.8682 | 6 | 73 |
| 4efz-assembly3.cif.gz_B | crystal structure of a hypothetical metallo-beta-lactamase from burkholderia pseudomallei | 0.8677 | 82 | 264 |
| 4chl-assembly1.cif.gz_A | human ethylmalonic encephalopathy protein 1 (hethe1) | 0.8602 | 74 | 265 |
| 4ysl-assembly1.cif.gz_B | crystal structure of sdoa from pseudomonas putida in complex with glutathione | 0.8587 | 77 | 264 |
| 1r69-assembly1.cif.gz_A | structure of the amino-terminal domain of phage 434 repressor at 2.0 angstroms resolution | 0.8573 | 7 | 65 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7KLP6_1_199_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8849 | 83 | 263 | 3.60.15.10 |
| af_A0A0R0KZP1_7_202_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8843 | 158 | 251 | 3.60.15.10 |
| af_P9WMW3_3_221_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8743 | 85 | 268 | 3.60.15.10 |
| af_Q6PII5_1_211_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8695 | 82 | 251 | 3.60.15.10 |
| 3fymA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8682 | 6 | 73 | 1.10.260.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A353F1Y2-F1-model_v4 | MBL fold metallo-hydrolase | 0.9756 | 1 | 200 |
GO:0006749
GO:0016787 GO:0050313 GO:0070813 |
| AF-A0A2V5Q5J5-F1-model_v4 | MBL fold metallo-hydrolase | 0.972 | 1 | 163 |
GO:0016787
|
| AF-A0A2E3NBR2-F1-model_v4 | MBL fold metallo-hydrolase | 0.9718 | 2 | 268 |
GO:0016787
|
| AF-A0A2D5AQ81-F1-model_v4 | MBL fold metallo-hydrolase | 0.9712 | 1 | 147 |
GO:0003677
GO:0016787 |
| AF-A0A2V5UG96-F1-model_v4 | MBL fold metallo-hydrolase | 0.9708 | 1 | 183 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar