F353743

General Info

Members Datasets Scaffolds Average Seq Length
241 140 482 208

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10079916|Ga0105241_100799164
Length 244
Sequence MLCKILSFPRIVCGGGRIVRLMEELLRIEADVKAFVGLSDRSLERALKQELLEILEEAEFLFGPRDPSIELLEPRISEKFYGQGYGNRQIRIYLTSRSKNEPWVASYELSHEAIHLLSPVVWGEATVLEEGLATYFSFKYLNRVHGIQMTSTGFRKYDAAERGVSSLLAENEFLIKELRVRQPVISKIDEKLMVEVGNVEPSLAKYLCSDFETYGGSTGIKTTLWGELSNGARNIAAGLRSLWD

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
107 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
108 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
109 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
110 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
111 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
112 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
113 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
114 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
115 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
116 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
117 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
118 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
119 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
120 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
121 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
122 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
123 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
124 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
125 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
126 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
127 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
128 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
129 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
130 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
131 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
132 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
133 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
134 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
135 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
136 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.83
Rhizosphere 99.17
Stem 0
Stem Tuber 0
Unclassified 30.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10079916 3300009174 Bacteria 2558
2 SwRhRL2b_contig_1013731 2162886007 Unclassified 4520
3 MBSR1b_contig_4667890 2162886012 Bacteria 894
4 JGI24751J29686_10000064 3300002459 Bacteria 60667
5 Ga0065704_10084516 3300005289 Unclassified 3327
6 Ga0065712_10000392 3300005290 Bacteria 14012
7 Ga0065712_10019249 3300005290 Bacteria 1276
8 Ga0065715_10001445 3300005293 Bacteria 7772
9 Ga0065715_10125453 3300005293 Bacteria 2130
10 Ga0065715_10144041 3300005293 Unclassified 1813
11 Ga0065715_10211850 3300005293 Bacteria 1279
12 Ga0065707_10002779 3300005295 Bacteria 6065
13 Ga0070670_100000219 3300005331 Bacteria 52710
14 Ga0070670_100052338 3300005331 Bacteria 3507
15 Ga0070670_100055158 3300005331 Bacteria 3411
16 Ga0070670_100064593 3300005331 Bacteria 3140
17 Ga0070670_100391311 3300005331 Bacteria 1226
18 Ga0070670_100653445 3300005331 Unclassified 943
19 Ga0070682_100001288 3300005337 Bacteria 14213
20 Ga0070689_100004946 3300005340 Bacteria 9044
21 Ga0070692_10064487 3300005345 Bacteria 1938
22 Ga0070669_100462743 3300005353 Unclassified 1047
23 Ga0070669_100468282 3300005353 Bacteria 1041
24 Ga0070675_100164863 3300005354 Bacteria 1908
25 Ga0070673_100333806 3300005364 Unclassified 1342
26 Ga0070673_100488011 3300005364 Bacteria 1113
27 Ga0070688_100259072 3300005365 Bacteria 1241
28 Ga0070659_100529352 3300005366 Bacteria 1007
29 Ga0070700_100000043 3300005441 Bacteria 98943
30 Ga0070708_100459612 3300005445 Bacteria 1201
31 Ga0070707_100059380 3300005468 Bacteria 3669
32 Ga0070698_100018272 3300005471 Viruses 7383
33 Ga0070698_100020729 3300005471 Bacteria 6890
34 Ga0070699_100006393 3300005518 Bacteria 10264
35 Ga0070699_100035025 3300005518 Bacteria 4338
36 Ga0070679_100108413 3300005530 Bacteria 2763
37 Ga0070679_100125067 3300005530 Bacteria 2554
38 Ga0070697_100017780 3300005536 Bacteria 5599
39 Ga0070672_100930547 3300005543 Bacteria 769
40 Ga0070695_100056657 3300005545 Bacteria 2530
41 Ga0070693_100011922 3300005547 Bacteria 4387
42 Ga0070693_100459666 3300005547 Unclassified 895
43 Ga0070693_100465791 3300005547 Unclassified 890
44 Ga0070693_100505936 3300005547 Bacteria 858
45 Ga0070664_100070888 3300005564 Bacteria 2986
46 Ga0068857_100281205 3300005577 Unclassified 1531
47 Ga0068857_100295060 3300005577 Unclassified 1493
48 Ga0068857_100827556 3300005577 Bacteria 885
49 Ga0068854_100076356 3300005578 Bacteria 2462
50 Ga0068854_100115257 3300005578 Bacteria 2032
51 Ga0068854_100582553 3300005578 Unclassified 953
52 Ga0070702_100045913 3300005615 Bacteria 2474
53 Ga0068859_100001473 3300005617 Bacteria 23952
54 Ga0068859_100041130 3300005617 Unclassified 4644
55 Ga0068859_100076614 3300005617 Bacteria 3385
56 Ga0068859_100108941 3300005617 Bacteria 2831
57 Ga0068859_100254685 3300005617 Bacteria 1846
58 Ga0068859_100271676 3300005617 Bacteria 1787
59 Ga0068859_100640150 3300005617 Bacteria 1155
60 Ga0068864_100033751 3300005618 Bacteria 4351
61 Ga0068864_100479655 3300005618 Bacteria 1193
62 Ga0068864_100528904 3300005618 Unclassified 1137
63 Ga0068861_100196822 3300005719 Bacteria 1689
64 Ga0068870_10026359 3300005840 Bacteria 2897
65 Ga0068870_10146024 3300005840 Unclassified 1388
66 Ga0068863_100283532 3300005841 Bacteria 1605
67 Ga0068858_100033367 3300005842 Bacteria 4778
68 Ga0068858_100083486 3300005842 Bacteria 2971
69 Ga0068858_100403016 3300005842 Bacteria 1314
70 Ga0068860_100192912 3300005843 Bacteria 1972
71 Ga0068860_100275958 3300005843 Bacteria 1642
72 Ga0068862_100233738 3300005844 Bacteria 1669
73 Ga0068862_100334065 3300005844 Bacteria 1402
74 Ga0075428_101241264 3300006844 Unclassified 785
75 Ga0075430_100070693 3300006846 Bacteria 2927
76 Ga0075431_100156176 3300006847 Unclassified 2347
77 Ga0075431_100176347 3300006847 Bacteria 2195
78 Ga0075433_10074794 3300006852 Bacteria 2981
79 Ga0075433_10093020 3300006852 Bacteria 2667
80 Ga0075433_10221487 3300006852 Bacteria 1681
81 Ga0075433_10246686 3300006852 Archaea 1585
82 Ga0075433_10306836 3300006852 Bacteria 1405
83 Ga0075429_100027003 3300006880 Bacteria 4985
84 Ga0097620_100001473 3300006931 Bacteria 23952
85 Ga0097620_100041130 3300006931 Unclassified 4644
86 Ga0097620_100076617 3300006931 Bacteria 3385
87 Ga0097620_100108939 3300006931 Bacteria 2831
88 Ga0097620_100254677 3300006931 Bacteria 1846
89 Ga0097620_100271691 3300006931 Bacteria 1787
90 Ga0097620_100640147 3300006931 Bacteria 1155
91 Ga0105251_10028765 3300009011 Bacteria 2805
92 Ga0111539_10034011 3300009094 Bacteria 6184
93 Ga0105247_10047205 3300009101 Unclassified 2644
94 Ga0105247_10085173 3300009101 Bacteria 1998
95 Ga0105247_10135768 3300009101 Unclassified 1607
96 Ga0114129_10039998 3300009147 Bacteria 6613
97 Ga0114129_10124938 3300009147 Bacteria 3538
98 Ga0114129_10185289 3300009147 Bacteria 2829
99 Ga0105243_10655444 3300009148 Bacteria 1018
100 Ga0105243_10778914 3300009148 Unclassified 941
101 Ga0105241_10037892 3300009174 Unclassified 3634
102 Ga0105242_10232588 3300009176 Unclassified 1652
103 Ga0105242_10303398 3300009176 Bacteria 1458
104 Ga0105248_10002058 3300009177 Bacteria 22276
105 Ga0105248_10109850 3300009177 Bacteria 3109
106 Ga0105248_10135869 3300009177 Bacteria 2774
107 Ga0105248_10169857 3300009177 Bacteria 2458
108 Ga0105248_10403458 3300009177 Bacteria 1539
109 Ga0105248_10587972 3300009177 Unclassified 1256
110 Ga0105237_10081345 3300009545 Unclassified 3230
111 Ga0105238_10000527 3300009551 Bacteria 40063
112 Ga0105249_10002486 3300009553 Bacteria 15969
113 Ga0105249_10137194 3300009553 Unclassified 2342
114 Ga0105249_10461004 3300009553 Bacteria 1311
115 Ga0105249_10897975 3300009553 Unclassified 953
116 Ga0105239_10259564 3300010375 Bacteria 1952
117 Ga0157373_10025849 3300013100 Bacteria 4244
118 Ga0157373_10053451 3300013100 Bacteria 2872
119 Ga0157378_10178370 3300013297 Unclassified 1997
120 Ga0157378_10935459 3300013297 Bacteria 899
121 Ga0157372_10254521 3300013307 Bacteria 2039
122 Ga0157375_10711291 3300013308 Bacteria 1158
123 Ga0157375_11411306 3300013308 Bacteria 820
124 Ga0163163_10000231 3300014325 Bacteria 57575
125 Ga0163163_10658228 3300014325 Bacteria 1111
126 Ga0163163_10703004 3300014325 Unclassified 1074
127 Ga0157380_10466480 3300014326 Unclassified 1217
128 Ga0207710_10002241 3300025900 Bacteria 9073
129 Ga0207647_10005093 3300025904 Bacteria 9687
130 Ga0207662_10378762 3300025918 Bacteria 955
131 Ga0207652_10097618 3300025921 Bacteria 2590
132 Ga0207652_10172053 3300025921 Bacteria 1944
133 Ga0207646_10084281 3300025922 Bacteria 2844
134 Ga0207646_10108478 3300025922 Bacteria 2491
135 Ga0207681_10568586 3300025923 Bacteria 934
136 Ga0207694_10000918 3300025924 Bacteria 26089
137 Ga0207650_10000022 3300025925 Bacteria 318878
138 Ga0207650_10193829 3300025925 Unclassified 1625
139 Ga0207650_10242960 3300025925 Unclassified 1455
140 Ga0207686_10122536 3300025934 Unclassified 1772
141 Ga0207686_10662826 3300025934 Unclassified 826
142 Ga0207709_10006298 3300025935 Bacteria 6663
143 Ga0207709_10206515 3300025935 Bacteria 1407
144 Ga0207670_10001456 3300025936 Bacteria 12415
145 Ga0207691_10601868 3300025940 Unclassified 930
146 Ga0207711_10028896 3300025941 Unclassified 4671
147 Ga0207711_10092670 3300025941 Bacteria 2659
148 Ga0207711_10185761 3300025941 Bacteria 1892
149 Ga0207711_10365448 3300025941 Bacteria 1337
150 Ga0207711_10757160 3300025941 Unclassified 905
151 Ga0207689_10135676 3300025942 Bacteria 2026
152 Ga0207679_10176582 3300025945 Unclassified 1763
153 Ga0207679_10484206 3300025945 Unclassified 1102
154 Ga0207651_10361749 3300025960 Unclassified 1225
155 Ga0207640_10081139 3300025981 Unclassified 2217
156 Ga0207640_10090376 3300025981 Unclassified 2119
157 Ga0207640_10297111 3300025981 Bacteria 1276
158 Ga0207703_10045204 3300026035 Bacteria 3541
159 Ga0207703_10287924 3300026035 Unclassified 1494
160 Ga0207708_10000060 3300026075 Bacteria 93846
161 Ga0207708_10002010 3300026075 Bacteria 14975
162 Ga0207641_10190315 3300026088 Unclassified 1885
163 Ga0207641_10518407 3300026088 Bacteria 1159
164 Ga0207641_10636964 3300026088 Unclassified 1046
165 Ga0207648_10038894 3300026089 Bacteria 4185
166 Ga0207676_10039725 3300026095 Bacteria 3601
167 Ga0207676_10296063 3300026095 Bacteria 1475
168 Ga0207676_10357506 3300026095 Unclassified 1352
169 Ga0207676_10556492 3300026095 Bacteria 1096
170 Ga0207674_10059486 3300026116 Bacteria 3866
171 Ga0207674_10113015 3300026116 Bacteria 2689
172 Ga0207674_10121730 3300026116 Unclassified 2576
173 Ga0207674_10317509 3300026116 Bacteria 1507
174 Ga0207675_100073762 3300026118 Bacteria 3193
175 Ga0207428_10013058 3300027907 Bacteria 7274
176 Ga0268265_10028705 3300028380 Bacteria 3987
177 Ga0268265_10140051 3300028380 Bacteria 2024
178 Ga0268264_10107482 3300028381 Unclassified 2437
179 Ga0268264_10227098 3300028381 Bacteria 1722
180 Ga0268264_10647203 3300028381 Bacteria 1046
181 Ga0314311_1043456 3300030733 Unclassified 2407
182 Ga0307405_10208298 3300031731 Unclassified 1425
183 Ga0307410_10230750 3300031852 Bacteria 1429
184 Ga0307406_10005848 3300031901 Bacteria 6743
185 Ga0307407_10164024 3300031903 Bacteria 1457
186 Ga0307412_10259275 3300031911 Bacteria 1354
187 Ga0307416_100007017 3300032002 Bacteria 7106
188 Ga0307414_10010991 3300032004 Bacteria 5289
189 Ga0307414_10560630 3300032004 Unclassified 1019
190 Ga0307411_10001310 3300032005 Bacteria 10010
191 Ga0307415_100004809 3300032126 Bacteria 7078
192 Ga0373942_0003396 3300035207 Unclassified 3743
193 Ga0373931_0042907 3300035691 Unclassified 2380
194 Ga0242419_000210 3300038698 Unclassified 3063
195 Ga0451576_0673910 3300045051 Bacteria 1087
196 Ga0496108_0290397 3300048911 Bacteria 1424
197 Ga0496112_0400629 3300048915 Bacteria 1312
198 Ga0501291_018277 3300049514 Bacteria 1089
199 Ga0501292_005539 3300049515 Unclassified 1764
200 Ga0501292_029461 3300049515 Unclassified 917
201 Ga0501295_077589 3300049518 Unclassified 751
202 Ga0501296_017237 3300049519 Unclassified 902
203 Ga0501298_013205 3300049521 Bacteria 1459
204 Ga0501301_006854 3300049524 Unclassified 867
205 Ga0501198_012219 3300049649 Unclassified 1289
206 Ga0501202_000183 3300049652 Bacteria 7835
207 Ga0501202_063807 3300049652 Unclassified 838
208 Ga0501207_004216 3300049654 Bacteria 1946
209 Ga0501209_035272 3300049656 Unclassified 1294
210 Ga0501214_008502 3300049659 Bacteria 1080
211 Ga0501216_003646 3300049660 Bacteria 2257
212 Ga0501217_000747 3300049661 Bacteria 5633
213 Ga0501223_001577 3300049663 Bacteria 5249
214 Ga0501223_050250 3300049663 Unclassified 809
215 Ga0501224_001560 3300049664 Bacteria 3056
216 Ga0501227_070801 3300049665 Unclassified 905
217 Ga0501235_005205 3300049669 Bacteria 2829
218 Ga0501235_036888 3300049669 Unclassified 1112
219 Ga0501240_026471 3300049673 Unclassified 906
220 Ga0501249_004448 3300049679 Bacteria 2848
221 Ga0501250_029566 3300049680 Unclassified 754
222 Ga0501251_002407 3300049681 Bacteria 1813
223 Ga0501252_028704 3300049682 Unclassified 762
224 Ga0501253_123835 3300049683 Unclassified 629
225 Ga0501225_0019696 3300049705 Bacteria 1866
226 Ga0501225_0057098 3300049705 Bacteria 1094
227 Ga0501229_003331 3300049706 Bacteria 1923
228 Ga0501234_026829 3300049707 Unclassified 925
229 Ga0501245_026512 3300049708 Unclassified 936
230 Ga0501271_016080 3300049768 Bacteria 840
231 Ga0501273_005566 3300049770 Unclassified 1427
232 Ga0501283_008483 3300049779 Bacteria 1483
233 Ga0501204_030765 3300049850 Unclassified 745
234 nmdc:mga05p37_556401_c1 3300050507 Bacteria 1304
235 nmdc:mga05p37_951194_c1 3300050507 Unclassified 919
236 nmdc:mga06r32_501983_c1 3300050510 Bacteria 1190
237 nmdc:mga08y16_24260_c1 3300050511 Bacteria 6402
238 nmdc:mga0a205_24168_c1 3300050515 Bacteria 5772
239 nmdc:mga0a205_30609_c1 3300050515 Bacteria 5155
240 nmdc:mga0a205_360400_c1 3300050515 Bacteria 1321
241 nmdc:mga0a205_433305_c1 3300050515 Bacteria 1176
242 Ga0105241_10079916
243 SwRhRL2b_contig_1013731
244 MBSR1b_contig_4667890
245 JGI24751J29686_10000064
246 Ga0065704_10084516
247 Ga0065712_10000392
248 Ga0065712_10019249
249 Ga0065715_10001445
250 Ga0065715_10125453
251 Ga0065715_10144041
252 Ga0065715_10211850
253 Ga0065707_10002779
254 Ga0070670_100000219
255 Ga0070670_100052338
256 Ga0070670_100055158
257 Ga0070670_100064593
258 Ga0070670_100391311
259 Ga0070670_100653445
260 Ga0070682_100001288
261 Ga0070689_100004946
262 Ga0070692_10064487
263 Ga0070669_100462743
264 Ga0070669_100468282
265 Ga0070675_100164863
266 Ga0070673_100333806
267 Ga0070673_100488011
268 Ga0070688_100259072
269 Ga0070659_100529352
270 Ga0070700_100000043
271 Ga0070708_100459612
272 Ga0070707_100059380
273 Ga0070698_100018272
274 Ga0070698_100020729
275 Ga0070699_100006393
276 Ga0070699_100035025
277 Ga0070679_100108413
278 Ga0070679_100125067
279 Ga0070697_100017780
280 Ga0070672_100930547
281 Ga0070695_100056657
282 Ga0070693_100011922
283 Ga0070693_100459666
284 Ga0070693_100465791
285 Ga0070693_100505936
286 Ga0070664_100070888
287 Ga0068857_100281205
288 Ga0068857_100295060
289 Ga0068857_100827556
290 Ga0068854_100076356
291 Ga0068854_100115257
292 Ga0068854_100582553
293 Ga0070702_100045913
294 Ga0068859_100001473
295 Ga0068859_100041130
296 Ga0068859_100076614
297 Ga0068859_100108941
298 Ga0068859_100254685
299 Ga0068859_100271676
300 Ga0068859_100640150
301 Ga0068864_100033751
302 Ga0068864_100479655
303 Ga0068864_100528904
304 Ga0068861_100196822
305 Ga0068870_10026359
306 Ga0068870_10146024
307 Ga0068863_100283532
308 Ga0068858_100033367
309 Ga0068858_100083486
310 Ga0068858_100403016
311 Ga0068860_100192912
312 Ga0068860_100275958
313 Ga0068862_100233738
314 Ga0068862_100334065
315 Ga0075428_101241264
316 Ga0075430_100070693
317 Ga0075431_100156176
318 Ga0075431_100176347
319 Ga0075433_10074794
320 Ga0075433_10093020
321 Ga0075433_10221487
322 Ga0075433_10246686
323 Ga0075433_10306836
324 Ga0075429_100027003
325 Ga0097620_100001473
326 Ga0097620_100041130
327 Ga0097620_100076617
328 Ga0097620_100108939
329 Ga0097620_100254677
330 Ga0097620_100271691
331 Ga0097620_100640147
332 Ga0105251_10028765
333 Ga0111539_10034011
334 Ga0105247_10047205
335 Ga0105247_10085173
336 Ga0105247_10135768
337 Ga0114129_10039998
338 Ga0114129_10124938
339 Ga0114129_10185289
340 Ga0105243_10655444
341 Ga0105243_10778914
342 Ga0105241_10037892
343 Ga0105242_10232588
344 Ga0105242_10303398
345 Ga0105248_10002058
346 Ga0105248_10109850
347 Ga0105248_10135869
348 Ga0105248_10169857
349 Ga0105248_10403458
350 Ga0105248_10587972
351 Ga0105237_10081345
352 Ga0105238_10000527
353 Ga0105249_10002486
354 Ga0105249_10137194
355 Ga0105249_10461004
356 Ga0105249_10897975
357 Ga0105239_10259564
358 Ga0157373_10025849
359 Ga0157373_10053451
360 Ga0157378_10178370
361 Ga0157378_10935459
362 Ga0157372_10254521
363 Ga0157375_10711291
364 Ga0157375_11411306
365 Ga0163163_10000231
366 Ga0163163_10658228
367 Ga0163163_10703004
368 Ga0157380_10466480
369 Ga0207710_10002241
370 Ga0207647_10005093
371 Ga0207662_10378762
372 Ga0207652_10097618
373 Ga0207652_10172053
374 Ga0207646_10084281
375 Ga0207646_10108478
376 Ga0207681_10568586
377 Ga0207694_10000918
378 Ga0207650_10000022
379 Ga0207650_10193829
380 Ga0207650_10242960
381 Ga0207686_10122536
382 Ga0207686_10662826
383 Ga0207709_10006298
384 Ga0207709_10206515
385 Ga0207670_10001456
386 Ga0207691_10601868
387 Ga0207711_10028896
388 Ga0207711_10092670
389 Ga0207711_10185761
390 Ga0207711_10365448
391 Ga0207711_10757160
392 Ga0207689_10135676
393 Ga0207679_10176582
394 Ga0207679_10484206
395 Ga0207651_10361749
396 Ga0207640_10081139
397 Ga0207640_10090376
398 Ga0207640_10297111
399 Ga0207703_10045204
400 Ga0207703_10287924
401 Ga0207708_10000060
402 Ga0207708_10002010
403 Ga0207641_10190315
404 Ga0207641_10518407
405 Ga0207641_10636964
406 Ga0207648_10038894
407 Ga0207676_10039725
408 Ga0207676_10296063
409 Ga0207676_10357506
410 Ga0207676_10556492
411 Ga0207674_10059486
412 Ga0207674_10113015
413 Ga0207674_10121730
414 Ga0207674_10317509
415 Ga0207675_100073762
416 Ga0207428_10013058
417 Ga0268265_10028705
418 Ga0268265_10140051
419 Ga0268264_10107482
420 Ga0268264_10227098
421 Ga0268264_10647203
422 Ga0314311_1043456
423 Ga0307405_10208298
424 Ga0307410_10230750
425 Ga0307406_10005848
426 Ga0307407_10164024
427 Ga0307412_10259275
428 Ga0307416_100007017
429 Ga0307414_10010991
430 Ga0307414_10560630
431 Ga0307411_10001310
432 Ga0307415_100004809
433 Ga0373942_0003396
434 Ga0373931_0042907
435 Ga0242419_000210
436 Ga0451576_0673910
437 Ga0496108_0290397
438 Ga0496112_0400629
439 Ga0501291_018277
440 Ga0501292_005539
441 Ga0501292_029461
442 Ga0501295_077589
443 Ga0501296_017237
444 Ga0501298_013205
445 Ga0501301_006854
446 Ga0501198_012219
447 Ga0501202_000183
448 Ga0501202_063807
449 Ga0501207_004216
450 Ga0501209_035272
451 Ga0501214_008502
452 Ga0501216_003646
453 Ga0501217_000747
454 Ga0501223_001577
455 Ga0501223_050250
456 Ga0501224_001560
457 Ga0501227_070801
458 Ga0501235_005205
459 Ga0501235_036888
460 Ga0501240_026471
461 Ga0501249_004448
462 Ga0501250_029566
463 Ga0501251_002407
464 Ga0501252_028704
465 Ga0501253_123835
466 Ga0501225_0019696
467 Ga0501225_0057098
468 Ga0501229_003331
469 Ga0501234_026829
470 Ga0501245_026512
471 Ga0501271_016080
472 Ga0501273_005566
473 Ga0501283_008483
474 Ga0501204_030765
475 nmdc:mga05p37_556401_c1
476 nmdc:mga05p37_951194_c1
477 nmdc:mga06r32_501983_c1
478 nmdc:mga08y16_24260_c1
479 nmdc:mga0a205_24168_c1
480 nmdc:mga0a205_30609_c1
481 nmdc:mga0a205_360400_c1
482 nmdc:mga0a205_433305_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8j07-assembly1.cif.gz_s 96nm repeat of human respiratory doublet microtubule and associated axonemal complexes 0.5257 100 137
8cc4-assembly1.cif.gz_A lasb bound to phosphonic acid based inhibitor 0.5184 68 112
4k89-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa strain k solvent tolerant elastase 0.5169 66 112
1esp-assembly1.cif.gz_A neutral protease mutant e144s 0.5142 68 118
8cr7-assembly2.cif.gz_B crystal structure of recombinant lasb from pseudomonas aeruginosa pa7 0.5126 66 112
ID Description Score Start End Superfamily
af_Q9SJG7_52_263_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.6737 40 164 3.40.390.10
af_Q17554_48_254_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.6633 37 74 3.40.390.10
af_I1JCT7_352_571_1.10.390.10 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.5916 48 120 1.10.390.10
2bkeA01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.5498 128 174 1.10.150.20
af_Q9W554_824_931_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.5486 38 114 3.30.2010.10
ID Description Score Start End GO Terms
AF-A0A5M8QY01-F1-model_v4 IrrE N-terminal-like domain-containing protein 0.8984 38 176
AF-A0A413JWZ0-F1-model_v4 IrrE N-terminal-like domain-containing protein 0.8936 37 176
AF-A0A0M7LZM6-F1-model_v4 deleted 0.8927 70 175
AF-A0A4U1BV17-F1-model_v4 IrrE N-terminal-like domain-containing protein 0.8791 37 176
AF-A0A4V1ZL40-F1-model_v4 IrrE N-terminal-like domain-containing protein 0.878 43 176

Map