F353535

General Info

Members Datasets Scaffolds Average Seq Length
241 131 482 82

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100706671|Ga0070714_1007066711
Length 80
Sequence MKVSVADAKNKLPKLIKAVENGEPVTICRRGVPVVDLVPTKEARKTPKFGTLAGRIIIHDPDWWKPMSDEEAEAFIEGRL

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
31 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
48 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
49 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
50 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
70 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
76 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
82 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
84 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
85 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
86 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
108 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
109 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
112 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
115 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
116 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
120 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
123 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
124 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
127 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
128 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
129 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
130 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
131 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.68
Metatranscriptomes 3.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 0.83
Rhizosphere 97.1
Stem 0
Stem Tuber 0
Unclassified 43.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100706671 3300005435 Unclassified 973
2 Ga0070658_10756164 3300005327 Bacteria 844
3 Ga0070683_100664543 3300005329 Unclassified 998
4 Ga0068868_100039021 3300005338 Unclassified 3687
5 Ga0070692_10080611 3300005345 Bacteria 1752
6 Ga0070671_100958893 3300005355 Unclassified 748
7 Ga0070709_10131581 3300005434 Unclassified 1709
8 Ga0070709_11420520 3300005434 Unclassified 562
9 Ga0070714_100067086 3300005435 Bacteria 3093
10 Ga0070714_100106616 3300005435 Bacteria 2476
11 Ga0070714_100226547 3300005435 Bacteria 1720
12 Ga0070714_100423402 3300005435 Unclassified 1262
13 Ga0070714_100771979 3300005435 Bacteria 930
14 Ga0070714_101279208 3300005435 Unclassified 716
15 Ga0070713_100220643 3300005436 Bacteria 1720
16 Ga0070713_100260083 3300005436 Unclassified 1586
17 Ga0070713_100764569 3300005436 Bacteria 925
18 Ga0070710_10003233 3300005437 Bacteria 7717
19 Ga0070708_100062475 3300005445 Bacteria 3331
20 Ga0070708_100081908 3300005445 Bacteria 2923
21 Ga0070708_100135899 3300005445 Bacteria 2277
22 Ga0070708_100302864 3300005445 Unclassified 1505
23 Ga0070708_100802603 3300005445 Unclassified 885
24 Ga0070706_100299442 3300005467 Unclassified 1501
25 Ga0070706_100380354 3300005467 Unclassified 1315
26 Ga0070706_100691742 3300005467 Bacteria 946
27 Ga0070706_101758600 3300005467 Unclassified 564
28 Ga0070707_100180364 3300005468 Bacteria 2058
29 Ga0070707_100196661 3300005468 Bacteria 1965
30 Ga0070707_100204498 3300005468 Bacteria 1925
31 Ga0070707_100229925 3300005468 Bacteria 1805
32 Ga0070707_100335035 3300005468 Unclassified 1470
33 Ga0070707_100418902 3300005468 Unclassified 1300
34 Ga0070707_100422831 3300005468 Bacteria 1293
35 Ga0070707_100573584 3300005468 Unclassified 1091
36 Ga0070707_101090444 3300005468 Bacteria 764
37 Ga0070707_101749428 3300005468 Bacteria 589
38 Ga0070698_100002406 3300005471 Bacteria 20606
39 Ga0070699_100318885 3300005518 Bacteria 1396
40 Ga0070699_100332471 3300005518 Bacteria 1367
41 Ga0070699_100503932 3300005518 Unclassified 1100
42 Ga0070699_100993299 3300005518 Unclassified 769
43 Ga0070679_100477477 3300005530 Bacteria 1191
44 Ga0070684_100614807 3300005535 Unclassified 1011
45 Ga0070684_100674216 3300005535 Bacteria 963
46 Ga0070697_100038233 3300005536 Unclassified 3877
47 Ga0070697_100040431 3300005536 Bacteria 3773
48 Ga0070697_100516460 3300005536 Bacteria 1045
49 Ga0070697_100847087 3300005536 Bacteria 810
50 Ga0068853_100644613 3300005539 Unclassified 1008
51 Ga0070695_100450669 3300005545 Unclassified 986
52 Ga0068856_102222998 3300005614 Unclassified 557
53 Ga0068864_101495072 3300005618 Unclassified 678
54 Ga0070717_10013650 3300006028 Bacteria 6231
55 Ga0070717_10013699 3300006028 Bacteria 6221
56 Ga0070717_10051373 3300006028 Bacteria 3392
57 Ga0070717_10130363 3300006028 Bacteria 2162
58 Ga0070717_10247226 3300006028 Unclassified 1575
59 Ga0070717_10291788 3300006028 Bacteria 1448
60 Ga0070717_11010578 3300006028 Unclassified 757
61 Ga0070717_11130234 3300006028 Bacteria 713
62 Ga0070716_100089489 3300006173 Unclassified 1859
63 Ga0070716_100107834 3300006173 Bacteria 1720
64 Ga0070716_101191356 3300006173 Unclassified 611
65 Ga0070712_101002336 3300006175 Unclassified 723
66 Ga0075430_100460668 3300006846 Bacteria 1049
67 Ga0075433_10059700 3300006852 Bacteria 3337
68 Ga0075434_100057071 3300006871 Bacteria 3880
69 Ga0075434_100135934 3300006871 Bacteria 2477
70 Ga0075436_100001449 3300006914 Bacteria 16118
71 Ga0075436_100115607 3300006914 Bacteria 1874
72 Ga0075436_100527992 3300006914 Bacteria 865
73 Ga0075436_101318367 3300006914 Unclassified 546
74 Ga0075436_101535527 3300006914 Unclassified 506
75 Ga0075435_100224137 3300007076 Unclassified 1597
76 Ga0099794_10114255 3300007265 Bacteria 1355
77 Ga0099794_10389015 3300007265 Bacteria 728
78 Ga0099794_10495863 3300007265 Bacteria 642
79 Ga0099794_10764861 3300007265 Unclassified 516
80 Ga0099795_10043413 3300007788 Bacteria 1609
81 Ga0099795_10071375 3300007788 Bacteria 1311
82 Ga0099795_10215121 3300007788 Bacteria 816
83 Ga0105240_10018720 3300009093 Bacteria 9278
84 Ga0111539_10244585 3300009094 Bacteria 2089
85 Ga0114129_10105684 3300009147 Bacteria 3890
86 Ga0105248_12459194 3300009177 Unclassified 593
87 Ga0105237_10243019 3300009545 Bacteria 1801
88 Ga0105237_11431440 3300009545 Bacteria 698
89 Ga0099796_10049842 3300010159 Bacteria 1449
90 Ga0099796_10090774 3300010159 Bacteria 1135
91 Ga0099796_10172799 3300010159 Bacteria 863
92 Ga0099796_10361320 3300010159 Unclassified 628
93 Ga0157371_10052274 3300013102 Bacteria 2902
94 Ga0157370_10043392 3300013104 Bacteria 4328
95 Ga0157369_10285606 3300013105 Bacteria 1718
96 Ga0157369_10406485 3300013105 Bacteria 1412
97 Ga0157374_10522454 3300013296 Unclassified 1193
98 Ga0157372_10008009 3300013307 Bacteria 11240
99 Ga0157372_10253306 3300013307 Bacteria 2044
100 Ga0157372_11543124 3300013307 Bacteria 765
101 Ga0182008_10308993 3300014497 Unclassified 829
102 Ga0157376_10830570 3300014969 Unclassified 938
103 Ga0213872_10052599 3300021361 Unclassified 1848
104 Ga0213872_10154572 3300021361 Unclassified 1000
105 Ga0213872_10342434 3300021361 Unclassified 614
106 Ga0213875_10071840 3300021388 Unclassified 1615
107 Ga0213871_10095696 3300021441 Unclassified 864
108 Ga0213871_10263966 3300021441 Unclassified 549
109 Ga0224570_102642 3300022730 Unclassified 1182
110 Ga0224572_1102376 3300024225 Bacteria 529
111 Ga0228598_1004723 3300024227 Bacteria 2878
112 Ga0207692_10030242 3300025898 Bacteria 2581
113 Ga0207692_10087309 3300025898 Bacteria 1683
114 Ga0207692_10462686 3300025898 Unclassified 800
115 Ga0207647_10246930 3300025904 Bacteria 1024
116 Ga0207699_10241678 3300025906 Bacteria 1241
117 Ga0207699_10824593 3300025906 Unclassified 682
118 Ga0207684_10107812 3300025910 Bacteria 2383
119 Ga0207684_10116366 3300025910 Unclassified 2291
120 Ga0207684_11037274 3300025910 Unclassified 685
121 Ga0207707_10599159 3300025912 Bacteria 933
122 Ga0207695_10033456 3300025913 Bacteria 5605
123 Ga0207693_10437790 3300025915 Unclassified 1022
124 Ga0207663_11666194 3300025916 Unclassified 513
125 Ga0207652_10650927 3300025921 Bacteria 942
126 Ga0207646_10275222 3300025922 Unclassified 1521
127 Ga0207646_10381809 3300025922 Bacteria 1273
128 Ga0207646_10428166 3300025922 Bacteria 1194
129 Ga0207646_10582902 3300025922 Unclassified 1004
130 Ga0207646_11124242 3300025922 Unclassified 691
131 Ga0207646_11833408 3300025922 Unclassified 518
132 Ga0207700_10364035 3300025928 Bacteria 1261
133 Ga0207700_10600162 3300025928 Bacteria 980
134 Ga0207700_11755851 3300025928 Unclassified 546
135 Ga0207700_11942040 3300025928 Unclassified 515
136 Ga0207664_10084303 3300025929 Bacteria 2592
137 Ga0207664_10151093 3300025929 Bacteria 1973
138 Ga0207664_10623956 3300025929 Unclassified 968
139 Ga0207664_10923980 3300025929 Unclassified 783
140 Ga0207664_10998524 3300025929 Bacteria 750
141 Ga0207665_10262118 3300025939 Bacteria 1281
142 Ga0207665_10555103 3300025939 Unclassified 893
143 Ga0207711_11070676 3300025941 Unclassified 747
144 Ga0207639_10174048 3300026041 Bacteria 1825
145 Ga0207698_11488868 3300026142 Bacteria 692
146 Ga0209179_1042807 3300027512 Bacteria 956
147 Ga0209179_1142070 3300027512 Unclassified 536
148 Ga0209588_1042195 3300027671 Unclassified 1473
149 Ga0265356_1006953 3300028017 Bacteria 1313
150 Ga0265357_1035151 3300028023 Unclassified 580
151 Ga0265338_11090994 3300028800 Unclassified 538
152 Ga0265762_1010359 3300030760 Unclassified 1665
153 Ga0265762_1014448 3300030760 Unclassified 1425
154 Ga0265762_1150503 3300030760 Unclassified 553
155 Ga0265770_1031092 3300030878 Bacteria 894
156 Ga0265760_10004814 3300031090 Bacteria 3867
157 Ga0265760_10005325 3300031090 Bacteria 3690
158 Ga0265760_10069013 3300031090 Unclassified 1082
159 Ga0265760_10119211 3300031090 Bacteria 846
160 Ga0265330_10023974 3300031235 Bacteria 2768
161 Ga0265325_10542954 3300031241 Unclassified 503
162 Ga0265340_10074833 3300031247 Unclassified 1601
163 Ga0265339_10097230 3300031249 Unclassified 1536
164 Ga0265316_10007966 3300031344 Bacteria 9904
165 Ga0265316_11095252 3300031344 Unclassified 553
166 Ga0265314_10006097 3300031711 Bacteria 10713
167 Ga0316214_1044354 3300033545 Unclassified 641
168 Ga0373936_0006094 3300035113 Bacteria 4543
169 Ga0373945_0192322 3300035116 Bacteria 844
170 Ga0373954_0159275 3300035118 Bacteria 1104
171 Ga0373957_0460747 3300035120 Unclassified 551
172 Ga0373943_0080631 3300035170 Unclassified 1668
173 Ga0373943_0548700 3300035170 Bacteria 678
174 Ga0373943_0555013 3300035170 Bacteria 674
175 Ga0373935_0786650 3300035692 Unclassified 702
176 Ga0373927_0304530 3300035695 Bacteria 1049
177 Ga0373927_0550611 3300035695 Unclassified 762
178 Ga0373927_0591016 3300035695 Bacteria 734
179 Ga0373933_1013145 3300035724 Unclassified 547
180 Ga0373947_0070238 3300035725 Bacteria 2145
181 Ga0373947_0218624 3300035725 Unclassified 1252
182 Ga0373947_0609046 3300035725 Unclassified 744
183 Ga0373937_0075010 3300036401 Plasmid 3122
184 Ga0373937_0155884 3300036401 Bacteria 2140
185 Ga0373937_0382555 3300036401 Bacteria 1335
186 Ga0373925_0084336 3300037068 Bacteria 2421
187 Ga0373925_1594943 3300037068 Unclassified 533
188 Ga0395900_0213628 3300037418 Bacteria 1947
189 Ga0395898_1043971 3300037466 Unclassified 752
190 Ga0436364_0158019 3300037853 Bacteria 21351
191 Ga0436364_0357298 3300037853 Unclassified 987
192 Ga0395901_1022555 3300038443 Unclassified 801
193 Ga0436360_0155361 3300039438 Bacteria 2125
194 Ga0436360_0385725 3300039438 Unclassified 656
195 Ga0436360_0871702 3300039438 Bacteria 3634
196 Ga0436360_0899094 3300039438 Bacteria 802
197 Ga0436361_0001429 3300039447 Unclassified 2259
198 Ga0436361_0021865 3300039447 Unclassified 1324
199 Ga0436361_0514702 3300039447 Bacteria 673
200 Ga0436361_0839710 3300039447 Bacteria 5631
201 Ga0466961_0374803 3300044693 Bacteria 865
202 Ga0466963_0400023 3300044694 Unclassified 968
203 Ga0466957_0000579 3300044842 Bacteria 18515
204 Ga0451576_1201831 3300045051 Bacteria 792
205 Ga0466958_0143607 3300045836 Bacteria 1504
206 Ga0466967_0018519 3300045976 Bacteria 5568
207 Ga0495590_0021008 3300046457 Bacteria 2317
208 Ga0495580_0003599 3300046472 Bacteria 13139
209 Ga0495580_0005341 3300046472 Bacteria 10644
210 Ga0495580_0409075 3300046472 Unclassified 914
211 Ga0495582_0071553 3300046473 Unclassified 1919
212 Ga0495639_0648666 3300046475 Bacteria 544
213 Ga0495665_0369545 3300046531 Bacteria 729
214 Ga0495587_0080779 3300046536 Bacteria 1884
215 Ga0495587_0363370 3300046536 Unclassified 806
216 Ga0495669_0048224 3300046684 Bacteria 1905
217 Ga0495669_0522094 3300046684 Unclassified 578
218 Ga0495604_0969534 3300047317 Unclassified 528
219 Ga0495674_0192051 3300047319 Bacteria 1697
220 Ga0495602_0019719 3300048088 Bacteria 6684
221 Ga0496100_1329531 3300048903 Unclassified 567
222 Ga0496108_1693239 3300048911 Unclassified 521
223 Ga0501036_0709984 3300049572 Unclassified 831
224 Ga0501040_0048668 3300049576 Bacteria 2897
225 Ga0501075_1260056 3300049591 Unclassified 561
226 Ga0501076_0450443 3300049592 Bacteria 1060
227 Ga0501080_1086319 3300049742 Bacteria 691
228 Ga0501081_0605065 3300049743 Unclassified 821
229 Ga0501083_0207514 3300049744 Bacteria 1278
230 nmdc:mga0qj67_334390_c1 3300050509 Bacteria 1225
231 nmdc:mga08y16_205902_c1 3300050511 Bacteria 2038
232 nmdc:mga0n895_249849_c1 3300050512 Bacteria 1800
233 nmdc:mga0n895_32508_c1 3300050512 Bacteria 5008
234 nmdc:mga0n895_668022_c1 3300050512 Bacteria 1037
235 nmdc:mga0rr50_163343_c1 3300050513 Unclassified 1809
236 nmdc:mga0rr50_1850180_c1 3300050513 Unclassified 508
237 nmdc:mga08x19_2926_c1 3300050514 Bacteria 10270
238 nmdc:mga08x19_55934_c1 3300050514 Plasmid 2545
239 Ga0495601_0255983 3300053077 Unclassified 1143
240 Ga0500590_204452 3300053148 Unclassified 832
241 Ga0501084_0193766 3300054114 Bacteria 1715
242 Ga0070714_100706671
243 Ga0070658_10756164
244 Ga0070683_100664543
245 Ga0068868_100039021
246 Ga0070692_10080611
247 Ga0070671_100958893
248 Ga0070709_10131581
249 Ga0070709_11420520
250 Ga0070714_100067086
251 Ga0070714_100106616
252 Ga0070714_100226547
253 Ga0070714_100423402
254 Ga0070714_100771979
255 Ga0070714_101279208
256 Ga0070713_100220643
257 Ga0070713_100260083
258 Ga0070713_100764569
259 Ga0070710_10003233
260 Ga0070708_100062475
261 Ga0070708_100081908
262 Ga0070708_100135899
263 Ga0070708_100302864
264 Ga0070708_100802603
265 Ga0070706_100299442
266 Ga0070706_100380354
267 Ga0070706_100691742
268 Ga0070706_101758600
269 Ga0070707_100180364
270 Ga0070707_100196661
271 Ga0070707_100204498
272 Ga0070707_100229925
273 Ga0070707_100335035
274 Ga0070707_100418902
275 Ga0070707_100422831
276 Ga0070707_100573584
277 Ga0070707_101090444
278 Ga0070707_101749428
279 Ga0070698_100002406
280 Ga0070699_100318885
281 Ga0070699_100332471
282 Ga0070699_100503932
283 Ga0070699_100993299
284 Ga0070679_100477477
285 Ga0070684_100614807
286 Ga0070684_100674216
287 Ga0070697_100038233
288 Ga0070697_100040431
289 Ga0070697_100516460
290 Ga0070697_100847087
291 Ga0068853_100644613
292 Ga0070695_100450669
293 Ga0068856_102222998
294 Ga0068864_101495072
295 Ga0070717_10013650
296 Ga0070717_10013699
297 Ga0070717_10051373
298 Ga0070717_10130363
299 Ga0070717_10247226
300 Ga0070717_10291788
301 Ga0070717_11010578
302 Ga0070717_11130234
303 Ga0070716_100089489
304 Ga0070716_100107834
305 Ga0070716_101191356
306 Ga0070712_101002336
307 Ga0075430_100460668
308 Ga0075433_10059700
309 Ga0075434_100057071
310 Ga0075434_100135934
311 Ga0075436_100001449
312 Ga0075436_100115607
313 Ga0075436_100527992
314 Ga0075436_101318367
315 Ga0075436_101535527
316 Ga0075435_100224137
317 Ga0099794_10114255
318 Ga0099794_10389015
319 Ga0099794_10495863
320 Ga0099794_10764861
321 Ga0099795_10043413
322 Ga0099795_10071375
323 Ga0099795_10215121
324 Ga0105240_10018720
325 Ga0111539_10244585
326 Ga0114129_10105684
327 Ga0105248_12459194
328 Ga0105237_10243019
329 Ga0105237_11431440
330 Ga0099796_10049842
331 Ga0099796_10090774
332 Ga0099796_10172799
333 Ga0099796_10361320
334 Ga0157371_10052274
335 Ga0157370_10043392
336 Ga0157369_10285606
337 Ga0157369_10406485
338 Ga0157374_10522454
339 Ga0157372_10008009
340 Ga0157372_10253306
341 Ga0157372_11543124
342 Ga0182008_10308993
343 Ga0157376_10830570
344 Ga0213872_10052599
345 Ga0213872_10154572
346 Ga0213872_10342434
347 Ga0213875_10071840
348 Ga0213871_10095696
349 Ga0213871_10263966
350 Ga0224570_102642
351 Ga0224572_1102376
352 Ga0228598_1004723
353 Ga0207692_10030242
354 Ga0207692_10087309
355 Ga0207692_10462686
356 Ga0207647_10246930
357 Ga0207699_10241678
358 Ga0207699_10824593
359 Ga0207684_10107812
360 Ga0207684_10116366
361 Ga0207684_11037274
362 Ga0207707_10599159
363 Ga0207695_10033456
364 Ga0207693_10437790
365 Ga0207663_11666194
366 Ga0207652_10650927
367 Ga0207646_10275222
368 Ga0207646_10381809
369 Ga0207646_10428166
370 Ga0207646_10582902
371 Ga0207646_11124242
372 Ga0207646_11833408
373 Ga0207700_10364035
374 Ga0207700_10600162
375 Ga0207700_11755851
376 Ga0207700_11942040
377 Ga0207664_10084303
378 Ga0207664_10151093
379 Ga0207664_10623956
380 Ga0207664_10923980
381 Ga0207664_10998524
382 Ga0207665_10262118
383 Ga0207665_10555103
384 Ga0207711_11070676
385 Ga0207639_10174048
386 Ga0207698_11488868
387 Ga0209179_1042807
388 Ga0209179_1142070
389 Ga0209588_1042195
390 Ga0265356_1006953
391 Ga0265357_1035151
392 Ga0265338_11090994
393 Ga0265762_1010359
394 Ga0265762_1014448
395 Ga0265762_1150503
396 Ga0265770_1031092
397 Ga0265760_10004814
398 Ga0265760_10005325
399 Ga0265760_10069013
400 Ga0265760_10119211
401 Ga0265330_10023974
402 Ga0265325_10542954
403 Ga0265340_10074833
404 Ga0265339_10097230
405 Ga0265316_10007966
406 Ga0265316_11095252
407 Ga0265314_10006097
408 Ga0316214_1044354
409 Ga0373936_0006094
410 Ga0373945_0192322
411 Ga0373954_0159275
412 Ga0373957_0460747
413 Ga0373943_0080631
414 Ga0373943_0548700
415 Ga0373943_0555013
416 Ga0373935_0786650
417 Ga0373927_0304530
418 Ga0373927_0550611
419 Ga0373927_0591016
420 Ga0373933_1013145
421 Ga0373947_0070238
422 Ga0373947_0218624
423 Ga0373947_0609046
424 Ga0373937_0075010
425 Ga0373937_0155884
426 Ga0373937_0382555
427 Ga0373925_0084336
428 Ga0373925_1594943
429 Ga0395900_0213628
430 Ga0395898_1043971
431 Ga0436364_0158019
432 Ga0436364_0357298
433 Ga0395901_1022555
434 Ga0436360_0155361
435 Ga0436360_0385725
436 Ga0436360_0871702
437 Ga0436360_0899094
438 Ga0436361_0001429
439 Ga0436361_0021865
440 Ga0436361_0514702
441 Ga0436361_0839710
442 Ga0466961_0374803
443 Ga0466963_0400023
444 Ga0466957_0000579
445 Ga0451576_1201831
446 Ga0466958_0143607
447 Ga0466967_0018519
448 Ga0495590_0021008
449 Ga0495580_0003599
450 Ga0495580_0005341
451 Ga0495580_0409075
452 Ga0495582_0071553
453 Ga0495639_0648666
454 Ga0495665_0369545
455 Ga0495587_0080779
456 Ga0495587_0363370
457 Ga0495669_0048224
458 Ga0495669_0522094
459 Ga0495604_0969534
460 Ga0495674_0192051
461 Ga0495602_0019719
462 Ga0496100_1329531
463 Ga0496108_1693239
464 Ga0501036_0709984
465 Ga0501040_0048668
466 Ga0501075_1260056
467 Ga0501076_0450443
468 Ga0501080_1086319
469 Ga0501081_0605065
470 Ga0501083_0207514
471 nmdc:mga0qj67_334390_c1
472 nmdc:mga08y16_205902_c1
473 nmdc:mga0n895_249849_c1
474 nmdc:mga0n895_32508_c1
475 nmdc:mga0n895_668022_c1
476 nmdc:mga0rr50_163343_c1
477 nmdc:mga0rr50_1850180_c1
478 nmdc:mga08x19_2926_c1
479 nmdc:mga08x19_55934_c1
480 Ga0495601_0255983
481 Ga0500590_204452
482 Ga0501084_0193766

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02604

PhdYeFM_antitox

Antitoxin Phd_YefM, type II toxin-antitoxin system

1

48

0.91

Map