F353308

General Info

Members Datasets Scaffolds Average Seq Length
240 175 197 152

Family's Representative Sequence

Representative Sequence 3300053108|Ga0500562_012649|Ga0500562_012649_611_1153
Length 180
Sequence MTKGFDFILILDDHWYLARKTGYKKIRAMIVINNFDEYNAYSGKELGVSEWHTINQDQINRFAAATLDYQWIHVDAEKASREGPFKSTIAHGYLTLSLIPYLWKQIADVRNIKMEINYGIENFKFGQAVLVDSDVQLKAKLKSIVNLRGTVKVVIEATLIIKDQLKPAYTGDVIFLYIFE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2582580736 Prauserella sp. Am3 Isolate Unclassified
4 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
5 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
6 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
7 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
8 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
9 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
10 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
11 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
12 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
13 2738541283 Pedobacter sp. OK701 Isolate Unclassified
14 2738541284 Pedobacter sp. YR016 Isolate Unclassified
15 2738541302 Pedobacter sp. CF074 Isolate Unclassified
16 2739367651 Pedobacter sp. OK291 Isolate Unclassified
17 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
18 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
19 2818991437 Pedobacter terrae 518 Isolate Unclassified
20 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
21 2818991444 Filimonas endophytica 3197 Isolate Unclassified
22 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
23 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
24 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
25 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
26 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
27 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
28 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
29 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
30 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
31 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
32 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
33 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
34 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
35 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
36 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
37 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
38 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
39 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
40 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
41 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
42 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
43 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
44 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
45 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
46 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
47 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
48 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
49 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
50 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
51 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
52 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
53 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
54 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
55 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
71 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
86 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
104 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
105 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
106 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
107 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
108 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
118 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
119 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
120 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
121 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
122 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
129 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
134 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
137 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
144 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
145 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
146 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
149 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
150 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
151 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
152 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
153 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
157 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
158 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
159 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
160 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
161 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
162 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
163 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
164 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
165 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
166 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
167 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
168 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
169 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
170 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
171 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
174 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
175 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.08
Metatranscriptomes 0
Isolates 17.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.83
Nodule 0.42
Rhizoplane 3.75
Rhizosphere 56.67
Stem 0
Stem Tuber 0
Unclassified 23.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1153840 2162886007 Bacteria 1368
2 SwRhRL2b_contig_2825517 2162886007 Bacteria 12669
3 SwRhRL2b_contig_341942 2162886007 Bacteria 47645
4 JGI25152J39213_1000425 3300002773 Bacteria 25324
5 JGI25150J39212_1000049 3300002774 Bacteria 73898
6 JGI25151J46595_10000003 3300003187 Bacteria 715330
7 JGI25153J46596_10000154 3300003215 Bacteria 69318
8 rootH2_10190116 3300003320 Bacteria 6351
9 rootH2_10215392 3300003320 Bacteria 3144
10 rootL2_10009524 3300003322 Bacteria 5814
11 rootL2_10286375 3300003322 Bacteria 2385
12 JGI25160J50197_1007392 3300003354 Bacteria 4305
13 Ga0055535_1005863 3300003761 Bacteria 2603
14 Ga0055542_1003469 3300003762 Bacteria 4253
15 Ga0055531_10000422 3300003794 Bacteria 40052
16 Ga0065165_1042077 3300005262 Bacteria 1351
17 Ga0065714_10002470 3300005288 Bacteria 16742
18 Ga0065714_10004190 3300005288 Bacteria 10413
19 Ga0065714_10064467 3300005288 Bacteria 63317
20 Ga0065714_10066119 3300005288 Bacteria 7572
21 Ga0065714_10080257 3300005288 Bacteria 2454
22 Ga0065714_10203895 3300005288 Bacteria 874
23 Ga0065714_10246089 3300005288 Bacteria 760
24 Ga0065704_10000254 3300005289 Bacteria 51402
25 Ga0065704_10070995 3300005289 Bacteria 13890
26 Ga0065704_10075264 3300005289 Bacteria 5699
27 Ga0065704_10077302 3300005289 Bacteria 4787
28 Ga0065704_10079329 3300005289 Bacteria 4186
29 Ga0065704_10328548 3300005289 Bacteria 841
30 Ga0070660_100172539 3300005339 Bacteria 1747
31 Ga0070689_100060212 3300005340 Bacteria 2951
32 Ga0070674_100289785 3300005356 Bacteria 1301
33 Ga0070708_100043862 3300005445 Bacteria 3931
34 Ga0070708_100606886 3300005445 Bacteria 1032
35 Ga0068867_100112465 3300005459 Bacteria 2094
36 Ga0070707_100079622 3300005468 Bacteria 3162
37 Ga0070697_100336009 3300005536 Bacteria 1303
38 Ga0068857_100096496 3300005577 Bacteria 2649
39 Ga0081539_10007741 3300005985 Bacteria 9630
40 Ga0105244_10045471 3300009036 Bacteria 2258
41 Ga0114129_10296230 3300009147 Bacteria 2158
42 Ga0105243_10000006 3300009148 Bacteria 465541
43 Ga0105242_10022655 3300009176 Bacteria 4944
44 Ga0105237_10032252 3300009545 Bacteria 5304
45 Ga0157329_1004088 3300012491 Unclassified 929
46 Ga0157314_1017485 3300012500 Unclassified 698
47 Ga0157373_10000196 3300013100 Bacteria 49815
48 Ga0157373_10009445 3300013100 Bacteria 7205
49 Ga0157373_10015051 3300013100 Bacteria 5658
50 Ga0157371_10000034 3300013102 Bacteria 223947
51 Ga0157371_10000510 3300013102 Bacteria 46799
52 Ga0157371_10002936 3300013102 Bacteria 15903
53 Ga0157371_10278251 3300013102 Bacteria 1208
54 Ga0157370_10000896 3300013104 Bacteria 37760
55 Ga0157370_10003373 3300013104 Bacteria 18784
56 Ga0157370_10043862 3300013104 Bacteria 4302
57 Ga0157370_10046234 3300013104 Bacteria 4173
58 Ga0157370_10115856 3300013104 Bacteria 2503
59 Ga0157370_10211533 3300013104 Bacteria 1797
60 Ga0157369_10000002 3300013105 Bacteria 524510
61 Ga0163162_10000277 3300013306 Bacteria 46887
62 Ga0157372_10818655 3300013307 Bacteria 1081
63 Ga0157375_10778238 3300013308 Bacteria 1107
64 Ga0182008_10000009 3300014497 Bacteria 331416
65 Ga0182008_10000462 3300014497 Bacteria 31030
66 Ga0182008_10001411 3300014497 Bacteria 16123
67 Ga0182006_1000403 3300015261 Bacteria 35045
68 Ga0182006_1000952 3300015261 Bacteria 19221
69 Ga0182006_1001662 3300015261 Bacteria 13097
70 Ga0182006_1002893 3300015261 Bacteria 9117
71 Ga0182007_10000001 3300015262 Bacteria 1127301
72 Ga0182005_1000067 3300015265 Bacteria 87767
73 Ga0163161_10000700 3300017792 Bacteria 26736
74 Ga0163161_10000839 3300017792 Bacteria 23977
75 Ga0163161_10003764 3300017792 Bacteria 10625
76 Ga0163161_11457741 3300017792 Unclassified 599
77 Ga0213876_10000229 3300021384 Bacteria 54944
78 Ga0209436_100805 3300025208 Bacteria 12842
79 Ga0209258_100193 3300025242 Bacteria 124682
80 Ga0207425_1000004 3300025245 Bacteria 1092421
81 Ga0209148_1000167 3300025254 Bacteria 135407
82 Ga0209129_1000005 3300025258 Bacteria 777812
83 Ga0209025_1000009 3300025294 Bacteria 1092561
84 Ga0209758_1000010 3300025297 Bacteria 1092782
85 Ga0207426_1000912 3300025302 Bacteria 29557
86 Ga0207426_1002568 3300025302 Bacteria 11335
87 Ga0209257_1000280 3300025304 Bacteria 114473
88 Ga0207646_10556276 3300025922 Bacteria 1031
89 Ga0207686_10010884 3300025934 Bacteria 4962
90 Ga0207709_10000007 3300025935 Bacteria 752025
91 Ga0207670_10165382 3300025936 Bacteria 1655
92 Ga0207669_10234109 3300025937 Bacteria 1357
93 Ga0207689_10551942 3300025942 Bacteria 968
94 Ga0207640_11200853 3300025981 Bacteria 674
95 Ga0207648_10092396 3300026089 Bacteria 2646
96 Ga0207674_10818313 3300026116 Bacteria 899
97 Ga0307515_10119134 3300028794 Bacteria 3006
98 Ga0307511_10000960 3300030521 Bacteria 30555
99 Ga0307511_10166202 3300030521 Unclassified 1224
100 Ga0316176_1204851 3300030732 Bacteria 41535
101 Ga0314311_1247567 3300030733 Bacteria 1343
102 Ga0316183_1109514 3300030742 Bacteria 62860
103 Ga0316181_1261343 3300030744 Bacteria 21663
104 Ga0307405_11659429 3300031731 Bacteria 565
105 Ga0307405_12010044 3300031731 Bacteria 517
106 Ga0307407_10000065 3300031903 Bacteria 41572
107 Ga0307412_10000004 3300031911 Bacteria 544053
108 Ga0307409_100046392 3300031995 Bacteria 3289
109 Ga0307416_100000146 3300032002 Bacteria 41573
110 Ga0307414_10000464 3300032004 Bacteria 21296
111 Ga0307414_10000951 3300032004 Bacteria 14797
112 Ga0307414_10016514 3300032004 Bacteria 4490
113 Ga0307414_10023321 3300032004 Bacteria 3923
114 Ga0307414_10026208 3300032004 Bacteria 3749
115 Ga0307414_10035706 3300032004 Bacteria 3311
116 Ga0307414_10344035 3300032004 Bacteria 1278
117 Ga0307414_10499661 3300032004 Bacteria 1076
118 Ga0307411_10492129 3300032005 Bacteria 1035
119 Ga0436365_1234622 3300039437 Bacteria 117941
120 Ga0451787_352956 3300041441 Bacteria 735
121 Ga0451791_1304480 3300041451 Bacteria 801
122 Ga0451793_1498015 3300041452 Bacteria 849
123 Ga0451807_2595384 3300041486 Bacteria 553
124 Ga0439431_0010870 3300041997 Bacteria 2073
125 Ga0439445_0007474 3300042004 Unclassified 2536
126 Ga0453684_0023218 3300044712 Bacteria 9150
127 Ga0451576_0002806 3300045051 Bacteria 25112
128 Ga0495650_0092603 3300046471 Bacteria 1147
129 Ga0495606_0235985 3300046507 Bacteria 1022
130 Ga0495610_0000064 3300046512 Bacteria 125922
131 Ga0495610_0000403 3300046512 Bacteria 44499
132 Ga0495632_0099174 3300046519 Bacteria 1374
133 Ga0495663_0001456 3300046525 Bacteria 7452
134 Ga0495652_0156351 3300046529 Bacteria 1775
135 Ga0495621_0181918 3300046539 Bacteria 839
136 Ga0495645_0286744 3300046543 Bacteria 1081
137 Ga0495633_0408211 3300046558 Bacteria 614
138 Ga0495611_0258790 3300046648 Bacteria 806
139 Ga0495625_0063188 3300046660 Bacteria 2615
140 Ga0495687_053480 3300047443 Bacteria 1700
141 Ga0495593_0414331 3300047673 Bacteria 674
142 Ga0496101_0258190 3300048904 Bacteria 1358
143 Ga0496102_0099038 3300048905 Bacteria 2705
144 Ga0496105_0157392 3300048908 Bacteria 1865
145 Ga0496113_0044527 3300048916 Bacteria 3288
146 Ga0496115_1352591 3300048918 Bacteria 528
147 Ga0496116_0000006 3300048919 Bacteria 811937
148 Ga0496116_0012235 3300048919 Bacteria 7018
149 Ga0496116_0012674 3300048919 Bacteria 6861
150 Ga0496116_0174266 3300048919 Bacteria 1161
151 Ga0496117_0000023 3300048920 Bacteria 438585
152 Ga0496117_0001275 3300048920 Bacteria 37368
153 Ga0496117_0006327 3300048920 Bacteria 12046
154 Ga0496118_0000660 3300048921 Bacteria 56444
155 Ga0496118_0035804 3300048921 Bacteria 4023
156 Ga0496119_0000010 3300048922 Bacteria 438534
157 Ga0496121_0000051 3300048924 Bacteria 315378
158 Ga0496122_0000091 3300048925 Bacteria 204567
159 Ga0496122_0000166 3300048925 Bacteria 157284
160 Ga0496122_0003701 3300048925 Bacteria 19795
161 Ga0496122_0004421 3300048925 Bacteria 17492
162 Ga0496122_0020853 3300048925 Bacteria 5894
163 Ga0496122_0107263 3300048925 Bacteria 1846
164 Ga0496123_0000294 3300048926 Bacteria 97574
165 Ga0496123_0024384 3300048926 Bacteria 4599
166 Ga0496123_0051161 3300048926 Bacteria 2753
167 Ga0496124_0001583 3300048927 Bacteria 32871
168 Ga0496124_0185336 3300048927 Unclassified 1597
169 Ga0496124_0313413 3300048927 Bacteria 1127
170 Ga0496125_0000169 3300048928 Bacteria 145879
171 Ga0496125_0005162 3300048928 Bacteria 14687
172 Ga0496125_0059068 3300048928 Bacteria 3093
173 Ga0501249_008842 3300049679 Bacteria 2092
174 Ga0501241_001279 3300049758 Bacteria 5221
175 nmdc:mga05p37_943337_c1 3300050507 Bacteria 924
176 nmdc:mga0n895_680952_c1 3300050512 Bacteria 1025
177 Ga0500644_0000081 3300053088 Bacteria 58662
178 Ga0500646_0002097 3300053090 Bacteria 5199
179 Ga0500583_0003128 3300053092 Bacteria 5131
180 Ga0500651_0110078 3300053093 Bacteria 1681
181 Ga0500562_000038 3300053108 Bacteria 72186
182 Ga0500562_012649 3300053108 Bacteria 2148
183 Ga0500607_305485 3300053121 Bacteria 584
184 Ga0500658_0001953 3300053134 Bacteria 8070
185 Ga0500559_0024035 3300053136 Bacteria 2590
186 Ga0500573_0184340 3300053140 Bacteria 1120
187 Ga0500577_0000829 3300053142 Bacteria 7998
188 Ga0500588_0230065 3300053146 Bacteria 693
189 Ga0500616_0052927 3300053153 Bacteria 2133
190 Ga0500622_0000132 3300053156 Bacteria 78669
191 Ga0500634_0008373 3300053161 Bacteria 5170
192 Ga0500634_0189377 3300053161 Bacteria 916
193 Ga0500636_0045333 3300053177 Bacteria 2594
194 Ga0500645_070015 3300053730 Bacteria 1007
195 Ga0501084_0000459 3300054114 Bacteria 31419
196 Ga0501084_0752426 3300054114 Bacteria 821
197 Ga0500661_014773 3300055283 Bacteria 1403

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005339 Ga0070660_100172539 Ga0070660_1001725391 130
2 3300048905 Ga0496102_0099038 Ga0496102_0099038_1278_1841 130
3 3300048908 Ga0496105_0157392 Ga0496105_0157392_212_775 130
4 3300048916 Ga0496113_0044527 Ga0496113_0044527_11_574 130
5 3300048919 Ga0496116_0000006 Ga0496116_0000006_726166_726729 130
6 3300048920 Ga0496117_0000023 Ga0496117_0000023_276197_276760 130
7 3300048921 Ga0496118_0000660 Ga0496118_0000660_38032_38595 130
8 3300048922 Ga0496119_0000010 Ga0496119_0000010_161832_162395 130
9 3300048925 Ga0496122_0000166 Ga0496122_0000166_28557_29120 130
10 3300048926 Ga0496123_0000294 Ga0496123_0000294_5538_6101 130
11 3300048927 Ga0496124_0001583 Ga0496124_0001583_15193_15756 130
12 3300048928 Ga0496125_0005162 Ga0496125_0005162_8273_8836 130
13 3300005445 Ga0070708_100606886 Ga0070708_1006068862 134
14 3300005468 Ga0070707_100079622 Ga0070707_1000796223 134
15 3300005536 Ga0070697_100336009 Ga0070697_1003360092 134
16 3300009147 Ga0114129_10296230 Ga0114129_102962303 134
17 3300025922 Ga0207646_10556276 Ga0207646_105562762 134
18 3300050507 nmdc:mga05p37_943337_c1 nmdc:mga05p37_943337_c1_12_428 134
19 3300005340 Ga0070689_100060212 Ga0070689_1000602123 140
20 3300005459 Ga0068867_100112465 Ga0068867_1001124652 140
21 3300025936 Ga0207670_10165382 Ga0207670_101653823 140
22 3300026089 Ga0207648_10092396 Ga0207648_100923963 140
23 3300025942 Ga0207689_10551942 Ga0207689_105519422 141
24 3300003320 rootH2_10215392 rootH2_102153923 146
25 iso_pu_bacteria 2818991442 2819577131 147
26 iso_pu_bacteria 2821136567 2821140416 147
27 iso_pu_bacteria 2883068021 2883071790 147
28 iso_pu_bacteria 2896109856 2896112158 147
29 iso_pu_bacteria 2904467357 2904472836 147
30 iso_pu_bacteria 2929177148 2929182106 147
31 iso_pu_bacteria 2929239360 2929240666 147
32 iso_pu_bacteria 2945977869 2945978037 147
33 iso_pu_bacteria 2946013367 2946016110 147
34 3300005445 Ga0070708_100043862 Ga0070708_1000438621 148
35 iso_pu_bacteria 2511231000 2511234430 148
36 iso_pu_bacteria 2582581278 2585141713 148
37 iso_pu_bacteria 2582581281 2585155785 148
38 iso_pu_bacteria 2582581282 2585160291 148
39 iso_pu_bacteria 2585427687 2586206934 148
40 iso_pu_bacteria 2585428115 2587942035 148
41 iso_pu_bacteria 2585428183 2588215126 148
42 iso_pu_bacteria 2585428184 2588218306 148
43 iso_pu_bacteria 2585428185 2588222378 148
44 iso_pu_bacteria 2721755487 2722726684 148
45 iso_pu_bacteria 2738541283 2738754903 148
46 iso_pu_bacteria 2738541284 2738762898 148
47 iso_pu_bacteria 2738541302 2738853702 148
48 iso_pu_bacteria 2739367651 2739588933 148
49 iso_pu_bacteria 2775506987 2776614459 148
50 iso_pu_bacteria 2816332188 2816873269 148
51 iso_pu_bacteria 2818991437 2819547964 148
52 iso_pu_bacteria 2818991444 2819587324 148
53 iso_pu_bacteria 2842903701 2842905723 148
54 iso_pu_bacteria 2849281842 2849282111 148
55 iso_pu_bacteria 2857627736 2857628607 148
56 iso_pu_bacteria 2871720351 2871721684 148
57 iso_pu_bacteria 2904445276 2904445455 148
58 iso_pu_bacteria 2904780799 2904782231 148
59 iso_pu_bacteria 2919177583 2919179634 148
60 iso_pu_bacteria 2945997725 2946000947 148
61 iso_pu_bacteria 3003233435 3003236626 148
62 iso_pu_bacteria 8003151029 8003154870 148
63 iso_pu_bacteria 8055588893 8055589841 148
64 3300005985 Ga0081539_10007741 Ga0081539_100077414 149
65 3300005356 Ga0070674_100289785 Ga0070674_1002897852 150
66 3300009176 Ga0105242_10022655 Ga0105242_100226556 150
67 3300021384 Ga0213876_10000229 Ga0213876_1000022926 150
68 3300025934 Ga0207686_10010884 Ga0207686_100108846 150
69 3300025937 Ga0207669_10234109 Ga0207669_102341092 150
70 3300039437 Ga0436365_1234622 Ga0436365_1234622_69388_69840 150
71 3300046529 Ga0495652_0156351 Ga0495652_0156351_1164_1616 150
72 3300046543 Ga0495645_0286744 Ga0495645_0286744_189_641 150
73 3300050512 nmdc:mga0n895_680952_c1 nmdc:mga0n895_680952_c1_531_986 150
74 3300053140 Ga0500573_0184340 Ga0500573_0184340_394_861 150
75 3300054114 Ga0501084_0000459 Ga0501084_0000459_16995_17447 150
76 iso_pu_bacteria 2582580736 2583151237 150
77 3300003322 rootL2_10009524 rootL2_100095242 151
78 3300003322 rootL2_10286375 rootL2_102863753 151
79 3300003761 Ga0055535_1005863 Ga0055535_10058633 151
80 3300003762 Ga0055542_1003469 Ga0055542_10034692 151
81 3300003794 Ga0055531_10000422 Ga0055531_1000042223 151
82 3300005262 Ga0065165_1042077 Ga0065165_10420772 151
83 3300005289 Ga0065704_10075264 Ga0065704_100752645 151
84 3300005577 Ga0068857_100096496 Ga0068857_1000964964 151
85 3300012491 Ga0157329_1004088 Ga0157329_10040881 151
86 3300012500 Ga0157314_1017485 Ga0157314_10174851 151
87 3300013102 Ga0157371_10278251 Ga0157371_102782512 151
88 3300015265 Ga0182005_1000067 Ga0182005_100006712 151
89 3300025208 Ga0209436_100805 Ga0209436_10080513 151
90 3300025242 Ga0209258_100193 Ga0209258_10019398 151
91 3300025254 Ga0209148_1000167 Ga0209148_100016718 151
92 3300025302 Ga0207426_1002568 Ga0207426_10025682 151
93 3300025304 Ga0209257_1000280 Ga0209257_100028020 151
94 3300025981 Ga0207640_11200853 Ga0207640_112008531 151
95 3300026116 Ga0207674_10818313 Ga0207674_108183131 151
96 3300028794 Ga0307515_10119134 Ga0307515_101191343 151
97 3300030521 Ga0307511_10000960 Ga0307511_100009602 151
98 3300030521 Ga0307511_10166202 Ga0307511_101662022 151
99 3300032004 Ga0307414_10499661 Ga0307414_104996612 151
100 3300041441 Ga0451787_352956 Ga0451787_352956_138_593 151
101 3300041451 Ga0451791_1304480 Ga0451791_1304480_313_768 151
102 3300041452 Ga0451793_1498015 Ga0451793_1498015_88_543 151
103 3300041486 Ga0451807_2595384 Ga0451807_2595384_48_503 151
104 3300046519 Ga0495632_0099174 Ga0495632_0099174_434_889 151
105 3300046539 Ga0495621_0181918 Ga0495621_0181918_11_484 151
106 3300047443 Ga0495687_053480 Ga0495687_053480_1161_1616 151
107 3300047673 Ga0495593_0414331 Ga0495593_0414331_91_546 151
108 3300048904 Ga0496101_0258190 Ga0496101_0258190_282_788 151
109 3300048918 Ga0496115_1352591 Ga0496115_1352591_28_483 151
110 3300048924 Ga0496121_0000051 Ga0496121_0000051_233321_233776 151
111 3300053088 Ga0500644_0000081 Ga0500644_0000081_30667_31122 151
112 3300053090 Ga0500646_0002097 Ga0500646_0002097_3688_4143 151
113 3300053092 Ga0500583_0003128 Ga0500583_0003128_1472_1927 151
114 3300053121 Ga0500607_305485 Ga0500607_305485_33_488 151
115 3300053134 Ga0500658_0001953 Ga0500658_0001953_5018_5473 151
116 3300053136 Ga0500559_0024035 Ga0500559_0024035_2116_2571 151
117 3300053142 Ga0500577_0000829 Ga0500577_0000829_5559_6014 151
118 3300053146 Ga0500588_0230065 Ga0500588_0230065_125_580 151
119 3300053153 Ga0500616_0052927 Ga0500616_0052927_635_1090 151
120 3300053156 Ga0500622_0000132 Ga0500622_0000132_14372_14827 151
121 3300053161 Ga0500634_0008373 Ga0500634_0008373_815_1270 151
122 3300053177 Ga0500636_0045333 Ga0500636_0045333_751_1206 151
123 3300055283 Ga0500661_014773 Ga0500661_014773_524_979 151
124 2162886007 SwRhRL2b_contig_1153840 SwRhRL2b_0691.00002900 152
125 2162886007 SwRhRL2b_contig_2825517 SwRhRL2b_0969.00001470 152
126 2162886007 SwRhRL2b_contig_341942 SwRhRL2b_0580.00001990 152
127 3300002773 JGI25152J39213_1000425 JGI25152J39213_10004258 152
128 3300002774 JGI25150J39212_1000049 JGI25150J39212_10000498 152
129 3300003187 JGI25151J46595_10000003 JGI25151J46595_100000038 152
130 3300003215 JGI25153J46596_10000154 JGI25153J46596_1000015460 152
131 3300003320 rootH2_10190116 rootH2_1019011610 152
132 3300003354 JGI25160J50197_1007392 JGI25160J50197_10073924 152
133 3300005288 Ga0065714_10002470 Ga0065714_100024707 152
134 3300005288 Ga0065714_10004190 Ga0065714_100041908 152
135 3300005288 Ga0065714_10064467 Ga0065714_100644679 152
136 3300005288 Ga0065714_10066119 Ga0065714_100661194 152
137 3300005288 Ga0065714_10080257 Ga0065714_100802572 152
138 3300005288 Ga0065714_10203895 Ga0065714_102038951 152
139 3300005288 Ga0065714_10246089 Ga0065714_102460891 152
140 3300005289 Ga0065704_10000254 Ga0065704_100002547 152
141 3300005289 Ga0065704_10070995 Ga0065704_100709952 152
142 3300005289 Ga0065704_10077302 Ga0065704_100773023 152
143 3300005289 Ga0065704_10079329 Ga0065704_100793293 152
144 3300005289 Ga0065704_10328548 Ga0065704_103285482 152
145 3300009036 Ga0105244_10045471 Ga0105244_100454713 152
146 3300009148 Ga0105243_10000006 Ga0105243_1000000655 152
147 3300009545 Ga0105237_10032252 Ga0105237_100322526 152
148 3300013100 Ga0157373_10000196 Ga0157373_100001962 152
149 3300013100 Ga0157373_10009445 Ga0157373_100094455 152
150 3300013100 Ga0157373_10015051 Ga0157373_100150512 152
151 3300013102 Ga0157371_10000034 Ga0157371_10000034161 152
152 3300013102 Ga0157371_10000510 Ga0157371_1000051010 152
153 3300013102 Ga0157371_10002936 Ga0157371_1000293611 152
154 3300013104 Ga0157370_10000896 Ga0157370_1000089618 152
155 3300013104 Ga0157370_10003373 Ga0157370_100033733 152
156 3300013104 Ga0157370_10043862 Ga0157370_100438622 152
157 3300013104 Ga0157370_10046234 Ga0157370_100462344 152
158 3300013104 Ga0157370_10115856 Ga0157370_101158562 152
159 3300013104 Ga0157370_10211533 Ga0157370_102115332 152
160 3300013105 Ga0157369_10000002 Ga0157369_10000002114 152
161 3300013306 Ga0163162_10000277 Ga0163162_100002779 152
162 3300013307 Ga0157372_10818655 Ga0157372_108186552 152
163 3300013308 Ga0157375_10778238 Ga0157375_107782381 152
164 3300014497 Ga0182008_10000009 Ga0182008_1000000964 152
165 3300014497 Ga0182008_10000462 Ga0182008_1000046230 152
166 3300014497 Ga0182008_10001411 Ga0182008_100014114 152
167 3300015261 Ga0182006_1000403 Ga0182006_100040312 152
168 3300015261 Ga0182006_1000952 Ga0182006_10009524 152
169 3300015261 Ga0182006_1001662 Ga0182006_10016622 152
170 3300015261 Ga0182006_1002893 Ga0182006_10028934 152
171 3300015262 Ga0182007_10000001 Ga0182007_10000001660 152
172 3300017792 Ga0163161_10000700 Ga0163161_1000070010 152
173 3300017792 Ga0163161_10000839 Ga0163161_1000083912 152
174 3300017792 Ga0163161_10003764 Ga0163161_100037645 152
175 3300017792 Ga0163161_11457741 Ga0163161_114577411 152
176 3300025245 Ga0207425_1000004 Ga0207425_1000004316 152
177 3300025258 Ga0209129_1000005 Ga0209129_1000005624 152
178 3300025294 Ga0209025_1000009 Ga0209025_1000009316 152
179 3300025297 Ga0209758_1000010 Ga0209758_1000010317 152
180 3300025302 Ga0207426_1000912 Ga0207426_100091225 152
181 3300025935 Ga0207709_10000007 Ga0207709_10000007296 152
182 3300030732 Ga0316176_1204851 Ga0316176_120485120 152
183 3300030733 Ga0314311_1247567 Ga0314311_12475672 152
184 3300030742 Ga0316183_1109514 Ga0316183_110951447 152
185 3300030744 Ga0316181_1261343 Ga0316181_126134314 152
186 3300031731 Ga0307405_11659429 Ga0307405_116594292 152
187 3300031731 Ga0307405_12010044 Ga0307405_120100441 152
188 3300031903 Ga0307407_10000065 Ga0307407_1000006518 152
189 3300031911 Ga0307412_10000004 Ga0307412_10000004446 152
190 3300031995 Ga0307409_100046392 Ga0307409_1000463924 152
191 3300032002 Ga0307416_100000146 Ga0307416_10000014617 152
192 3300032004 Ga0307414_10000464 Ga0307414_100004644 152
193 3300032004 Ga0307414_10000951 Ga0307414_100009512 152
194 3300032004 Ga0307414_10016514 Ga0307414_100165143 152
195 3300032004 Ga0307414_10023321 Ga0307414_100233213 152
196 3300032004 Ga0307414_10026208 Ga0307414_100262083 152
197 3300032004 Ga0307414_10035706 Ga0307414_100357061 152
198 3300032004 Ga0307414_10344035 Ga0307414_103440352 152
199 3300032005 Ga0307411_10492129 Ga0307411_104921292 152
200 3300041997 Ga0439431_0010870 Ga0439431_0010870_799_1257 152
201 3300042004 Ga0439445_0007474 Ga0439445_0007474_1638_2096 152
202 3300044712 Ga0453684_0023218 Ga0453684_0023218_4154_4618 152
203 3300045051 Ga0451576_0002806 Ga0451576_0002806_7196_7660 152
204 3300046471 Ga0495650_0092603 Ga0495650_0092603_242_703 152
205 3300046507 Ga0495606_0235985 Ga0495606_0235985_294_752 152
206 3300046512 Ga0495610_0000064 Ga0495610_0000064_104782_105240 152
207 3300046512 Ga0495610_0000403 Ga0495610_0000403_16174_16632 152
208 3300046525 Ga0495663_0001456 Ga0495663_0001456_1965_2423 152
209 3300046558 Ga0495633_0408211 Ga0495633_0408211_40_498 152
210 3300046648 Ga0495611_0258790 Ga0495611_0258790_138_599 152
211 3300046660 Ga0495625_0063188 Ga0495625_0063188_352_813 152
212 3300048919 Ga0496116_0012235 Ga0496116_0012235_1548_2006 152
213 3300048919 Ga0496116_0012674 Ga0496116_0012674_1787_2248 152
214 3300048919 Ga0496116_0174266 Ga0496116_0174266_674_1132 152
215 3300048920 Ga0496117_0001275 Ga0496117_0001275_25133_25591 152
216 3300048920 Ga0496117_0006327 Ga0496117_0006327_1153_1614 152
217 3300048921 Ga0496118_0035804 Ga0496118_0035804_530_991 152
218 3300048925 Ga0496122_0000091 Ga0496122_0000091_139896_140354 152
219 3300048925 Ga0496122_0003701 Ga0496122_0003701_8247_8705 152
220 3300048925 Ga0496122_0004421 Ga0496122_0004421_14132_14623 152
221 3300048925 Ga0496122_0020853 Ga0496122_0020853_2550_3011 152
222 3300048925 Ga0496122_0107263 Ga0496122_0107263_307_765 152
223 3300048926 Ga0496123_0024384 Ga0496123_0024384_3836_4294 152
224 3300048926 Ga0496123_0051161 Ga0496123_0051161_2051_2509 152
225 3300048927 Ga0496124_0185336 Ga0496124_0185336_178_636 152
226 3300048927 Ga0496124_0313413 Ga0496124_0313413_17_478 152
227 3300048928 Ga0496125_0000169 Ga0496125_0000169_117800_118258 152
228 3300048928 Ga0496125_0059068 Ga0496125_0059068_1179_1637 152
229 3300049679 Ga0501249_008842 Ga0501249_008842_403_861 152
230 3300049758 Ga0501241_001279 Ga0501241_001279_3940_4398 152
231 3300053093 Ga0500651_0110078 Ga0500651_0110078_811_1269 152
232 3300053108 Ga0500562_000038 Ga0500562_000038_23022_23480 152
233 3300053108 Ga0500562_012649 Ga0500562_012649_611_1153 152
234 3300053161 Ga0500634_0189377 Ga0500634_0189377_52_510 152
235 3300053730 Ga0500645_070015 Ga0500645_070015_260_718 152
236 3300054114 Ga0501084_0752426 Ga0501084_0752426_171_689 152
237 iso_pu_bacteria 2818991460 2819677487 152
238 iso_pu_bacteria 2842722452 2842726387 152
239 iso_pu_bacteria 2842909656 2842910638 152
240 iso_pu_bacteria 2954016120 2954017858 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

38

163

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c2i-assembly1.cif.gz_B structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis 0.9374 3 149
2c2i-assembly1.cif.gz_B structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis 0.9194 3 149
3k67-assembly1.cif.gz_A crystal structure of protein af1124 from archaeoglobus fulgidus 0.881 14 149
1iq6-assembly1.cif.gz_A (r)-hydratase from a. caviae involved in pha biosynthesis 0.867 14 147
4w78-assembly1.cif.gz_F crystal structure of the chsh1-chsh2 complex from mycobacterium tuberculosis 0.8464 14 150
ID Description Score Start End Superfamily
af_B0G197_51_201_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9448 1 150 3.10.129.10
2c2iB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9365 3 149 3.10.129.10
af_B0G197_51_201_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9329 1 150 3.10.129.10
2c2iB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9183 3 149 3.10.129.10
5cpgB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8846 7 152 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1W2DHA7-F1-model_v4 deleted 0.9932 1 152
AF-A0A519KRP7-F1-model_v4 MaoC family dehydratase 0.9926 85 152
AF-A0A318UM33-F1-model_v4 Acyl dehydratase 0.9906 1 152
AF-A0A1M6UM12-F1-model_v4 Acyl dehydratase 0.9902 1 152
AF-A0A4V1MK01-F1-model_v4 Acyl dehydratase 0.9897 1 152

Feature Viewer

pLDDT pTM Quality
97.16 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map